F464399

General Info

Members Datasets Scaffolds Average Seq Length
566 277 1132 257

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10019482|Ga0207697_100194823
Length 248
Sequence MSSPVICFGQQPCGIFPRRFLYAKIQTACLLQREIGGEIVFFYHDSDHDPRETITILRDHDGHLRRLNFQFANKLQKQFSPLEWKEKIARQLPQCVTASLVEYFKQTDADNVADFCLQMYQRMGLLDGVQVTRSGDPRVRERAIAVDDYFVDVRYEGELVRARLSDDCLLLHKGGKNYIKLPLEEHEKTQISPTRDTRLRWMQSVVRCTHYVCGAGEGRYLKTSDAPDVQFITRDEISESDRAYVPEV

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 3.89
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 19.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10019482 3300025315 Bacteria 2779
2 MRS1b_contig_6164211 2162886011 Bacteria 1634
3 MBSR1b_contig_4098306 2162886012 Bacteria 1212
4 CNXas_1000140 3300000545 Bacteria 12749
5 Ga0055542_1000409 3300003762 Bacteria 41890
6 Ga0065703_1018977 3300005272 Unclassified 4610
7 Ga0065712_10088686 3300005290 Unclassified 2507
8 Ga0065712_10136769 3300005290 Bacteria 1477
9 Ga0065712_10142945 3300005290 Bacteria 1434
10 Ga0065715_10009912 3300005293 Bacteria 3022
11 Ga0065715_10037900 3300005293 Bacteria 1273
12 Ga0065715_10105334 3300005293 Bacteria 2891
13 Ga0065707_10025915 3300005295 Bacteria 1296
14 Ga0070658_10034470 3300005327 Bacteria 4072
15 Ga0070658_10256263 3300005327 Bacteria 1485
16 Ga0070676_10229209 3300005328 Bacteria 1231
17 Ga0070683_100006820 3300005329 Bacteria 9598
18 Ga0070683_100093817 3300005329 Bacteria 2820
19 Ga0070683_100128859 3300005329 Bacteria 2393
20 Ga0070683_100497463 3300005329 Bacteria 1164
21 Ga0070690_100046063 3300005330 Unclassified 2772
22 Ga0070690_100107391 3300005330 Bacteria 1858
23 Ga0070670_100004392 3300005331 Bacteria 11803
24 Ga0070670_100052416 3300005331 Bacteria 3504
25 Ga0070670_100079878 3300005331 Unclassified 2811
26 Ga0070666_10054279 3300005335 Unclassified 2703
27 Ga0068868_100239354 3300005338 Unclassified 1524
28 Ga0068868_100252834 3300005338 Unclassified 1484
29 Ga0068868_100419649 3300005338 Bacteria 1158
30 Ga0070660_100175126 3300005339 Unclassified 1735
31 Ga0070660_100175741 3300005339 Bacteria 1732
32 Ga0070689_100689656 3300005340 Bacteria 891
33 Ga0070687_100414520 3300005343 Unclassified 887
34 Ga0070661_100032908 3300005344 Bacteria 3755
35 Ga0070661_100141742 3300005344 Bacteria 1812
36 Ga0070692_10098822 3300005345 Unclassified 1597
37 Ga0070692_10342831 3300005345 Unclassified 926
38 Ga0070675_100108999 3300005354 Bacteria 2339
39 Ga0070675_100233730 3300005354 Bacteria 1604
40 Ga0070675_100237338 3300005354 Bacteria 1592
41 Ga0070675_100382818 3300005354 Unclassified 1252
42 Ga0070675_100471975 3300005354 Bacteria 1127
43 Ga0070671_100008822 3300005355 Bacteria 8090
44 Ga0070671_100086563 3300005355 Bacteria 2622
45 Ga0070674_100447216 3300005356 Unclassified 1066
46 Ga0070673_100008347 3300005364 Bacteria 6881
