F464494

General Info

Members Datasets Scaffolds Average Seq Length
567 312 512 264

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10004075|Ga0081455_1000407513
Length 259
Sequence MSRGYRPPAPHPSGARPPVVPASGLPGHVALIMDGNGRWAKQRGLPRTKGHEAGEAALFDVIEGALEVGVRYLSAYAFSTENWRRSPDEVRFLMGFNRAVIRRRRDELHAMGVRVRWSGRPGRLWKSVIDELRSAEEMTRRNDALTLQFCVNYGGRAELADAVRINPDRIDERTIRRYLYAPEIPDVDLFIRSSGEQRTSNFLLWQSSYAEMAFIPTLWPDFDRRHLWAAIEWYADRDRRFGSAIPNPVPGTGVTPSAR

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221575 Microbacterium sp. Root61 Isolate Unclassified
7 2643221616 Leifsonia sp. Root227 Isolate Unclassified
8 2643221711 Terrabacter sp. Root85 Isolate Unclassified
9 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
10 2687453737 Frankia sp. BMG5.36 Isolate Nodule
11 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
12 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
13 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
14 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
15 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
16 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
17 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
18 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
19 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
20 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
21 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
22 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
23 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
24 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
25 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
26 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
27 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
28 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
29 2857727296 Kocuria sp. R-72562 Isolate Unclassified
30 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
31 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
32 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
33 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
34 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
35 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
36 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
37 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
38 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
39 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
40 2919069694 Microbacterium sp. 1154 Isolate Unclassified
41 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
42 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
43 2920879853 Kocuria salina CV6 Isolate Unclassified
44 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
45 2928153084 Leifsonia sp. 563 Isolate Unclassified
46 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
47 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
48 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
49 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
50 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
51 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
52 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
198 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
199 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
306 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
309 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
310 8002775197 Frankia nepalensis CN7 Isolate Nodule
311 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
312 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.71
Metatranscriptomes 1.59
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0.71
Rhizoplane 7.05
Rhizosphere 71.08
Stem 0
Stem Tuber 0.18
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10016514 3300002067 Bacteria 2289
2 JGI25164J39214_1002166 3300002772 Bacteria 3264
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 Ga0006562J51391_1028901 3300003578 Bacteria 3870
5 Ga0006562J51391_1028902 3300003578 Bacteria 2357
6 Ga0006562J51391_1039029 3300003578 Bacteria 3280
7 Ga0006562J51391_1169475 3300003578 Bacteria 2100
8 Ga0006562J51391_1169476 3300003578 Bacteria 2030
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000221 3300003759 Bacteria 62301
12 Ga0055525_1000365 3300003759 Bacteria 30386
13 Ga0055527_1000001 3300003760 Bacteria 850044
14 Ga0055529_1000018 3300003763 Bacteria 344344
15 Ga0055541_1009324 3300003841 Bacteria 1523
16 Ga0070658_10000833 3300005327 Bacteria 26391
17 Ga0070658_10075378 3300005327 Bacteria 2767
18 Ga0070658_10121672 3300005327 Bacteria 2169
19 Ga0070658_10168885 3300005327 Bacteria 1837
20 Ga0070683_100013636 3300005329 Bacteria 7094
21 Ga0070682_100164986 3300005337 Bacteria 1534
22 Ga0068868_100029730 3300005338 Bacteria 4186
23 Ga0070660_100133225 3300005339 Bacteria 1990
24 Ga0070661_100068570 3300005344 Bacteria 2607
25 Ga0070668_100313524 3300005347 Bacteria 1319
26 Ga0070659_100014108 3300005366 Bacteria 5963
27 Ga0070659_100409250 3300005366 Bacteria 1146
28 Ga0070659_100432560 3300005366 Bacteria 1114
29 Ga0070667_100027561 3300005367 Bacteria 4727
30 Ga0070705_100125586 3300005440 Bacteria 1665
31 Ga0070663_100003571 3300005455 Bacteria 8983
32 Ga0070663_100281656 3300005455 Bacteria 1325
33 Ga0070681_10395661 3300005458 Bacteria 1293
34 Ga0070679_100428066 3300005530 Bacteria 1269
35 Ga0068853_100028944 3300005539 Bacteria 4663
36 Ga0070672_100049351 3300005543 Bacteria 3274
37 Ga0070693_100034918 3300005547 Bacteria 2785
38 Ga0068855_100023298 3300005563 Bacteria 7415
39 Ga0068855_100226576 3300005563 Bacteria 2095
40 Ga0068857_100124317 3300005577 Bacteria 2324
41 Ga0068856_100017184 3300005614 Bacteria 7009
42 Ga0068856_100026572 3300005614 Bacteria 5644
43 Ga0068856_100121478 3300005614 Bacteria 2614
44 Ga0068856_100376118 3300005614 Bacteria 1439
45 Ga0070702_100002838 3300005615 Bacteria 7602
46 Ga0068852_100006614 3300005616 Bacteria 8395
47 Ga0068852_100024812 3300005616 Bacteria 4850
48 Ga0068852_100057001 3300005616 Bacteria 3379
49 Ga0068852_100110180 3300005616 Bacteria 2501
50 Ga0068864_100023638 3300005618 Bacteria 5163
51 Ga0068864_100367238 3300005618 Bacteria 1361
52 Ga0068861_100907337 3300005719 Bacteria 835
53 Ga0068851_10000003 3300005834 Bacteria 293018
54 Ga0068863_100018229 3300005841 Bacteria 6721
55 Ga0068863_100380195 3300005841 Bacteria 1379
56 Ga0068858_100014735 3300005842 Bacteria 7358
57 Ga0068862_100001933 3300005844 Bacteria 18801
58 Ga0081455_10000363 3300005937 Bacteria 59814
59 Ga0081455_10004075 3300005937 Bacteria 16549
60 Ga0081455_10076616 3300005937 Bacteria 2754
61 Ga0081538_10116964 3300005981 Bacteria 1292
62 Ga0075365_10000821 3300006038 Bacteria 12815
63 Ga0075365_10017154 3300006038 Bacteria 4422
64 Ga0075363_100068619 3300006048 Bacteria 1923
65 Ga0075364_10005149 3300006051 Bacteria 7580
66 Ga0070715_10009957 3300006163 Bacteria 3371
67 Ga0070716_100001544 3300006173 Bacteria 10324
68 Ga0075367_10018787 3300006178 Bacteria 3820
69 Ga0075431_100486470 3300006847 Bacteria 1226
70 Ga0075429_100006527 3300006880 Bacteria 10092
71 Ga0068865_100038939 3300006881 Bacteria 3221
72 Ga0097620_100000357 3300006931 Bacteria 45626
73 Ga0105240_10006064 3300009093 Bacteria 17858
74 Ga0105240_10060054 3300009093 Bacteria 4741
75 Ga0105240_10296905 3300009093 Bacteria 1850
76 Ga0111539_10010636 3300009094 Bacteria 11585
77 Ga0105245_10149847 3300009098 Bacteria 2205
78 Ga0105245_10467955 3300009098 Bacteria 1272
79 Ga0105247_10090946 3300009101 Bacteria 1937
80 Ga0105247_10531272 3300009101 Bacteria 862
81 Ga0114129_10010043 3300009147 Bacteria 13495
82 Ga0105241_10001064 3300009174 Bacteria 20907
83 Ga0105242_10023921 3300009176 Bacteria 4821
84 Ga0105242_10379007 3300009176 Bacteria 1314
85 Ga0105242_10566617 3300009176 Bacteria 1092
86 Ga0105248_10001478 3300009177 Bacteria 26153
87 Ga0105248_10003592 3300009177 Bacteria 17186
88 Ga0105248_10315030 3300009177 Bacteria 1762
89 Ga0105237_10000131 3300009545 Bacteria 105010
90 Ga0105237_10052484 3300009545 Bacteria 4093