47 Ga0070659_100072701 3300005366 Bacteria 2737
48 Ga0070659_100101372 3300005366 Unclassified 2318
49 Ga0070667_100095653 3300005367 Bacteria 2561
50 Ga0070667_100143955 3300005367 Bacteria 2089
51 Ga0070714_100653268 3300005435 Unclassified 1012
52 Ga0070713_100072865 3300005436 Bacteria 2906
53 Ga0070713_100292092 3300005436 Unclassified 1498
54 Ga0070713_100438943 3300005436 Unclassified 1224
55 Ga0070713_100480064 3300005436 Unclassified 1171
56 Ga0070710_10141567 3300005437 Unclassified 1476
57 Ga0070701_10121542 3300005438 Unclassified 1472
58 Ga0070711_100019817 3300005439 Bacteria 4323
59 Ga0070711_100020107 3300005439 Bacteria 4297
60 Ga0070705_100033287 3300005440 Bacteria 2872
61 Ga0070705_100037877 3300005440 Bacteria 2724
62 Ga0070694_100000430 3300005444 Bacteria 22877
63 Ga0070694_100041267 3300005444 Bacteria 3077
64 Ga0070694_100215695 3300005444 Bacteria 1437
65 Ga0070694_100247693 3300005444 Unclassified 1347
66 Ga0070708_100010987 3300005445 Bacteria 7357
67 Ga0070708_100054603 3300005445 Bacteria 3548
68 Ga0070708_100054841 3300005445 Bacteria 3542
69 Ga0070708_100072039 3300005445 Bacteria 3113
70 Ga0070678_100384690 3300005456 Bacteria 1215
71 Ga0070662_100075076 3300005457 Bacteria 2503
72 Ga0070681_10092756 3300005458 Bacteria 2968
73 Ga0070681_10120567 3300005458 Bacteria 2558
74 Ga0070681_10232770 3300005458 Bacteria 1757
75 Ga0070681_10336333 3300005458 Bacteria 1419
76 Ga0068867_100528497 3300005459 Bacteria 1018
77 Ga0070706_100001499 3300005467 Bacteria 24511
78 Ga0070706_100015363 3300005467 Bacteria 7069
79 Ga0070706_100030431 3300005467 Bacteria 4974
80 Ga0070706_100176480 3300005467 Bacteria 1995
81 Ga0070706_100177970 3300005467 Unclassified 1986
82 Ga0070707_100007451 3300005468 Bacteria 10160
83 Ga0070707_100011887 3300005468 Bacteria 8125
84 Ga0070707_100088568 3300005468 Bacteria 2994
85 Ga0070707_100195725 3300005468 Bacteria 1971
86 Ga0070698_100040380 3300005471 Unclassified 4796
87 Ga0070698_100104495 3300005471 Unclassified 2802
88 Ga0070698_100257077 3300005471 Bacteria 1679
89 Ga0070699_100188706 3300005518 Unclassified 1831
90 Ga0070684_100045114 3300005535 Unclassified 3816
91 Ga0070684_100047081 3300005535 Unclassified 3737
92 Ga0070684_100103057 3300005535 Bacteria 2552
93 Ga0070684_100418992 3300005535 Bacteria 1236
94 Ga0070684_100481142 3300005535 Bacteria 1149
95 Ga0070697_100010159 3300005536 Bacteria 7345
96 Ga0070697_100066193 3300005536 Unclassified 2954
97 Ga0070672_100093743 3300005543 Unclassified 2426
98 Ga0070672_100123126 3300005543 Bacteria 2125
99 Ga0070696_100038060 3300005546 Bacteria 3319
100 Ga0070696_100127882 3300005546 Bacteria 1845
101 Ga0070665_100078301 3300005548 Bacteria 3312
102 Ga0070665_100242068 3300005548 Bacteria 1804
103 Ga0070704_100006480 3300005549 Bacteria 6903
104 Ga0070704_100077368 3300005549 Bacteria 2437
105 Ga0070704_100097521 3300005549 Bacteria 2206
106 Ga0070704_100227473 3300005549 Bacteria 1520
107 Ga0070704_100332241 3300005549 Bacteria 1277
108 Ga0068855_100025268 3300005563 Bacteria 7110
109 Ga0070664_100408739 3300005564 Bacteria 1242
110 Ga0068857_100002331 3300005577 Bacteria 15435
111 Ga0068857_100120589 3300005577 Unclassified 2361
112 Ga0068856_100000160 3300005614 Bacteria 69926
113 Ga0068856_100053851 3300005614 Bacteria 3968
114 Ga0068856_100169316 3300005614 Bacteria 2196
115 Ga0068859_100063521 3300005617 Bacteria 3723
116 Ga0068859_100123505 3300005617 Bacteria 2656
117 Ga0068859_100203103 3300005617 Bacteria 2067
118 Ga0068859_100261150 3300005617 Bacteria 1823
119 Ga0068864_100169080 3300005618 Bacteria 1992
120 Ga0068864_100484891 3300005618 Unclassified 1187
121 Ga0068863_100028911 3300005841 Bacteria 5293
122 Ga0068863_100673777 3300005841 Bacteria 1027
123 Ga0068858_100003575 3300005842 Bacteria 15382
124 Ga0068862_100022542 3300005844 Bacteria 5269
125 Ga0068862_100097396 3300005844 Bacteria 2568
126 Ga0068862_100203025 3300005844 Unclassified 1788
127 Ga0081455_10031035 3300005937 Bacteria 4843
128 Ga0081539_10001306 3300005985 Bacteria 43581
129 Ga0070717_10029185 3300006028 Unclassified 4422
130 Ga0070717_10034320 3300006028 Bacteria 4100
131 Ga0070717_10067240 3300006028 Bacteria 2981
132 Ga0070717_10106276 3300006028 Unclassified 2390
133 Ga0070717_10169098 3300006028 Bacteria 1900
134 Ga0075432_10113688 3300006058 Bacteria 1011
135 Ga0070715_10136917 3300006163 Unclassified 1185
136 Ga0070715_10202123 3300006163 Bacteria 1010
137 Ga0070716_100259822 3300006173 Unclassified 1188
138 Ga0070716_100507508 3300006173 Unclassified 891
139 Ga0070712_100005048 3300006175 Bacteria 8174
140 Ga0070712_100194631 3300006175 Bacteria 1589
141 Ga0070712_100226196 3300006175 Bacteria 1483
142 Ga0075367_10247241 3300006178 Bacteria 1118
143 Ga0075366_10046479 3300006195 Unclassified 2572
144 Ga0097621_100288341 3300006237 Bacteria 1447
145 Ga0068871_100136957 3300006358 Bacteria 2080
146 Ga0068871_100150309 3300006358 Bacteria 1986
147 Ga0075431_100010378 3300006847 Bacteria 9358
148 Ga0097620_100063522 3300006931 Bacteria 3723
149 Ga0097620_100123507 3300006931 Bacteria 2656
150 Ga0097620_100203114 3300006931 Bacteria 2067
151 Ga0097620_100261158 3300006931 Bacteria 1823
152 Ga0075435_100060840 3300007076 Unclassified 3062
153 Ga0099795_10020100 3300007788 Bacteria 2171
154 Ga0105240_10002835 3300009093 Bacteria 27410
155 Ga0105240_10097559 3300009093 Bacteria 3581
156 Ga0105240_10272328 3300009093 Bacteria 1949
157 Ga0105240_11147525 3300009093 Unclassified 825
158 Ga0105245_10589638 3300009098 Bacteria 1137
159 Ga0105247_10011097 3300009101 Bacteria 5433
160 Ga0105247_10041362 3300009101 Bacteria 2821