91 Ga0105237_10081585 3300009545 Bacteria 3225
92 Ga0105238_10420233 3300009551 Bacteria 1332
93 Ga0105249_10046438 3300009553 Bacteria 3952
94 Ga0105249_10776647 3300009553 Bacteria 1021
95 Ga0105239_10039388 3300010375 Bacteria 5178
96 Ga0105239_10394648 3300010375 Bacteria 1565
97 Ga0105239_10396574 3300010375 Bacteria 1561
98 Ga0157370_10040504 3300013104 Bacteria 4498
99 Ga0157369_10015044 3300013105 Bacteria 8731
100 Ga0157369_10046604 3300013105 Bacteria 4711
101 Ga0157369_10548092 3300013105 Bacteria 1195
102 Ga0157374_10384569 3300013296 Bacteria 1398
103 Ga0163162_10027684 3300013306 Bacteria 5607
104 Ga0163162_10659700 3300013306 Bacteria 1169
105 Ga0157372_10059728 3300013307 Bacteria 4266
106 Ga0157372_10398338 3300013307 Bacteria 1604
107 Ga0157372_10488787 3300013307 Bacteria 1435
108 Ga0163163_10012121 3300014325 Bacteria 7845
109 Ga0157380_10123667 3300014326 Bacteria 2196
110 Ga0157380_10168720 3300014326 Bacteria 1910
111 Ga0157379_10000058 3300014968 Bacteria 69871
112 Ga0157379_10017991 3300014968 Bacteria 6229
113 Ga0157376_10163493 3300014969 Bacteria 2020
114 Ga0163161_10172108 3300017792 Bacteria 1656
115 Ga0163161_10495716 3300017792 Bacteria 994
116 Ga0206353_10742524 3300020082 Bacteria 1170
117 Ga0206353_11120836 3300020082 Bacteria 19200
118 Ga0206353_11696786 3300020082 Bacteria 1734
119 Ga0206353_11704794 3300020082 Bacteria 1155
120 Ga0209566_100026 3300025225 Bacteria 367457
121 Ga0209674_100001 3300025226 Bacteria 4013750
122 Ga0209672_100006 3300025228 Bacteria 1004497
123 Ga0209147_100868 3300025229 Bacteria 14017
124 Ga0209563_100001 3300025230 Bacteria 4013775
125 Ga0209563_100461 3300025230 Bacteria 14011
126 Ga0207427_100329 3300025231 Bacteria 31805
127 Ga0209437_100739 3300025233 Bacteria 16245
128 Ga0209677_100001 3300025253 Bacteria 4013787
129 Ga0209677_100523 3300025253 Bacteria 21334
130 Ga0209148_1000015 3300025254 Bacteria 850103
131 Ga0209148_1000828 3300025254 Bacteria 22166
132 Ga0209233_1000001 3300025261 Bacteria 2992747
133 Ga0209233_1013893 3300025261 Bacteria 2288
134 Ga0209455_1000013 3300025272 Bacteria 850103
135 Ga0209455_1000979 3300025272 Bacteria 14449
136 Ga0209455_1019341 3300025272 Bacteria 1379
137 Ga0207656_10000002 3300025321 Bacteria 792178
138 Ga0207692_10344603 3300025898 Bacteria 917
139 Ga0207647_10015825 3300025904 Bacteria 5162
140 Ga0207647_10044805 3300025904 Bacteria 2762
141 Ga0207685_10024569 3300025905 Bacteria 2068
142 Ga0207705_10000006 3300025909 Bacteria 657147
143 Ga0207705_10025267 3300025909 Bacteria 4241
144 Ga0207705_10082199 3300025909 Bacteria 2349
145 Ga0207705_10293633 3300025909 Bacteria 1245
146 Ga0207654_10000001 3300025911 Bacteria 1816198
147 Ga0207707_10000220 3300025912 Bacteria 61279
148 Ga0207695_10006059 3300025913 Bacteria 15782
149 Ga0207695_10025529 3300025913 Bacteria 6612
150 Ga0207671_10000002 3300025914 Bacteria 1144816
151 Ga0207671_10024829 3300025914 Bacteria 4504
152 Ga0207671_10026815 3300025914 Bacteria 4311
153 Ga0207693_10001931 3300025915 Bacteria 18156
154 Ga0207660_10000997 3300025917 Bacteria 18782
155 Ga0207662_10057162 3300025918 Bacteria 2331
156 Ga0207657_10025274 3300025919 Bacteria 5480
157 Ga0207657_10088806 3300025919 Bacteria 2583
158 Ga0207649_10017423 3300025920 Bacteria 4071
159 Ga0207652_10000471 3300025921 Bacteria 41340
160 Ga0207652_10160407 3300025921 Bacteria 2016
161 Ga0207694_10000092 3300025924 Bacteria 100605
162 Ga0207694_10163248 3300025924 Bacteria 1800
163 Ga0207650_10227902 3300025925 Bacteria 1502
164 Ga0207659_10436179 3300025926 Bacteria 1101
165 Ga0207687_10084305 3300025927 Bacteria 2303
166 Ga0207687_10111005 3300025927 Bacteria 2035
167 Ga0207687_10231320 3300025927 Bacteria 1460
168 Ga0207664_10014767 3300025929 Bacteria 5653
169 Ga0207664_10147835 3300025929 Bacteria 1994
170 Ga0207690_10001146 3300025932 Bacteria 16853
171 Ga0207690_10175044 3300025932 Bacteria 1611
172 Ga0207706_10324820 3300025933 Bacteria 1339
173 Ga0207665_10000952 3300025939 Bacteria 19599
174 Ga0207691_10060547 3300025940 Bacteria 3439
175 Ga0207711_10000060 3300025941 Bacteria 127720
176 Ga0207711_10004780 3300025941 Bacteria 11496
177 Ga0207711_10004873 3300025941 Bacteria 11391
178 Ga0207711_10080057 3300025941 Bacteria 2853
179 Ga0207661_10058908 3300025944 Bacteria 3093
180 Ga0207661_10102850 3300025944 Bacteria 2403
181 Ga0207667_10006393 3300025949 Bacteria 14282
182 Ga0207667_10014728 3300025949 Bacteria 8899
183 Ga0207712_10017638 3300025961 Bacteria 4641
184 Ga0207712_10149101 3300025961 Bacteria 1805
185 Ga0207668_10696407 3300025972 Bacteria 893
186 Ga0207658_10009467 3300025986 Bacteria 6609
187 Ga0207658_10164439 3300025986 Bacteria 1821
188 Ga0207677_10020532 3300026023 Bacteria 4013
189 Ga0207677_10508549 3300026023 Bacteria 1043
190 Ga0207703_10000009 3300026035 Bacteria 343983
191 Ga0207703_10000031 3300026035 Bacteria 196940
192 Ga0207703_10208222 3300026035 Bacteria 1742
193 Ga0207639_10033026 3300026041 Bacteria 3814
194 Ga0207639_10260722 3300026041 Bacteria 1516
195 Ga0207678_10085543 3300026067 Bacteria 2696
196 Ga0207678_10102979 3300026067 Bacteria 2437
197 Ga0207678_10534638 3300026067 Bacteria 1024
198 Ga0207678_10924990 3300026067 Bacteria 771
199 Ga0207708_10242050 3300026075 Bacteria 1451
200 Ga0207702_10070091 3300026078 Bacteria 3015
201 Ga0207702_10110798 3300026078 Bacteria 2440
202 Ga0207702_10189466 3300026078 Bacteria 1899
203 Ga0207641_10003481 3300026088 Bacteria 13948
204 Ga0207648_10080635 3300026089 Bacteria 2839
205 Ga0207674_10004399 3300026116 Bacteria 16981
206 Ga0207674_10033183 3300026116 Bacteria 5405
207 Ga0207674_10105779 3300026116 Bacteria 2792
208 Ga0207674_10107019 3300026116 Bacteria 2773
209 Ga0207674_10152334 3300026116 Bacteria 2269
210 Ga0207674_10480524 3300026116 Bacteria 1201
211 Ga0207675_100009028 3300026118 Bacteria 9353
212 Ga0207683_10033049 3300026121 Bacteria 4493
213 Ga0207683_10084642 3300026121 Bacteria 2819
214 Ga0207698_10000277 3300026142 Bacteria 31170
215 Ga0207698_10056228 3300026142 Bacteria 3037
216 Ga0207698_10057880 3300026142 Bacteria 3001
217 Ga0207698_10115846 3300026142 Bacteria 2257
218 Ga0207698_10161729 3300026142 Bacteria 1959
219 Ga0268265_10000024 3300028380 Bacteria 266266
220 Ga0265338_10079749 3300028800 Bacteria 2753
221 Ga0265330_10102461 3300031235 Bacteria 1225
222 Ga0265325_10011674 3300031241 Bacteria 5041
223 Ga0265340_10044478 3300031247 Bacteria 2172
224 Ga0307514_10056760 3300031649 Bacteria 3003
225 Ga0316579_10004999 3300031691 Bacteria 5319
226 Ga0316579_10014531 3300031691 Bacteria 3406
227 Ga0265314_10051789 3300031711 Bacteria 2858
228 Ga0265342_10037249 3300031712 Bacteria 2967
229 Ga0316576_10000788 3300031727 Bacteria 15928
230 Ga0316576_10010618 3300031727 Bacteria 5995
231 Ga0316576_10047287 3300031727 Bacteria 3117
232 Ga0316578_10001133 3300031728 Bacteria 10445
233 Ga0316578_10002828 3300031728 Bacteria 7758
234 Ga0316577_10003953 3300031733 Bacteria 7578
235 Ga0316577_10193902 3300031733 Bacteria 1148
236 Ga0307413_10411219 3300031824 Bacteria 1063
237 Ga0307410_10015490 3300031852 Bacteria 4524
238 Ga0307406_10000833 3300031901 Bacteria 17322
239 Ga0307407_10035365 3300031903 Bacteria 2744
240 Ga0307409_100056726 3300031995 Bacteria 3030
241 Ga0307409_100446300 3300031995 Bacteria 1247
242 Ga0307409_100774845 3300031995 Bacteria 965
243 Ga0307416_100051319 3300032002 Bacteria 3294
244 Ga0307416_100060492 3300032002 Bacteria 3085
245 Ga0307414_10425427 3300032004 Bacteria 1159
246 Ga0316583_10010540 3300032133 Bacteria 3334
247 Ga0316583_10056409 3300032133 Bacteria 1380
248 Ga0316585_10003151 3300032137 Bacteria 4502
249 Ga0316585_10040948 3300032137 Bacteria 1476
250 Ga0316580_10004593 3300032139 Bacteria 4010
251 Ga0316580_10004781 3300032139 Bacteria 3935
252 Ga0373956_0002961 3300035119 Bacteria 6874
253 Ga0316574_0014337 3300035398 Bacteria 4578
254 Ga0316574_0042442 3300035398 Bacteria 2806
255 Ga0316574_0089402 3300035398 Bacteria 1962
256 Ga0373931_0100571 3300035691 Bacteria 1626
257 Ga0316582_0015780 3300036647 Bacteria 4329
258 Ga0316584_0013835 3300036712 Bacteria 5725
259 Ga0316584_0022197 3300036712 Bacteria 4626
260 Ga0316584_0047693 3300036712 Bacteria 3200
261 Ga0395899_0000786 3300037312 Bacteria 31058
262 Ga0395900_0012475 3300037418 Bacteria 8689
263 Ga0395900_0120195 3300037418 Bacteria 2696
264 Ga0395900_0363044 3300037418 Bacteria 1419
265 Ga0395900_0488961 3300037418 Bacteria 1182
266 Ga0395898_0000752 3300037466 Bacteria 56634
267 Ga0395898_0032253 3300037466 Bacteria 5228
268 Ga0395898_0128878 3300037466 Bacteria 2424
269 Ga0395905_0022729 3300037471 Bacteria 5930
270 Ga0436364_0514406 3300037853 Bacteria 1164
271 Ga0395901_0000920 3300038443 Bacteria 32069
272 Ga0395901_0013301 3300038443 Bacteria 8359
273 Ga0395901_0146054 3300038443 Bacteria 2486
274 Ga0395901_0189658 3300038443 Bacteria 2156
275 Ga0395901_0246637 3300038443 Bacteria 1861
276 Ga0395901_0397633 3300038443 Bacteria 1416
277 Ga0395901_0525919 3300038443 Bacteria 1201
278 Ga0451847_0757701 3300041503 Bacteria 1340
279 Ga0451853_4030682 3300041512 Bacteria 3322
280 Ga0466972_0046432 3300044658 Bacteria 2102
281 Ga0466965_0000002 3300044683 Bacteria 297957
282 Ga0466965_0008852 3300044683 Bacteria 4667
283 Ga0466965_0061679 3300044683 Bacteria 1874
284 Ga0466965_0079457 3300044683 Bacteria 1657
285 Ga0466965_0136936 3300044683 Bacteria 1273
286 Ga0466965_0193558 3300044683 Bacteria 1076
287 Ga0466966_0037291 3300044684 Bacteria 3136
288 Ga0466966_0216302 3300044684 Bacteria 1157
289 Ga0466961_0086236 3300044693 Bacteria 1984
290 Ga0466961_0141798 3300044693 Bacteria 1504
291 Ga0466961_0398898 3300044693 Bacteria 835
292 Ga0466963_0192750 3300044694 Bacteria 1424
293 Ga0466963_0238085 3300044694 Bacteria 1276
294 Ga0466963_0385502 3300044694 Bacteria 988
295 Ga0466971_0011351 3300044719 Bacteria 3901
296 Ga0466971_0020548 3300044719 Bacteria 2936
297 Ga0466970_0028362 3300044765 Bacteria 2940
298 Ga0466970_0031042 3300044765 Bacteria 2820
299 Ga0466957_0072866 3300044842 Bacteria 2128
300 Ga0466957_0073490 3300044842 Bacteria 2119
301 Ga0466957_0081118 3300044842 Bacteria 2020
302 Ga0466957_0081347 3300044842 Bacteria 2017
303 Ga0466957_0211079 3300044842 Bacteria 1278
304 Ga0466957_0452020 3300044842 Bacteria 885
305 Ga0466960_0031771 3300044901 Bacteria 2438
306 Ga0466960_0050687 3300044901 Bacteria 2002
307 Ga0466960_0124266 3300044901 Bacteria 1355
308 Ga0466959_0006345 3300045049 Bacteria 8181
309 Ga0466959_0060247 3300045049 Bacteria 2762
310 Ga0466959_0060679 3300045049 Bacteria 2751
311 Ga0466967_0136969 3300045976 Bacteria 2277
312 Ga0466967_0575049 3300045976 Bacteria 1110
313 Ga0466967_0666756 3300045976 Bacteria 1029
314 Ga0495638_0035399 3300046460 Bacteria 3183
315 Ga0495638_0303961 3300046460 Bacteria 858
316 Ga0495653_0108869 3300046463 Bacteria 1995
317 Ga0495650_0001330 3300046471 Bacteria 24757
318 Ga0495664_0286059 3300046477 Bacteria 996
319 Ga0495631_0078123 3300046518 Bacteria 1429
320 Ga0495644_0065000 3300046523 Bacteria 1371
321 Ga0495648_0050573 3300046524 Bacteria 2537
322 Ga0495645_0133853 3300046543 Bacteria 1735
323 Ga0495674_0140275 3300047319 Bacteria 2032
324 Ga0495672_0223123 3300047320 Bacteria 929
325 Ga0495680_0407044 3300047322 Bacteria 938
326 Ga0496100_0057068 3300048903 Bacteria 2556
327 Ga0496100_0210644 3300048903 Bacteria 1421
328 Ga0496101_0006557 3300048904 Bacteria 7496
329 Ga0496101_0064501 3300048904 Bacteria 2668
330 Ga0496102_0004392 3300048905 Bacteria 11911
331 Ga0496102_0090718 3300048905 Bacteria 2828
332 Ga0496102_0162231 3300048905 Bacteria 2103
333 Ga0496103_0024681 3300048906 Bacteria 3627
334 Ga0496104_0034030 3300048907 Bacteria 4750
335 Ga0496104_0084071 3300048907 Bacteria 3036
336 Ga0496104_0149351 3300048907 Bacteria 2244
337 Ga0496104_0355653 3300048907 Bacteria 1377
338 Ga0496104_0371191 3300048907 Bacteria 1343
339 Ga0496105_0004765 3300048908 Bacteria 10243
340 Ga0496105_0016210 3300048908 Bacteria 5946
341 Ga0496105_0066952 3300048908 Bacteria 2965
342 Ga0496105_0083622 3300048908 Bacteria 2636
343 Ga0496105_0155160 3300048908 Bacteria 1880
344 Ga0496106_0204881 3300048909 Bacteria 1571
345 Ga0496107_0192175 3300048910 Bacteria 1517
346 Ga0496107_0401191 3300048910 Bacteria 1020
347 Ga0496108_0284483 3300048911 Bacteria 1439
348 Ga0496109_0045917 3300048912 Bacteria 3966
349 Ga0496109_0342580 3300048912 Bacteria 1412
350 Ga0496110_0047567 3300048913 Bacteria 3758
351 Ga0496110_0083055 3300048913 Bacteria 2857
352 Ga0496111_0118286 3300048914 Bacteria 1956
353 Ga0496112_0623162 3300048915 Bacteria 1010
354 Ga0496113_0106604 3300048916 Bacteria 2177
355 Ga0496113_0184726 3300048916 Bacteria 1653
356 Ga0496113_0421628 3300048916 Bacteria 1072
357 Ga0496114_0006381 3300048917 Bacteria 9283
358 Ga0496114_0015458 3300048917 Bacteria 6138
359 Ga0496114_0022079 3300048917 Bacteria 5183
360 Ga0496114_0080488 3300048917 Bacteria 2751
361 Ga0496114_0216726 3300048917 Bacteria 1680
362 Ga0496115_0010135 3300048918 Bacteria 7032
363 Ga0496115_0032163 3300048918 Bacteria 4138
364 Ga0496115_0055536 3300048918 Bacteria 3181
365 Ga0496115_0073801 3300048918 Bacteria 2769
366 Ga0496117_0000235 3300048920 Bacteria 104830
367 Ga0496117_0010509 3300048920 Bacteria 8419
368 Ga0496117_0015928 3300048920 Bacteria 6370
369 Ga0496117_0022233 3300048920 Bacteria 5091
370 Ga0496117_0026168 3300048920 Bacteria 4570
371 Ga0496117_0029945 3300048920 Bacteria 4186
372 Ga0496118_0007162 3300048921 Bacteria 11930
373 Ga0496118_0008668 3300048921 Bacteria 10458
374 Ga0496118_0009005 3300048921 Bacteria 10183
375 Ga0496118_0023094 3300048921 Bacteria 5415
376 Ga0496118_0036549 3300048921 Bacteria 3969
377 Ga0496119_0004965 3300048922 Bacteria 12999
378 Ga0496119_0007470 3300048922 Bacteria 9832
379 Ga0496119_0015874 3300048922 Bacteria 5766
380 Ga0496119_0018367 3300048922 Bacteria 5208
381 Ga0496120_0000655 3300048923 Bacteria 50898
382 Ga0496120_0030306 3300048923 Bacteria 3290
383 Ga0496120_0040968 3300048923 Bacteria 2717
384 Ga0496121_0000277 3300048924 Bacteria 107014
385 Ga0496122_0000200 3300048925 Bacteria 133548
386 Ga0496122_0000360 3300048925 Bacteria 97913
387 Ga0496122_0043308 3300048925 Bacteria 3528
388 Ga0496123_0000076 3300048926 Bacteria 194050
389 Ga0496123_0002417 3300048926 Bacteria 23290
390 Ga0496124_0018523 3300048927 Bacteria 6518
391 Ga0496124_0125943 3300048927 Bacteria 2041
392 Ga0496126_0014990 3300048929 Bacteria 7815
393 Ga0496126_0033121 3300048929 Bacteria 4863
394 Ga0496126_0057518 3300048929 Bacteria 3510
395 Ga0496126_0074598 3300048929 Bacteria 3012
396 Ga0496126_0107727 3300048929 Bacteria 2430
397 Ga0501031_0009585 3300049568 Bacteria 6304
398 Ga0501031_0065675 3300049568 Bacteria 2364
399 Ga0501032_0002800 3300049569 Bacteria 13565
400 Ga0501032_0006994 3300049569 Bacteria 8272
401 Ga0501032_0017933 3300049569 Bacteria 4966
402 Ga0501032_0069724 3300049569 Bacteria 2346
403 Ga0501032_0085237 3300049569 Bacteria 2100
404 Ga0501033_0007753 3300049570 Bacteria 8321
405 Ga0501033_0012915 3300049570 Bacteria 6369
406 Ga0501033_0060490 3300049570 Bacteria 2794
407 Ga0501033_0162805 3300049570 Bacteria 1605
408 Ga0501034_0022284 3300049571 Bacteria 6456
409 Ga0501034_0024988 3300049571 Bacteria 6078
410 Ga0501034_0078018 3300049571 Bacteria 3317
411 Ga0501036_0017172 3300049572 Bacteria 6048
412 Ga0501036_0248761 3300049572 Bacteria 1490
413 Ga0501037_0006742 3300049573 Bacteria 8401
414 Ga0501037_0021415 3300049573 Bacteria 4777
415 Ga0501037_0038611 3300049573 Bacteria 3517
416 Ga0501037_0066006 3300049573 Bacteria 2636
417 Ga0501037_0089882 3300049573 Bacteria 2222
418 Ga0501037_0166930 3300049573 Bacteria 1567
419 Ga0501038_0033875 3300049574 Bacteria 4494
420 Ga0501038_0038126 3300049574 Bacteria 4209
421 Ga0501038_0038199 3300049574 Bacteria 4205
422 Ga0501038_0071682 3300049574 Bacteria 2938
423 Ga0501039_0153251 3300049575 Bacteria 1810
424 Ga0501039_0167174 3300049575 Bacteria 1729
425 Ga0501039_0449193 3300049575 Bacteria 1012
426 Ga0501042_0042640 3300049578 Bacteria 3230
427 Ga0501042_0043943 3300049578 Bacteria 3183