161 Ga0114129_10040264 3300009147 Bacteria 6587
162 Ga0114129_10075342 3300009147 Bacteria 4698
163 Ga0114129_10109863 3300009147 Bacteria 3806
164 Ga0114129_10208266 3300009147 Bacteria 2645
165 Ga0105243_10062034 3300009148 Bacteria 2992
166 Ga0105241_10133412 3300009174 Bacteria 2013
167 Ga0105242_10286681 3300009176 Unclassified 1498
168 Ga0105248_10192303 3300009177 Bacteria 2299
169 Ga0105237_10236820 3300009545 Bacteria 1827
170 Ga0105237_10326495 3300009545 Bacteria 1538
171 Ga0105238_10014396 3300009551 Bacteria 7994
172 Ga0105238_10765046 3300009551 Unclassified 980
173 Ga0105238_10824650 3300009551 Bacteria 944
174 Ga0105249_10020051 3300009553 Bacteria 5971
175 Ga0105249_10065296 3300009553 Bacteria 3348
176 Ga0105249_10292626 3300009553 Unclassified 1630
177 Ga0105249_10467126 3300009553 Bacteria 1303
178 Ga0105249_10565764 3300009553 Bacteria 1189
179 Ga0099796_10135534 3300010159 Unclassified 958
180 Ga0105239_10237945 3300010375 Bacteria 2044
181 Ga0105239_10413437 3300010375 Bacteria 1527
182 Ga0105239_10496224 3300010375 Unclassified 1388
183 Ga0105246_10424269 3300011119 Bacteria 1111
184 Ga0157315_1001280 3300012508 Unclassified 1369
185 Ga0157370_10112332 3300013104 Bacteria 2547
186 Ga0157369_10157750 3300013105 Bacteria 2396
187 Ga0157374_10011295 3300013296 Bacteria 7724
188 Ga0157374_10318825 3300013296 Bacteria 1540
189 Ga0157378_10161252 3300013297 Bacteria 2097
190 Ga0157378_10179924 3300013297 Unclassified 1988
191 Ga0157378_10279843 3300013297 Bacteria 1608
192 Ga0163162_10007927 3300013306 Bacteria 10355
193 Ga0163162_10443198 3300013306 Unclassified 1431
194 Ga0157372_10135649 3300013307 Bacteria 2834
195 Ga0157372_11268656 3300013307 Unclassified 850
196 Ga0157375_10004336 3300013308 Bacteria 12319
197 Ga0157375_10010789 3300013308 Bacteria 8048
198 Ga0157375_10011773 3300013308 Bacteria 7734
199 Ga0157375_10341869 3300013308 Bacteria 1662
200 Ga0163163_10617087 3300014325 Bacteria 1148
201 Ga0182008_10111903 3300014497 Unclassified 1353
202 Ga0157379_10182225 3300014968 Bacteria 1897
203 Ga0157379_10251293 3300014968 Unclassified 1605
204 Ga0157379_10296557 3300014968 Bacteria 1473
205 Ga0157376_10016501 3300014969 Bacteria 5609
206 Ga0157376_10020933 3300014969 Bacteria 5070
207 Ga0157376_10030822 3300014969 Bacteria 4287
208 Ga0157376_10071522 3300014969 Unclassified 2948
209 Ga0157376_10212533 3300014969 Bacteria 1787
210 Ga0182007_10039015 3300015262 Unclassified 1591
211 Ga0182005_1091888 3300015265 Bacteria 844
212 Ga0209258_100149 3300025242 Bacteria 162184
213 Ga0209148_1000143 3300025254 Bacteria 162184
214 Ga0209455_1001395 3300025272 Bacteria 10976
215 Ga0207673_1011716 3300025290 Unclassified 1137
216 Ga0207697_10004774 3300025315 Bacteria 6412
217 Ga0207697_10010657 3300025315 Bacteria 3922
218 Ga0207697_10011490 3300025315 Unclassified 3743