428 Ga0501042_0521754 3300049578 Bacteria 863
429 Ga0501043_0013204 3300049579 Bacteria 6460
430 Ga0501043_0021246 3300049579 Bacteria 5088
431 Ga0501043_0044171 3300049579 Bacteria 3503
432 Ga0501043_0091162 3300049579 Bacteria 2396
433 Ga0501043_0139025 3300049579 Bacteria 1902
434 Ga0501043_0263281 3300049579 Bacteria 1325
435 Ga0501046_0007020 3300049580 Bacteria 9921
436 Ga0501046_0016323 3300049580 Bacteria 6222
437 Ga0501046_0018795 3300049580 Bacteria 5741
438 Ga0501047_0006712 3300049581 Bacteria 10821
439 Ga0501047_0010036 3300049581 Bacteria 8953
440 Ga0501047_0010335 3300049581 Bacteria 8827
441 Ga0501047_0041412 3300049581 Bacteria 4451
442 Ga0501047_0043118 3300049581 Bacteria 4358
443 Ga0501047_0164540 3300049581 Bacteria 2089
444 Ga0501047_0230335 3300049581 Bacteria 1706
445 Ga0501047_0282473 3300049581 Bacteria 1504
446 Ga0501048_0008758 3300049582 Bacteria 7624
447 Ga0501067_0068932 3300049583 Bacteria 1959
448 Ga0501069_0067808 3300049585 Bacteria 1996
449 Ga0501070_0000088 3300049586 Bacteria 77423
450 Ga0501070_0016947 3300049586 Bacteria 6114
451 Ga0501070_0091215 3300049586 Bacteria 2522
452 Ga0501071_0000422 3300049587 Bacteria 21099
453 Ga0501073_0004953 3300049589 Bacteria 9993
454 Ga0501073_0090958 3300049589 Bacteria 2121
455 Ga0501073_0146193 3300049589 Bacteria 1638
456 Ga0501073_0250990 3300049589 Bacteria 1221
457 Ga0501074_0073678 3300049590 Bacteria 2453
458 Ga0501080_0048351 3300049742 Bacteria 3959
459 Ga0501080_0204660 3300049742 Bacteria 1811
460 Ga0501083_0000052 3300049744 Bacteria 84349
461 Ga0501083_0215903 3300049744 Bacteria 1250
462 Ga0501035_0005181 3300049822 Bacteria 12332
463 Ga0501035_0056307 3300049822 Bacteria 3508
464 Ga0501035_0060074 3300049822 Bacteria 3384
465 Ga0501035_0064364 3300049822 Bacteria 3259
466 Ga0501035_0112835 3300049822 Bacteria 2381
467 Ga0501035_0185140 3300049822 Bacteria 1792
468 Ga0501044_0031929 3300049823 Bacteria 5537
469 Ga0501044_0076027 3300049823 Bacteria 3409
470 Ga0501044_0077795 3300049823 Bacteria 3363
471 Ga0501044_0158170 3300049823 Bacteria 2244
472 Ga0501045_0020601 3300049824 Bacteria 4712
473 nmdc:mga00v17_15245_c1 3300050491 Bacteria 4310
474 nmdc:mga0yw44_16278_c1 3300050492 Bacteria 4013
475 nmdc:mga0yw44_26387_c1 3300050492 Bacteria 3318
476 nmdc:mga06z11_29106_c1 3300050494 Bacteria 2657
477 nmdc:mga07m45_127895_c1 3300050496 Bacteria 1469
478 nmdc:mga05p37_210191_c1 3300050507 Bacteria 2353
479 nmdc:mga05p37_9946_c1 3300050507 Bacteria 11294
480 nmdc:mga09592_11_c1 3300050508 Bacteria 73718
481 nmdc:mga0qj67_432383_c1 3300050509 Bacteria 1061
482 nmdc:mga06r32_1205_c1 3300050510 Bacteria 23293
483 nmdc:mga06r32_40772_c1 3300050510 Bacteria 4409
484 nmdc:mga06r32_5_c1 3300050510 Bacteria 79813
485 nmdc:mga06r32_900_c4 3300050510 Bacteria 7021
486 nmdc:mga08y16_236059_c1 3300050511 Bacteria 1891
487 nmdc:mga08y16_61508_c1 3300050511 Bacteria 3921
488 nmdc:mga0n895_16320_c1 3300050512 Bacteria 6811
489 nmdc:mga0rr50_26939_c1 3300050513 Bacteria 4019
490 nmdc:mga0a205_38341_c1 3300050515 Bacteria 4610
491 Ga0500635_0000013 3300053080 Bacteria 133088
492 Ga0495595_0031041 3300053084 Bacteria 2400
493 Ga0495619_0038942 3300053085 Bacteria 3103
494 Ga0500643_000953 3300053087 Bacteria 18072
495 Ga0500651_0000300 3300053093 Bacteria 28581
496 Ga0500562_004538 3300053108 Bacteria 3507
497 Ga0500593_076599 3300053117 Bacteria 1441
498 Ga0500559_0000156 3300053136 Bacteria 53941
499 Ga0500559_0000372 3300053136 Bacteria 33038
500 Ga0500559_0008624 3300053136 Bacteria 4459
501 Ga0500573_0007144 3300053140 Bacteria 6076
502 Ga0500573_0017995 3300053140 Bacteria 4026
503 Ga0500573_0023971 3300053140 Bacteria 3506
504 Ga0500573_0025310 3300053140 Bacteria 3412
505 Ga0500573_0034665 3300053140 Bacteria 2911
506 Ga0500573_0042920 3300053140 Bacteria 2611
507 Ga0500573_0061311 3300053140 Bacteria 2154
508 Ga0500577_0085660 3300053142 Bacteria 1264
509 Ga0500590_004686 3300053148 Bacteria 6493
510 Ga0500616_0084785 3300053153 Bacteria 1584
511 Ga0500620_000060 3300053155 Bacteria 20194
512 Ga0500636_0101218 3300053177 Bacteria 1638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10000220 Ga0207707_1000022026 226
2 3300025917 Ga0207660_10000997 Ga0207660_1000099717 226
3 3300025921 Ga0207652_10000471 Ga0207652_1000047126 226
4 3300009094 Ga0111539_10010636 Ga0111539_100106366 234
5 3300009147 Ga0114129_10010043 Ga0114129_100100437 234
6 3300009176 Ga0105242_10566617 Ga0105242_105666172 234
7 3300010375 Ga0105239_10039388 Ga0105239_100393884 234
8 3300046518 Ga0495631_0078123 Ga0495631_0078123_151_867 234
9 3300046523 Ga0495644_0065000 Ga0495644_0065000_203_919 234
10 3300050507 nmdc:mga05p37_9946_c1 nmdc:mga05p37_9946_c1_5797_6513 234
11 3300050510 nmdc:mga06r32_40772_c1 nmdc:mga06r32_40772_c1_1069_1785 234
12 3300050512 nmdc:mga0n895_16320_c1 nmdc:mga0n895_16320_c1_3197_3913 234
13 3300050513 nmdc:mga0rr50_26939_c1 nmdc:mga0rr50_26939_c1_82_798 234
14 3300050515 nmdc:mga0a205_38341_c1 nmdc:mga0a205_38341_c1_2626_3342 234
15 3300009553 Ga0105249_10046438 Ga0105249_100464384 235
16 3300013306 Ga0163162_10659700 Ga0163162_106597001 235
17 3300048911 Ga0496108_0284483 Ga0496108_0284483_481_1200 235
18 3300009101 Ga0105247_10531272 Ga0105247_105312721 236
19 3300050507 nmdc:mga05p37_210191_c1 nmdc:mga05p37_210191_c1_642_1358 237
20 3300050508 nmdc:mga09592_11_c1 nmdc:mga09592_11_c1_24432_25148 237
21 3300050510 nmdc:mga06r32_5_c1 nmdc:mga06r32_5_c1_75057_75773 237
22 3300038443 Ga0395901_0246637 Ga0395901_0246637_1060_1776 238
23 3300046460 Ga0495638_0303961 Ga0495638_0303961_56_775 239
24 3300005618 Ga0068864_100367238 Ga0068864_1003672382 240
25 3300014968 Ga0157379_10017991 Ga0157379_100179917 240
26 3300036712 Ga0316584_0013835 Ga0316584_0013835_2021_2761 240
27 3300013296 Ga0157374_10384569 Ga0157374_103845692 241
28 3300049578 Ga0501042_0521754 Ga0501042_0521754_66_791 241
29 3300050509 nmdc:mga0qj67_432383_c1 nmdc:mga0qj67_432383_c1_264_1019 241
30 3300009093 Ga0105240_10296905 Ga0105240_102969052 243
31 3300009553 Ga0105249_10776647 Ga0105249_107766471 243
32 3300013307 Ga0157372_10398338 Ga0157372_103983383 243
33 3300020082 Ga0206353_11120836 Ga0206353_1112083620 243
34 3300025944 Ga0207661_10102850 Ga0207661_101028503 243
35 3300026116 Ga0207674_10480524 Ga0207674_104805242 243
36 3300035398 Ga0316574_0089402 Ga0316574_0089402_271_1005 243
37 3300044693 Ga0466961_0398898 Ga0466961_0398898_30_788 243
38 3300049583 Ga0501067_0068932 Ga0501067_0068932_740_1480 244
39 3300026067 Ga0207678_10924990 Ga0207678_109249901 246
40 3300053087 Ga0500643_000953 Ga0500643_000953_15376_16146 246
41 3300005455 Ga0070663_100003571 Ga0070663_1000035716 247
42 3300005458 Ga0070681_10395661 Ga0070681_103956611 247
43 3300005937 Ga0081455_10004075 Ga0081455_1000407513 247
44 3300005981 Ga0081538_10116964 Ga0081538_101169642 247
45 3300013105 Ga0157369_10548092 Ga0157369_105480922 247
46 3300013307 Ga0157372_10488787 Ga0157372_104887872 247
47 3300020082 Ga0206353_11704794 Ga0206353_117047942 247
48 3300025924 Ga0207694_10163248 Ga0207694_101632481 247
49 3300025927 Ga0207687_10084305 Ga0207687_100843053 247
50 3300025933 Ga0207706_10324820 Ga0207706_103248202 247
51 3300026067 Ga0207678_10534638 Ga0207678_105346382 247
52 3300026118 Ga0207675_100009028 Ga0207675_1000090286 247
53 3300037418 Ga0395900_0488961 Ga0395900_0488961_324_1088 247
54 3300037466 Ga0395898_0032253 Ga0395898_0032253_3106_3861 247
55 3300038443 Ga0395901_0000920 Ga0395901_0000920_8191_8946 247
56 3300038443 Ga0395901_0146054 Ga0395901_0146054_683_1447 247
57 3300041503 Ga0451847_0757701 Ga0451847_0757701_70_834 247
58 3300041512 Ga0451853_4030682 Ga0451853_4030682_1790_2554 247
59 3300044683 Ga0466965_0079457 Ga0466965_0079457_376_1140 247
60 3300044683 Ga0466965_0193558 Ga0466965_0193558_219_971 247
61 3300044684 Ga0466966_0216302 Ga0466966_0216302_27_791 247
62 3300044694 Ga0466963_0192750 Ga0466963_0192750_454_1206 247
63 3300044719 Ga0466971_0011351 Ga0466971_0011351_1657_2421 247
64 3300044719 Ga0466971_0020548 Ga0466971_0020548_678_1442 247
65 3300044765 Ga0466970_0028362 Ga0466970_0028362_737_1501 247
66 3300044842 Ga0466957_0211079 Ga0466957_0211079_322_1074 247
67 3300044842 Ga0466957_0452020 Ga0466957_0452020_32_796 247
68 3300044901 Ga0466960_0031771 Ga0466960_0031771_1208_1981 247
69 3300045049 Ga0466959_0060679 Ga0466959_0060679_837_1589 247
70 3300045976 Ga0466967_0136969 Ga0466967_0136969_452_1216 247
71 3300045976 Ga0466967_0666756 Ga0466967_0666756_187_951 247
72 3300048912 Ga0496109_0342580 Ga0496109_0342580_471_1226 247
73 3300050510 nmdc:mga06r32_1205_c1 nmdc:mga06r32_1205_c1_6716_7483 247
74 3300050511 nmdc:mga08y16_236059_c1 nmdc:mga08y16_236059_c1_508_1260 247
75 3300005719 Ga0068861_100907337 Ga0068861_1009073371 248
76 3300009098 Ga0105245_10467955 Ga0105245_104679552 248
77 3300026075 Ga0207708_10242050 Ga0207708_102420501 248
78 3300005337 Ga0070682_100164986 Ga0070682_1001649862 249
79 3300005841 Ga0068863_100380195 Ga0068863_1003801952 249
80 3300005937 Ga0081455_10076616 Ga0081455_100766162 249
81 3300009177 Ga0105248_10001478 Ga0105248_100014786 249
82 3300013105 Ga0157369_10046604 Ga0157369_100466044 249
83 3300014325 Ga0163163_10012121 Ga0163163_100121215 249
84 3300014968 Ga0157379_10000058 Ga0157379_1000005826 249
85 3300020082 Ga0206353_10742524 Ga0206353_107425242 249
86 3300025918 Ga0207662_10057162 Ga0207662_100571622 249
87 3300025925 Ga0207650_10227902 Ga0207650_102279022 249
88 3300025941 Ga0207711_10004873 Ga0207711_100048736 249
89 3300026035 Ga0207703_10000009 Ga0207703_10000009333 249
90 3300026035 Ga0207703_10208222 Ga0207703_102082223 249
91 3300026067 Ga0207678_10102979 Ga0207678_101029793 249
92 3300026116 Ga0207674_10105779 Ga0207674_101057793 249
93 3300026142 Ga0207698_10115846 Ga0207698_101158463 249
94 iso_pu_bacteria 2915358134 2915358431 249
95 3300026067 Ga0207678_10085543 Ga0207678_100855432 250
96 3300050511 nmdc:mga08y16_61508_c1 nmdc:mga08y16_61508_c1_3029_3859 250
97 iso_pu_bacteria 2818991318 2819427056 250
98 3300005366 Ga0070659_100432560 Ga0070659_1004325602 251
99 3300005614 Ga0068856_100017184 Ga0068856_1000171848 251
100 3300005937 Ga0081455_10000363 Ga0081455_1000036361 251
101 3300006847 Ga0075431_100486470 Ga0075431_1004864702 251
102 3300009176 Ga0105242_10379007 Ga0105242_103790072 251
103 3300009177 Ga0105248_10315030 Ga0105248_103150302 251
104 3300013307 Ga0157372_10059728 Ga0157372_100597281 251
105 3300014326 Ga0157380_10123667 Ga0157380_101236673 251
106 3300017792 Ga0163161_10172108 Ga0163161_101721082 251
107 3300025926 Ga0207659_10436179 Ga0207659_104361792 251
108 3300025927 Ga0207687_10111005 Ga0207687_101110052 251
109 3300025972 Ga0207668_10696407 Ga0207668_106964071 251
110 3300026089 Ga0207648_10080635 Ga0207648_100806354 251
111 3300026121 Ga0207683_10033049 Ga0207683_100330497 251
112 3300028800 Ga0265338_10079749 Ga0265338_100797492 251
113 3300031235 Ga0265330_10102461 Ga0265330_101024611 251
114 3300031241 Ga0265325_10011674 Ga0265325_100116744 251
115 3300031247 Ga0265340_10044478 Ga0265340_100444782 251
116 3300031691 Ga0316579_10014531 Ga0316579_100145312 251
117 3300031711 Ga0265314_10051789 Ga0265314_100517893 251
118 3300031712 Ga0265342_10037249 Ga0265342_100372493 251
119 3300031727 Ga0316576_10010618 Ga0316576_100106185 251
120 3300031728 Ga0316578_10002828 Ga0316578_100028288 251
121 3300031733 Ga0316577_10003953 Ga0316577_100039538 251
122 3300031995 Ga0307409_100446300 Ga0307409_1004463001 251
123 3300032002 Ga0307416_100060492 Ga0307416_1000604924 251
124 3300032004 Ga0307414_10425427 Ga0307414_104254271 251
125 3300032133 Ga0316583_10010540 Ga0316583_100105403 251
126 3300032137 Ga0316585_10003151 Ga0316585_100031514 251
127 3300032139 Ga0316580_10004781 Ga0316580_100047812 251
128 3300035398 Ga0316574_0014337 Ga0316574_0014337_843_1622 251
129 3300036647 Ga0316582_0015780 Ga0316582_0015780_1007_1786 251
130 3300036712 Ga0316584_0022197 Ga0316584_0022197_960_1739 251
131 3300044694 Ga0466963_0238085 Ga0466963_0238085_83_859 251
132 3300046463 Ga0495653_0108869 Ga0495653_0108869_455_1234 251
133 3300046477 Ga0495664_0286059 Ga0495664_0286059_101_880 251
134 3300047319 Ga0495674_0140275 Ga0495674_0140275_143_922 251
135 3300048907 Ga0496104_0355653 Ga0496104_0355653_227_1006 251
136 3300048908 Ga0496105_0083622 Ga0496105_0083622_354_1133 251
137 3300048909 Ga0496106_0204881 Ga0496106_0204881_287_1066 251
138 3300048912 Ga0496109_0045917 Ga0496109_0045917_1004_1783 251
139 3300048917 Ga0496114_0022079 Ga0496114_0022079_3457_4236 251
140 3300050510 nmdc:mga06r32_900_c4 nmdc:mga06r32_900_c4_6179_7000 251
141 3300053084 Ga0495595_0031041 Ga0495595_0031041_1599_2378 251
142 3300053085 Ga0495619_0038942 Ga0495619_0038942_871_1650 251
143 iso_pu_bacteria 2857481737 2857484105 251
144 iso_pu_bacteria 2857727296 2857728394 251
145 iso_pu_bacteria 2870782633 2870784256 251
146 3300013104 Ga0157370_10040504 Ga0157370_100405044 252
147 iso_pu_bacteria 2558860112 2558911457 252
148 iso_pu_bacteria 2818991458 2819666048 252
149 iso_pu_bacteria 2818991462 2819692475 252
150 iso_pu_bacteria 2818991469 2819728716 252
151 iso_pu_bacteria 2887443736 2887446309 252
152 iso_pu_bacteria 2920879853 2920883751 252
153 3300005347 Ga0070668_100313524 Ga0070668_1003135241 253
154 3300005530 Ga0070679_100428066 Ga0070679_1004280662 253
155 3300005841 Ga0068863_100018229 Ga0068863_1000182294 253
156 3300006880 Ga0075429_100006527 Ga0075429_1000065276 253
157 3300025921 Ga0207652_10160407 Ga0207652_101604073 253
158 3300026088 Ga0207641_10003481 Ga0207641_100034819 253
159 3300026116 Ga0207674_10033183 Ga0207674_100331836 253
160 3300031824 Ga0307413_10411219 Ga0307413_104112191 253
161 3300031852 Ga0307410_10015490 Ga0307410_100154905 253
162 3300031903 Ga0307407_10035365 Ga0307407_100353653 253
163 3300031995 Ga0307409_100056726 Ga0307409_1000567262 253
164 3300032002 Ga0307416_100051319 Ga0307416_1000513193 253
165 3300037853 Ga0436364_0514406 Ga0436364_0514406_166_1056 253
166 3300048903 Ga0496100_0210644 Ga0496100_0210644_129_902 253
167 3300048917 Ga0496114_0015458 Ga0496114_0015458_222_1004 253
168 3300048917 Ga0496114_0216726 Ga0496114_0216726_866_1639 253
169 iso_pu_bacteria 2508501039 2508675900 253
170 iso_pu_bacteria 2643221711 2644609196 253
171 iso_pu_bacteria 2687453737 2689956703 253
172 iso_pu_bacteria 2773857921 2774848612 253
173 iso_pu_bacteria 2811994882 2812374325 253
174 iso_pu_bacteria 2816332119 2816424707 253
175 iso_pu_bacteria 2837268691 2837271121 253
176 iso_pu_bacteria 2868088558 2868091252 253
177 3300005329 Ga0070683_100013636 Ga0070683_1000136365 254
178 3300006163 Ga0070715_10009957 Ga0070715_100099572 254
179 3300006173 Ga0070716_100001544 Ga0070716_1000015442 254
180 3300013105 Ga0157369_10015044 Ga0157369_100150443 254
181 3300025898 Ga0207692_10344603 Ga0207692_103446031 254
182 3300025905 Ga0207685_10024569 Ga0207685_100245692 254
183 3300025913 Ga0207695_10025529 Ga0207695_100255293 254
184 3300025915 Ga0207693_10001931 Ga0207693_1000193115 254
185 3300025939 Ga0207665_10000952 Ga0207665_100009525 254
186 3300025944 Ga0207661_10058908 Ga0207661_100589081 254
187 3300026142 Ga0207698_10161729 Ga0207698_101617292 254
188 3300037471 Ga0395905_0022729 Ga0395905_0022729_4554_5345 254
189 3300038443 Ga0395901_0013301 Ga0395901_0013301_6268_7059 254
190 3300044901 Ga0466960_0124266 Ga0466960_0124266_523_1308 254
191 3300047320 Ga0495672_0223123 Ga0495672_0223123_87_884 254
192 3300048907 Ga0496104_0084071 Ga0496104_0084071_1757_2533 254
193 3300048907 Ga0496104_0371191 Ga0496104_0371191_112_888 254
194 3300048908 Ga0496105_0155160 Ga0496105_0155160_485_1261 254
195 3300048913 Ga0496110_0083055 Ga0496110_0083055_1862_2638 254
196 3300048915 Ga0496112_0623162 Ga0496112_0623162_23_799 254
197 3300048916 Ga0496113_0184726 Ga0496113_0184726_682_1458 254
198 3300003578 Ga0006562J51391_1039029 Ga0006562J51391_10390294 255
199 3300013306 Ga0163162_10027684 Ga0163162_100276847 255
200 3300026116 Ga0207674_10152334 Ga0207674_101523344 255