219 Ga0207697_10014480 3300025315 Bacteria 3270
220 Ga0207697_10036704 3300025315 Bacteria 2007
221 Ga0207697_10042447 3300025315 Unclassified 1869
222 Ga0207653_10049889 3300025885 Bacteria 1390
223 Ga0207653_10084363 3300025885 Unclassified 1104
224 Ga0207692_10012305 3300025898 Unclassified 3671
225 Ga0207642_10187666 3300025899 Bacteria 1132
226 Ga0207647_10003697 3300025904 Bacteria 11437
227 Ga0207685_10103537 3300025905 Unclassified 1221
228 Ga0207685_10112492 3300025905 Unclassified 1182
229 Ga0207699_10069706 3300025906 Bacteria 2145
230 Ga0207645_10005978 3300025907 Bacteria 8760
231 Ga0207645_10038210 3300025907 Bacteria 3079
232 Ga0207645_10047317 3300025907 Bacteria 2747
233 Ga0207705_10285456 3300025909 Bacteria 1264
234 Ga0207684_10000662 3300025910 Bacteria 40821
235 Ga0207684_10015334 3300025910 Bacteria 6597
236 Ga0207684_10130980 3300025910 Bacteria 2152
237 Ga0207684_10216321 3300025910 Unclassified 1653
238 Ga0207684_10267391 3300025910 Bacteria 1475
239 Ga0207707_10216083 3300025912 Bacteria 1669
240 Ga0207695_10010863 3300025913 Bacteria 11089
241 Ga0207695_10079895 3300025913 Unclassified 3313
242 Ga0207695_10407530 3300025913 Bacteria 1244
243 Ga0207671_10261374 3300025914 Bacteria 1362
244 Ga0207693_10005286 3300025915 Bacteria 10794
245 Ga0207693_10005814 3300025915 Bacteria 10233
246 Ga0207693_10044942 3300025915 Unclassified 3470
247 Ga0207693_10095987 3300025915 Bacteria 2324
248 Ga0207693_10126730 3300025915 Bacteria 2007
249 Ga0207693_10564913 3300025915 Unclassified 887
250 Ga0207663_10007812 3300025916 Bacteria 5569
251 Ga0207660_10176310 3300025917 Bacteria 1657
252 Ga0207657_10217641 3300025919 Bacteria 1531
253 Ga0207657_10367889 3300025919 Unclassified 1133
254 Ga0207649_10013217 3300025920 Bacteria 4607
255 Ga0207649_10392009 3300025920 Unclassified 1037
256 Ga0207646_10005978 3300025922 Bacteria 12690
257 Ga0207646_10019129 3300025922 Bacteria 6369
258 Ga0207646_10086888 3300025922 Bacteria 2798
259 Ga0207681_10156171 3300025923 Bacteria 1715
260 Ga0207694_10014801 3300025924 Bacteria 5881
261 Ga0207650_10025406 3300025925 Bacteria 4219
262 Ga0207659_10033153 3300025926 Bacteria 3552
263 Ga0207659_10081973 3300025926 Bacteria 2387
264 Ga0207659_10214000 3300025926 Bacteria 1546
265 Ga0207659_10225625 3300025926 Bacteria 1508
266 Ga0207659_10289319 3300025926 Unclassified 1342
267 Ga0207700_10077939 3300025928 Bacteria 2576
268 Ga0207664_10032290 3300025929 Bacteria 4011
269 Ga0207644_10012286 3300025931 Bacteria 5684
270 Ga0207644_10054455 3300025931 Bacteria 2881
271 Ga0207644_10072025 3300025931 Bacteria 2530
272 Ga0207690_10052626 3300025932 Bacteria 2728
273 Ga0207690_10179579 3300025932 Unclassified 1593
274 Ga0207706_10088780 3300025933 Bacteria 2717
275 Ga0207706_10132798 3300025933 Bacteria 2190