201 3300031995 Ga0307409_100774845 Ga0307409_1007748451 255
202 3300048903 Ga0496100_0057068 Ga0496100_0057068_125_904 255
203 3300048904 Ga0496101_0006557 Ga0496101_0006557_3837_4616 255
204 3300048905 Ga0496102_0004392 Ga0496102_0004392_4303_5082 255
205 3300048906 Ga0496103_0024681 Ga0496103_0024681_2836_3615 255
206 3300048907 Ga0496104_0034030 Ga0496104_0034030_1963_2742 255
207 3300048908 Ga0496105_0004765 Ga0496105_0004765_3728_4507 255
208 3300048910 Ga0496107_0401191 Ga0496107_0401191_93_872 255
209 3300048916 Ga0496113_0106604 Ga0496113_0106604_878_1657 255
210 3300048916 Ga0496113_0421628 Ga0496113_0421628_202_1008 255
211 3300048917 Ga0496114_0006381 Ga0496114_0006381_5685_6464 255
212 iso_pu_bacteria 2808606365 2808874713 255
213 iso_pu_bacteria 2835188231 2835188957 255
214 iso_pu_bacteria 2919446982 2919447030 255
215 3300044683 Ga0466965_0136936 Ga0466965_0136936_369_1220 256
216 3300053140 Ga0500573_0017995 Ga0500573_0017995_1410_2180 256
217 3300005367 Ga0070667_100027561 Ga0070667_1000275613 257
218 3300025904 Ga0207647_10044805 Ga0207647_100448053 257
219 3300025929 Ga0207664_10014767 Ga0207664_100147673 257
220 3300025986 Ga0207658_10164439 Ga0207658_101644392 257
221 3300031691 Ga0316579_10004999 Ga0316579_100049997 257
222 3300031727 Ga0316576_10000788 Ga0316576_100007887 257
223 3300031733 Ga0316577_10193902 Ga0316577_101939022 257
224 3300032133 Ga0316583_10056409 Ga0316583_100564092 257
225 3300032137 Ga0316585_10040948 Ga0316585_100409482 257
226 3300032139 Ga0316580_10004593 Ga0316580_100045934 257
227 3300035119 Ga0373956_0002961 Ga0373956_0002961_4382_5350 257
228 3300046524 Ga0495648_0050573 Ga0495648_0050573_503_1300 257
229 3300048907 Ga0496104_0149351 Ga0496104_0149351_920_1729 257
230 3300048913 Ga0496110_0047567 Ga0496110_0047567_1688_2497 257
231 3300048914 Ga0496111_0118286 Ga0496111_0118286_948_1757 257
232 3300048918 Ga0496115_0055536 Ga0496115_0055536_749_1558 257
233 iso_pu_bacteria 2675903058 2676475526 257
234 iso_pu_bacteria 2827628540 2827631307 257
235 iso_pu_bacteria 3002998708 3003003001 257
236 3300031727 Ga0316576_10047287 Ga0316576_100472871 258
237 3300031728 Ga0316578_10001133 Ga0316578_100011333 258
238 3300035398 Ga0316574_0042442 Ga0316574_0042442_1962_2768 258
239 3300036712 Ga0316584_0047693 Ga0316584_0047693_2357_3163 258
240 3300045976 Ga0466967_0575049 Ga0466967_0575049_168_965 258
241 3300049581 Ga0501047_0041412 Ga0501047_0041412_763_1563 258
242 iso_pu_bacteria 2784132109 2784472516 258
243 3300006048 Ga0075363_100068619 Ga0075363_1000686192 259
244 3300044694 Ga0466963_0385502 Ga0466963_0385502_79_960 259
245 3300044842 Ga0466957_0072866 Ga0466957_0072866_560_1441 259
246 3300005440 Ga0070705_100125586 Ga0070705_1001255861 260
247 3300005547 Ga0070693_100034918 Ga0070693_1000349181 260
248 3300005615 Ga0070702_100002838 Ga0070702_1000028387 260
249 3300005616 Ga0068852_100057001 Ga0068852_1000570012 260
250 3300006038 Ga0075365_10017154 Ga0075365_100171542 260
251 3300006051 Ga0075364_10005149 Ga0075364_100051496 260
252 3300006881 Ga0068865_100038939 Ga0068865_1000389393 260
253 3300009176 Ga0105242_10023921 Ga0105242_100239214 260
254 3300014326 Ga0157380_10168720 Ga0157380_101687202 260
255 3300025961 Ga0207712_10149101 Ga0207712_101491011 260
256 3300026121 Ga0207683_10084642 Ga0207683_100846423 260
257 3300035691 Ga0373931_0100571 Ga0373931_0100571_174_1034 260
258 3300046543 Ga0495645_0133853 Ga0495645_0133853_295_1104 260
259 3300047322 Ga0495680_0407044 Ga0495680_0407044_118_918 260
260 3300048905 Ga0496102_0162231 Ga0496102_0162231_109_918 260
261 3300048910 Ga0496107_0192175 Ga0496107_0192175_374_1183 260
262 3300049572 Ga0501036_0248761 Ga0501036_0248761_590_1408 260
263 3300049573 Ga0501037_0166930 Ga0501037_0166930_260_1078 260
264 3300049574 Ga0501038_0071682 Ga0501038_0071682_2010_2828 260
265 3300049575 Ga0501039_0167174 Ga0501039_0167174_894_1712 260
266 3300049580 Ga0501046_0018795 Ga0501046_0018795_827_1645 260
267 3300049590 Ga0501074_0073678 Ga0501074_0073678_108_926 260
268 3300049742 Ga0501080_0204660 Ga0501080_0204660_862_1680 260
269 3300049823 Ga0501044_0158170 Ga0501044_0158170_569_1387 260
270 3300050491 nmdc:mga00v17_15245_c1 nmdc:mga00v17_15245_c1_3223_4023 260
271 3300050492 nmdc:mga0yw44_26387_c1 nmdc:mga0yw44_26387_c1_558_1358 260
272 3300053108 Ga0500562_004538 Ga0500562_004538_373_1173 260
273 iso_pu_bacteria 8002775197 8002775492 260
274 3300048929 Ga0496126_0014990 Ga0496126_0014990_308_1111 261
275 iso_pu_bacteria 2852643534 2852645680 261
276 iso_pu_bacteria 2966924647 2966925023 261
277 3300005844 Ga0068862_100001933 Ga0068862_1000019332 262
278 3300006931 Ga0097620_100000357 Ga0097620_10000035728 262
279 3300025941 Ga0207711_10000060 Ga0207711_100000601 262
280 3300025961 Ga0207712_10017638 Ga0207712_100176384 262
281 3300028380 Ga0268265_10000024 Ga0268265_1000002451 262
282 3300048920 Ga0496117_0026168 Ga0496117_0026168_2116_2973 262
283 3300048921 Ga0496118_0007162 Ga0496118_0007162_8134_8991 262
284 3300048922 Ga0496119_0004965 Ga0496119_0004965_6233_7072 262
285 3300053140 Ga0500573_0023971 Ga0500573_0023971_1932_2720 262
286 3300053140 Ga0500573_0025310 Ga0500573_0025310_820_1608 262
287 3300053153 Ga0500616_0084785 Ga0500616_0084785_704_1543 262
288 iso_pu_bacteria 2939660829 2939664013 262
289 iso_pu_bacteria 2946080515 2946080767 262
290 3300053136 Ga0500559_0000156 Ga0500559_0000156_23605_24414 263
291 3300053140 Ga0500573_0007144 Ga0500573_0007144_3866_4657 263
292 iso_pu_bacteria 2643221566 2643848267 263
293 iso_pu_bacteria 2643221575 2643885398 263
294 iso_pu_bacteria 2643221616 2644095956 263
295 iso_pu_bacteria 2773857758 2774380346 263
296 iso_pu_bacteria 2862993130 2862995848 263
297 iso_pu_bacteria 2884763398 2884765319 263
298 iso_pu_bacteria 2908678064 2908680887 263
299 iso_pu_bacteria 2919069694 2919071563 263
300 iso_pu_bacteria 2966921586 2966922340 263
301 iso_pu_bacteria 8004212874 8004214347 263
302 3300048922 Ga0496119_0018367 Ga0496119_0018367_2421_3215 264
303 iso_pu_bacteria 2964326757 2964329477 264
304 3300005327 Ga0070658_10168885 Ga0070658_101688852 265
305 3300005338 Ga0068868_100029730 Ga0068868_1000297302 265
306 3300005344 Ga0070661_100068570 Ga0070661_1000685702 265
307 3300005366 Ga0070659_100014108 Ga0070659_1000141087 265
308 3300005539 Ga0068853_100028944 Ga0068853_1000289441 265
309 3300005543 Ga0070672_100049351 Ga0070672_1000493513 265
310 3300005614 Ga0068856_100026572 Ga0068856_1000265722 265
311 3300005614 Ga0068856_100376118 Ga0068856_1003761182 265
312 3300005616 Ga0068852_100110180 Ga0068852_1001101803 265
313 3300005618 Ga0068864_100023638 Ga0068864_1000236383 265
314 3300005842 Ga0068858_100014735 Ga0068858_1000147358 265
315 3300009093 Ga0105240_10006064 Ga0105240_1000606413 265
316 3300009093 Ga0105240_10060054 Ga0105240_100600545 265
317 3300009098 Ga0105245_10149847 Ga0105245_101498471 265
318 3300009101 Ga0105247_10090946 Ga0105247_100909463 265
319 3300009174 Ga0105241_10001064 Ga0105241_1000106413 265
320 3300009177 Ga0105248_10003592 Ga0105248_1000359213 265
321 3300009545 Ga0105237_10052484 Ga0105237_100524843 265
322 3300009545 Ga0105237_10081585 Ga0105237_100815852 265
323 3300009551 Ga0105238_10420233 Ga0105238_104202332 265
324 3300010375 Ga0105239_10396574 Ga0105239_103965742 265
325 3300014969 Ga0157376_10163493 Ga0157376_101634932 265
326 3300025254 Ga0209148_1000828 Ga0209148_10008283 265
327 3300025272 Ga0209455_1019341 Ga0209455_10193412 265
328 3300025909 Ga0207705_10025267 Ga0207705_100252674 265
329 3300025911 Ga0207654_10000001 Ga0207654_100000011694 265
330 3300025913 Ga0207695_10006059 Ga0207695_100060599 265
331 3300025914 Ga0207671_10024829 Ga0207671_100248293 265
332 3300025914 Ga0207671_10026815 Ga0207671_100268153 265
333 3300025919 Ga0207657_10025274 Ga0207657_100252743 265
334 3300025920 Ga0207649_10017423 Ga0207649_100174233 265
335 3300025927 Ga0207687_10231320 Ga0207687_102313202 265
336 3300025932 Ga0207690_10001146 Ga0207690_100011467 265
337 3300025940 Ga0207691_10060547 Ga0207691_100605473 265
338 3300025941 Ga0207711_10004780 Ga0207711_100047807 265
339 3300025941 Ga0207711_10080057 Ga0207711_100800574 265
340 3300025949 Ga0207667_10014728 Ga0207667_100147288 265
341 3300025986 Ga0207658_10009467 Ga0207658_100094672 265
342 3300026023 Ga0207677_10020532 Ga0207677_100205322 265
343 3300026023 Ga0207677_10508549 Ga0207677_105085492 265
344 3300026035 Ga0207703_10000031 Ga0207703_1000003136 265
345 3300026041 Ga0207639_10033026 Ga0207639_100330263 265
346 3300026078 Ga0207702_10189466 Ga0207702_101894662 265
347 3300026116 Ga0207674_10107019 Ga0207674_101070192 265
348 3300026142 Ga0207698_10056228 Ga0207698_100562283 265
349 3300048908 Ga0496105_0016210 Ga0496105_0016210_1222_2025 265
350 3300048917 Ga0496114_0080488 Ga0496114_0080488_375_1178 265
351 3300048918 Ga0496115_0010135 Ga0496115_0010135_4121_4924 265
352 3300048918 Ga0496115_0073801 Ga0496115_0073801_571_1374 265
353 3300049586 Ga0501070_0000088 Ga0501070_0000088_44898_45698 265
354 3300049822 Ga0501035_0064364 Ga0501035_0064364_1020_1823 265
355 3300053093 Ga0500651_0000300 Ga0500651_0000300_9322_10119 265
356 3300053136 Ga0500559_0000372 Ga0500559_0000372_24759_25556 265
357 3300053136 Ga0500559_0008624 Ga0500559_0008624_1102_1899 265
358 3300053148 Ga0500590_004686 Ga0500590_004686_3263_4060 265
359 3300053177 Ga0500636_0101218 Ga0500636_0101218_697_1494 265
360 iso_pu_bacteria 2585428094 2587862583 265
361 iso_pu_bacteria 2870622029 2870623779 265
362 iso_pu_bacteria 2939657138 2939658270 265
363 3300005339 Ga0070660_100133225 Ga0070660_1001332251 266
364 3300005563 Ga0068855_100226576 Ga0068855_1002265763 266
365 3300048921 Ga0496118_0036549 Ga0496118_0036549_2079_2879 266
366 3300048922 Ga0496119_0015874 Ga0496119_0015874_1345_2145 266
367 3300048923 Ga0496120_0000655 Ga0496120_0000655_33975_34775 266
368 3300049568 Ga0501031_0009585 Ga0501031_0009585_4810_5613 266
369 3300049569 Ga0501032_0006994 Ga0501032_0006994_5527_6330 266
370 3300049570 Ga0501033_0007753 Ga0501033_0007753_5830_6633 266
371 3300049571 Ga0501034_0022284 Ga0501034_0022284_2568_3371 266
372 3300049572 Ga0501036_0017172 Ga0501036_0017172_1442_2245 266
373 3300049573 Ga0501037_0038611 Ga0501037_0038611_244_1047 266
374 3300049574 Ga0501038_0038126 Ga0501038_0038126_1718_2521 266
375 3300049578 Ga0501042_0043943 Ga0501042_0043943_257_1060 266
376 3300049579 Ga0501043_0021246 Ga0501043_0021246_343_1146 266
377 3300049580 Ga0501046_0007020 Ga0501046_0007020_7501_8304 266
378 3300049581 Ga0501047_0010335 Ga0501047_0010335_7289_8092 266
379 3300049582 Ga0501048_0008758 Ga0501048_0008758_5308_6111 266
380 3300049586 Ga0501070_0091215 Ga0501070_0091215_949_1752 266
381 3300049589 Ga0501073_0146193 Ga0501073_0146193_192_995 266
382 3300049822 Ga0501035_0060074 Ga0501035_0060074_1718_2521 266
383 3300049823 Ga0501044_0076027 Ga0501044_0076027_1107_1910 266
384 3300049824 Ga0501045_0020601 Ga0501045_0020601_1234_2037 266
385 3300053140 Ga0500573_0061311 Ga0500573_0061311_474_1283 266
386 3300053142 Ga0500577_0085660 Ga0500577_0085660_95_904 266
387 3300002772 JGI25164J39214_1002166 JGI25164J39214_10021663 267
388 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002606 267
389 3300003578 Ga0006562J51391_1028901 Ga0006562J51391_10289012 267
390 3300003578 Ga0006562J51391_1028902 Ga0006562J51391_10289023 267
391 3300005327 Ga0070658_10000833 Ga0070658_100008333 267
392 3300005327 Ga0070658_10121672 Ga0070658_101216722 267
393 3300005455 Ga0070663_100281656 Ga0070663_1002816562 267
394 3300005563 Ga0068855_100023298 Ga0068855_1000232986 267
395 3300005577 Ga0068857_100124317 Ga0068857_1001243172 267
396 3300005616 Ga0068852_100006614 Ga0068852_1000066142 267
397 3300005616 Ga0068852_100024812 Ga0068852_1000248125 267
398 3300005834 Ga0068851_10000003 Ga0068851_1000000376 267
399 3300009545 Ga0105237_10000131 Ga0105237_1000013176 267
400 3300010375 Ga0105239_10394648 Ga0105239_103946482 267
401 3300025231 Ga0207427_100329 Ga0207427_10032935 267
402 3300025233 Ga0209437_100739 Ga0209437_1007393 267
403 3300025261 Ga0209233_1000001 Ga0209233_10000012201 267
404 3300025321 Ga0207656_10000002 Ga0207656_10000002161 267
405 3300025909 Ga0207705_10000006 Ga0207705_10000006211 267
406 3300025909 Ga0207705_10082199 Ga0207705_100821992 267
407 3300025914 Ga0207671_10000002 Ga0207671_10000002455 267
408 3300025924 Ga0207694_10000092 Ga0207694_1000009259 267
409 3300025949 Ga0207667_10006393 Ga0207667_100063938 267
410 3300026078 Ga0207702_10070091 Ga0207702_100700912 267
411 3300026116 Ga0207674_10004399 Ga0207674_100043995 267
412 3300026142 Ga0207698_10000277 Ga0207698_1000027710 267
413 3300026142 Ga0207698_10057880 Ga0207698_100578802 267
414 3300031649 Ga0307514_10056760 Ga0307514_100567602 267
415 3300031901 Ga0307406_10000833 Ga0307406_100008338 267
416 3300044683 Ga0466965_0000002 Ga0466965_0000002_112612_113415 267
417 3300046460 Ga0495638_0035399 Ga0495638_0035399_468_1271 267
418 3300046471 Ga0495650_0001330 Ga0495650_0001330_17280_18083 267
419 3300048923 Ga0496120_0030306 Ga0496120_0030306_948_1751 267
420 3300048923 Ga0496120_0040968 Ga0496120_0040968_706_1509 267
421 3300048924 Ga0496121_0000277 Ga0496121_0000277_20163_20966 267
422 3300048925 Ga0496122_0000360 Ga0496122_0000360_944_1747 267
423 3300048926 Ga0496123_0002417 Ga0496123_0002417_20880_21683 267
424 3300048927 Ga0496124_0125943 Ga0496124_0125943_756_1559 267
425 3300048929 Ga0496126_0074598 Ga0496126_0074598_425_1228 267
426 3300049568 Ga0501031_0065675 Ga0501031_0065675_1106_1909 267
427 3300049569 Ga0501032_0002800 Ga0501032_0002800_9202_10005 267
428 3300049569 Ga0501032_0069724 Ga0501032_0069724_1315_2118 267
429 3300049570 Ga0501033_0060490 Ga0501033_0060490_1398_2201 267
430 3300049571 Ga0501034_0024988 Ga0501034_0024988_5257_6060 267
431 3300049573 Ga0501037_0006742 Ga0501037_0006742_6157_6960 267
432 3300049574 Ga0501038_0033875 Ga0501038_0033875_435_1238 267
433 3300049579 Ga0501043_0139025 Ga0501043_0139025_557_1360 267
434 3300049579 Ga0501043_0263281 Ga0501043_0263281_291_1094 267
435 3300049581 Ga0501047_0006712 Ga0501047_0006712_4355_5158 267
436 3300049581 Ga0501047_0282473 Ga0501047_0282473_503_1306 267
437 3300049585 Ga0501069_0067808 Ga0501069_0067808_343_1146 267
438 3300049586 Ga0501070_0016947 Ga0501070_0016947_1999_2802 267
439 3300049587 Ga0501071_0000422 Ga0501071_0000422_19966_20769 267
440 3300049589 Ga0501073_0090958 Ga0501073_0090958_269_1072 267
441 3300049744 Ga0501083_0215903 Ga0501083_0215903_312_1115 267
442 3300049822 Ga0501035_0005181 Ga0501035_0005181_2367_3170 267
443 3300049823 Ga0501044_0031929 Ga0501044_0031929_1884_2687 267
444 3300050496 nmdc:mga07m45_127895_c1 nmdc:mga07m45_127895_c1_160_963 267
445 3300053080 Ga0500635_0000013 Ga0500635_0000013_80858_81667 267
446 3300053140 Ga0500573_0034665 Ga0500573_0034665_841_1644 267
447 3300053155 Ga0500620_000060 Ga0500620_000060_18983_19786 267
448 iso_pu_bacteria 2870628048 2870630378 267
449 iso_pu_bacteria 2919523602 2919524402 267
450 3300003760 Ga0055527_1000001 Ga0055527_1000001198 268
451 3300003763 Ga0055529_1000018 Ga0055529_1000018298 268
452 3300005327 Ga0070658_10075378 Ga0070658_100753782 268
453 3300005614 Ga0068856_100121478 Ga0068856_1001214782 268
454 3300020082 Ga0206353_11696786 Ga0206353_116967862 268
455 3300025228 Ga0209672_100006 Ga0209672_100006778 268
456 3300025229 Ga0209147_100868 Ga0209147_1008689 268
457 3300025253 Ga0209677_100523 Ga0209677_10052314 268
458 3300025254 Ga0209148_1000015 Ga0209148_1000015622 268
459 3300025261 Ga0209233_1013893 Ga0209233_10138932 268
460 3300025272 Ga0209455_1000013 Ga0209455_1000013622 268
461 3300025909 Ga0207705_10293633 Ga0207705_102936332 268
462 3300026078 Ga0207702_10110798 Ga0207702_101107983 268
463 3300037312 Ga0395899_0000786 Ga0395899_0000786_18202_19008 268
464 3300037418 Ga0395900_0012475 Ga0395900_0012475_6712_7524 268
465 3300037418 Ga0395900_0120195 Ga0395900_0120195_962_1768 268
466 3300037418 Ga0395900_0363044 Ga0395900_0363044_109_918 268
467 3300037466 Ga0395898_0000752 Ga0395898_0000752_26947_27759 268