276 Ga0207670_10041089 3300025936 Bacteria 3039
277 Ga0207670_10098399 3300025936 Bacteria 2085
278 Ga0207704_10174775 3300025938 Bacteria 1545
279 Ga0207665_10006438 3300025939 Bacteria 7791
280 Ga0207665_10073368 3300025939 Bacteria 2340
281 Ga0207665_10080401 3300025939 Bacteria 2242
282 Ga0207691_10021981 3300025940 Bacteria 6020
283 Ga0207711_10099172 3300025941 Bacteria 2574
284 Ga0207661_10132853 3300025944 Bacteria 2134
285 Ga0207679_10175562 3300025945 Bacteria 1768
286 Ga0207679_10477676 3300025945 Bacteria 1109
287 Ga0207667_10070941 3300025949 Unclassified 3624
288 Ga0207667_10287714 3300025949 Unclassified 1679
289 Ga0207667_10886068 3300025949 Bacteria 885
290 Ga0207651_10428429 3300025960 Unclassified 1131
291 Ga0207712_10033662 3300025961 Bacteria 3466
292 Ga0207712_10037856 3300025961 Bacteria 3294
293 Ga0207712_10103005 3300025961 Bacteria 2126
294 Ga0207712_10243045 3300025961 Unclassified 1451
295 Ga0207668_10036133 3300025972 Unclassified 3296
296 Ga0207668_10418948 3300025972 Bacteria 1136
297 Ga0207668_10451512 3300025972 Bacteria 1097
298 Ga0207658_10413795 3300025986 Bacteria 1187
299 Ga0207677_10380932 3300026023 Bacteria 1191
300 Ga0207639_10143784 3300026041 Unclassified 1990
301 Ga0207702_10078454 3300026078 Bacteria 2859
302 Ga0207702_10283015 3300026078 Bacteria 1568
303 Ga0207641_10158334 3300026088 Bacteria 2057
304 Ga0207641_10450247 3300026088 Bacteria 1244
305 Ga0207676_10216229 3300026095 Unclassified 1704
306 Ga0207674_10042661 3300026116 Bacteria 4683
307 Ga0207675_100027610 3300026118 Bacteria 5287
308 Ga0207675_100063764 3300026118 Bacteria 3443
309 Ga0207683_10022716 3300026121 Bacteria 5387
310 Ga0207683_10024351 3300026121 Bacteria 5213
311 Ga0207683_10231510 3300026121 Bacteria 1685
312 Ga0268266_10098991 3300028379 Unclassified 2566
313 Ga0268265_10060327 3300028380 Bacteria 2906
314 Ga0268264_10261354 3300028381 Bacteria 1613
315 Ga0268264_10402958 3300028381 Bacteria 1315
316 Ga0265337_1000445 3300028556 Bacteria 21986
317 Ga0265337_1001456 3300028556 Bacteria 11609
318 Ga0265326_10000964 3300028558 Bacteria 10399
319 Ga0265319_1001567 3300028563 Bacteria 13416
320 Ga0265319_1002617 3300028563 Bacteria 9700
321 Ga0265319_1004592 3300028563 Bacteria 6797
322 Ga0265319_1004724 3300028563 Bacteria 6674
323 Ga0265319_1025690 3300028563 Bacteria 2105
324 Ga0265334_10008038 3300028573 Bacteria 4503
325 Ga0265318_10000016 3300028577 Bacteria 184782
326 Ga0265318_10001565 3300028577 Bacteria 13289
327 Ga0265318_10010742 3300028577 Bacteria 3975
328 Ga0265318_10026496 3300028577 Bacteria 2282
329 Ga0265318_10069318 3300028577 Bacteria 1308
330 Ga0265323_10004291 3300028653 Bacteria 6154
331 Ga0265323_10012072 3300028653 Bacteria 3470
332 Ga0265323_10024626 3300028653 Bacteria 2286
333 Ga0265323_10047224 3300028653 Bacteria 1541
334 Ga0265322_10010563 3300028654 Bacteria 2680
335 Ga0265338_10000177 3300028800 Bacteria 118670
336 Ga0265338_10000495 3300028800 Bacteria 70342
337 Ga0265338_10005525 3300028800 Bacteria 16480
338 Ga0265338_10034149 3300028800 Bacteria 4921
339 Ga0265338_10063030 3300028800 Bacteria 3236
340 Ga0265338_10148598 3300028800 Unclassified 1824
341 Ga0265324_10000785 3300029957 Bacteria 20872
342 Ga0265324_10004177 3300029957 Bacteria 6607
343 Ga0265324_10093299 3300029957 Bacteria 1024
344 Ga0265330_10025467 3300031235 Bacteria 2681
345 Ga0265332_10059051 3300031238 Unclassified 1642
346 Ga0265328_10030535 3300031239 Bacteria 2007
347 Ga0265320_10000375 3300031240 Bacteria 36376
348 Ga0265320_10001487 3300031240 Bacteria 17114
349 Ga0265320_10001561 3300031240 Bacteria 16482
350 Ga0265320_10012765 3300031240 Bacteria 4868
351 Ga0265320_10024304 3300031240 Bacteria 3207
352 Ga0265320_10043535 3300031240 Bacteria 2218
353 Ga0265320_10148125 3300031240 Bacteria 1061
354 Ga0265325_10005235 3300031241 Bacteria 8054
355 Ga0265340_10000564 3300031247 Bacteria 20575
356 Ga0265340_10000880 3300031247 Bacteria 17010
357 Ga0265340_10139767 3300031247 Bacteria 1108
358 Ga0265339_10043236 3300031249 Bacteria 2492
359 Ga0265331_10019621 3300031250 Bacteria 3488
360 Ga0265327_10000188 3300031251 Bacteria 130649
361 Ga0265327_10030270 3300031251 Bacteria 3063
362 Ga0265316_10009610 3300031344 Bacteria 8886
363 Ga0265316_10035792 3300031344 Bacteria 4019
364 Ga0265316_10039420 3300031344 Bacteria 3794
365 Ga0265316_10087195 3300031344 Unclassified 2385
366 Ga0307513_10018229 3300031456 Bacteria 8395
367 Ga0265313_10000905 3300031595 Bacteria 29781
368 Ga0265313_10002676 3300031595 Bacteria 15100
369 Ga0265313_10005753 3300031595 Bacteria 9022
370 Ga0265313_10006331 3300031595 Bacteria 8421
371 Ga0307508_10000116 3300031616 Bacteria 94844
372 Ga0265314_10000596 3300031711 Bacteria 45506
373 Ga0265314_10146868 3300031711 Bacteria 1451
374 Ga0265314_10165994 3300031711 Bacteria 1338
375 Ga0265342_10035384 3300031712 Bacteria 3057
376 Ga0265342_10071228 3300031712 Bacteria 2026
377 Ga0265342_10071554 3300031712 Bacteria 2020
378 Ga0373953_0078990 3300035117 Unclassified 1366
379 Ga0373954_0080833 3300035118 Bacteria 1553
380 Ga0373954_0090092 3300035118 Bacteria 1472
381 Ga0373956_0006594 3300035119 Bacteria 4654
382 Ga0373957_0128036 3300035120 Bacteria 1032
383 Ga0373943_0023371 3300035170 Bacteria 2874
384 Ga0373943_0137107 3300035170 Bacteria 1315
385 Ga0373946_0065626 3300035171 Bacteria 1555
386 Ga0373955_0163029 3300035172 Unclassified 1317
387 Ga0373942_0068555 3300035207 Bacteria 1031
388 Ga0373924_0152082 3300035410 Unclassified 1013
389 Ga0373935_0095348 3300035692 Bacteria 1954
390 Ga0373933_0011081 3300035724 Bacteria 4956
391 Ga0373933_0223717 3300035724 Bacteria 1208
392 Ga0373947_0274705 3300035725 Bacteria 1119