468 3300037466 Ga0395898_0128878 Ga0395898_0128878_1234_2040 268
469 3300038443 Ga0395901_0189658 Ga0395901_0189658_127_936 268
470 3300038443 Ga0395901_0397633 Ga0395901_0397633_401_1207 268
471 3300044842 Ga0466957_0081118 Ga0466957_0081118_520_1374 268
472 3300048920 Ga0496117_0022233 Ga0496117_0022233_3103_3909 268
473 3300048921 Ga0496118_0023094 Ga0496118_0023094_240_1046 268
474 3300048925 Ga0496122_0043308 Ga0496122_0043308_1049_1855 268
475 3300005366 Ga0070659_100409250 Ga0070659_1004092501 269
476 3300025904 Ga0207647_10015825 Ga0207647_100158255 269
477 3300025919 Ga0207657_10088806 Ga0207657_100888062 269
478 3300025932 Ga0207690_10175044 Ga0207690_101750441 269
479 3300026041 Ga0207639_10260722 Ga0207639_102607222 269
480 3300038443 Ga0395901_0525919 Ga0395901_0525919_331_1140 269
481 3300048920 Ga0496117_0000235 Ga0496117_0000235_39110_39934 269
482 3300048920 Ga0496117_0029945 Ga0496117_0029945_1267_2076 269
483 3300048921 Ga0496118_0008668 Ga0496118_0008668_6172_6981 269
484 3300049573 Ga0501037_0089882 Ga0501037_0089882_455_1264 269
485 3300049580 Ga0501046_0016323 Ga0501046_0016323_885_1694 269
486 3300049581 Ga0501047_0043118 Ga0501047_0043118_1001_1810 269
487 3300049822 Ga0501035_0112835 Ga0501035_0112835_1389_2198 269
488 3300053140 Ga0500573_0042920 Ga0500573_0042920_1004_1837 269
489 iso_pu_bacteria 2585428157 2588108528 269
490 iso_pu_bacteria 2808606368 2808885665 269
491 iso_pu_bacteria 2852632344 2852634222 269
492 iso_pu_bacteria 2928121344 2928123214 269
493 3300003752 Ga0055539_1000008 Ga0055539_1000008376 270
494 3300003756 Ga0055533_1000001 Ga0055533_1000001694 270
495 3300003759 Ga0055525_1000221 Ga0055525_100022140 270
496 3300003759 Ga0055525_1000365 Ga0055525_100036523 270
497 3300003841 Ga0055541_1009324 Ga0055541_10093242 270
498 3300006038 Ga0075365_10000821 Ga0075365_1000082114 270
499 3300006178 Ga0075367_10018787 Ga0075367_100187874 270
500 3300017792 Ga0163161_10495716 Ga0163161_104957162 270
501 3300025225 Ga0209566_100026 Ga0209566_10002629 270
502 3300025226 Ga0209674_100001 Ga0209674_100001695 270
503 3300025230 Ga0209563_100001 Ga0209563_100001695 270
504 3300025230 Ga0209563_100461 Ga0209563_1004615 270
505 3300025253 Ga0209677_100001 Ga0209677_100001695 270
506 3300044658 Ga0466972_0046432 Ga0466972_0046432_640_1488 270
507 3300044683 Ga0466965_0061679 Ga0466965_0061679_50_898 270
508 3300044684 Ga0466966_0037291 Ga0466966_0037291_925_1737 270
509 3300044693 Ga0466961_0086236 Ga0466961_0086236_975_1823 270
510 3300044765 Ga0466970_0031042 Ga0466970_0031042_1865_2677 270
511 3300044842 Ga0466957_0073490 Ga0466957_0073490_423_1235 270
512 3300045049 Ga0466959_0006345 Ga0466959_0006345_2719_3531 270
513 3300049569 Ga0501032_0017933 Ga0501032_0017933_1001_1813 270
514 3300049569 Ga0501032_0085237 Ga0501032_0085237_139_951 270
515 3300049570 Ga0501033_0012915 Ga0501033_0012915_1850_2662 270
516 3300049570 Ga0501033_0162805 Ga0501033_0162805_516_1328 270
517 3300049571 Ga0501034_0078018 Ga0501034_0078018_2344_3156 270
518 3300049573 Ga0501037_0021415 Ga0501037_0021415_2036_2848 270
519 3300049573 Ga0501037_0066006 Ga0501037_0066006_1504_2316 270
520 3300049574 Ga0501038_0038199 Ga0501038_0038199_2421_3233 270
521 3300049575 Ga0501039_0153251 Ga0501039_0153251_38_850 270
522 3300049575 Ga0501039_0449193 Ga0501039_0449193_13_825 270
523 3300049578 Ga0501042_0042640 Ga0501042_0042640_185_997 270
524 3300049579 Ga0501043_0013204 Ga0501043_0013204_1577_2389 270
525 3300049579 Ga0501043_0044171 Ga0501043_0044171_310_1122 270
526 3300049579 Ga0501043_0091162 Ga0501043_0091162_218_1030 270
527 3300049581 Ga0501047_0010036 Ga0501047_0010036_1660_2472 270
528 3300049581 Ga0501047_0164540 Ga0501047_0164540_334_1146 270
529 3300049581 Ga0501047_0230335 Ga0501047_0230335_734_1546 270
530 3300049589 Ga0501073_0004953 Ga0501073_0004953_6966_7778 270
531 3300049589 Ga0501073_0250990 Ga0501073_0250990_119_931 270
532 3300049742 Ga0501080_0048351 Ga0501080_0048351_2639_3451 270
533 3300049822 Ga0501035_0056307 Ga0501035_0056307_2379_3191 270
534 3300049822 Ga0501035_0185140 Ga0501035_0185140_569_1381 270
535 3300049823 Ga0501044_0077795 Ga0501044_0077795_774_1586 270
536 3300050492 nmdc:mga0yw44_16278_c1 nmdc:mga0yw44_16278_c1_474_1286 270
537 3300050494 nmdc:mga06z11_29106_c1 nmdc:mga06z11_29106_c1_808_1620 270
538 3300053117 Ga0500593_076599 Ga0500593_076599_415_1227 270
539 iso_pu_bacteria 2844841374 2844842361 270
540 iso_pu_bacteria 2919055335 2919058009 270
541 iso_pu_bacteria 2928153084 2928155976 270
542 iso_pu_bacteria 8056037122 8056039516 270
543 3300048920 Ga0496117_0010509 Ga0496117_0010509_1333_2148 271
544 3300048921 Ga0496118_0009005 Ga0496118_0009005_2229_3044 271
545 3300048922 Ga0496119_0007470 Ga0496119_0007470_4449_5264 271
546 3300048925 Ga0496122_0000200 Ga0496122_0000200_73586_74401 271
547 3300048926 Ga0496123_0000076 Ga0496123_0000076_119636_120451 271
548 3300048927 Ga0496124_0018523 Ga0496124_0018523_4018_4833 271
549 3300048929 Ga0496126_0033121 Ga0496126_0033121_3366_4181 271
550 3300048929 Ga0496126_0107727 Ga0496126_0107727_933_1748 271
551 3300025272 Ga0209455_1000979 Ga0209455_100097911 272
552 3300044683 Ga0466965_0008852 Ga0466965_0008852_525_1343 272
553 3300044842 Ga0466957_0081347 Ga0466957_0081347_692_1510 272
554 3300044901 Ga0466960_0050687 Ga0466960_0050687_357_1175 272
555 3300045049 Ga0466959_0060247 Ga0466959_0060247_1197_2015 272
556 3300048904 Ga0496101_0064501 Ga0496101_0064501_1577_2401 272
557 3300048905 Ga0496102_0090718 Ga0496102_0090718_1358_2182 272
558 3300048908 Ga0496105_0066952 Ga0496105_0066952_1597_2421 272
559 3300048918 Ga0496115_0032163 Ga0496115_0032163_321_1145 272
560 3300048929 Ga0496126_0057518 Ga0496126_0057518_2055_2879 272
561 3300044693 Ga0466961_0141798 Ga0466961_0141798_343_1164 273
562 3300049744 Ga0501083_0000052 Ga0501083_0000052_40489_41310 273
563 3300002067 JGI24735J21928_10016514 JGI24735J21928_100165142 274
564 3300003578 Ga0006562J51391_1169475 Ga0006562J51391_11694752 274
565 3300003578 Ga0006562J51391_1169476 Ga0006562J51391_11694762 274
566 3300025929 Ga0207664_10147835 Ga0207664_101478354 274
567 3300048920 Ga0496117_0015928 Ga0496117_0015928_60_884 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

32

242

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4onc-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9737 20 257
4onc-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis decaprenyl diphosphate synthase in complex with bph-640 0.9684 20 261
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9653 24 254
2vg3-assembly1.cif.gz_A rv2361 with citronellyl pyrophosphate 0.9617 20 261
7cpn-assembly2.cif.gz_D crystal structure of dodecaprenyl diphosphate synthase from thermobifida fusca 0.9568 24 254
ID Description Score Start End Superfamily
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9694 20 254 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9604 31 254 3.40.1180.10
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9513 32 252 3.40.1180.10
5hxoA00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9506 33 254 3.40.1180.10
af_Q5FC21_4_262_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9496 32 252 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A6B3IRB1-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9943 41 162 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A7K0Z2S2-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9879 40 207 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A6B3IRB1-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9863 41 162 GO:0000287
GO:0005829
GO:0005886
GO:0008834
GO:0016094
GO:0030145
GO:0033850
GO:0045547
AF-A0A382VUM9-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9827 33 166 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A519WDT9-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9776 32 202 GO:0008834
GO:0016094
GO:0045547

Feature Viewer

pLDDT pTM Quality
89.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map