393 Ga0373947_0342362 3300035725 Bacteria 1002
394 Ga0373937_0007073 3300036401 Bacteria 9695
395 Ga0373937_0079193 3300036401 Bacteria 3037
396 Ga0395898_0129393 3300037466 Bacteria 2419
397 Ga0395901_0094526 3300038443 Bacteria 3132
398 Ga0451841_1412240 3300041498 Unclassified 1132
399 Ga0439458_0005186 3300042157 Bacteria 2935
400 Ga0451577_0000017 3300042876 Bacteria 523453
401 Ga0439440_0032991 3300042993 Unclassified 1232
402 Ga0466969_0061279 3300044656 Bacteria 1828
403 Ga0453683_0045440 3300044673 Bacteria 2754
404 Ga0453684_0021335 3300044712 Bacteria 9686
405 Ga0466957_0465729 3300044842 Unclassified 873
406 Ga0451576_0000443 3300045051 Bacteria 94447
407 Ga0451576_0001225 3300045051 Bacteria 45502
408 Ga0451576_0048695 3300045051 Unclassified 4450
409 Ga0451576_0086679 3300045051 Bacteria 3257
410 Ga0451576_0196530 3300045051 Unclassified 2107
411 Ga0451576_0434384 3300045051 Bacteria 1378
412 Ga0451576_0570672 3300045051 Bacteria 1189
413 Ga0451576_0707045 3300045051 Bacteria 1059
414 Ga0466967_0108245 3300045976 Bacteria 2550
415 Ga0466967_0223510 3300045976 Bacteria 1790
416 Ga0495592_0136323 3300046454 Bacteria 1711
417 Ga0495629_0016309 3300046459 Bacteria 5330
418 Ga0495629_0299706 3300046459 Bacteria 1101
419 Ga0495641_0150367 3300046461 Unclassified 1041
420 Ga0495651_0379549 3300046462 Bacteria 927
421 Ga0495653_0172813 3300046463 Unclassified 1490
422 Ga0495580_0121511 3300046472 Bacteria 1813
423 Ga0495662_0021760 3300046476 Bacteria 3098
424 Ga0495664_0015106 3300046477 Bacteria 4386
425 Ga0495664_0051624 3300046477 Bacteria 2442
426 Ga0495594_0177943 3300046499 Bacteria 1211
427 Ga0495618_0000362 3300046514 Bacteria 32670
428 Ga0495618_0002205 3300046514 Bacteria 12740
429 Ga0495618_0156074 3300046514 Unclassified 1456
430 Ga0495628_0000028 3300046516 Bacteria 126332
431 Ga0495628_0128537 3300046516 Bacteria 1939
432 Ga0495630_0009365 3300046517 Bacteria 7040
433 Ga0495630_0069867 3300046517 Bacteria 2642
434 Ga0495630_0089853 3300046517 Bacteria 2321
435 Ga0495630_0140605 3300046517 Bacteria 1835
436 Ga0495630_0571053 3300046517 Unclassified 867
437 Ga0495652_0016125 3300046529 Bacteria 6684
438 Ga0495652_0038804 3300046529 Bacteria 4123
439 Ga0495640_0020559 3300046533 Bacteria 4857
440 Ga0495640_0240243 3300046533 Bacteria 1137
441 Ga0495586_0000312 3300046535 Bacteria 30763
442 Ga0495586_0000351 3300046535 Bacteria 28823
443 Ga0495586_0035087 3300046535 Bacteria 2694
444 Ga0495587_0100605 3300046536 Unclassified 1666
445 Ga0495587_0129803 3300046536 Bacteria 1441
446 Ga0495587_0236592 3300046536 Unclassified 1028
447 Ga0495645_0027361 3300046543 Bacteria 4143
448 Ga0495645_0056784 3300046543 Unclassified 2842
449 Ga0495645_0059607 3300046543 Unclassified 2767
450 Ga0495645_0218001 3300046543 Bacteria 1285
451 Ga0495667_0118792 3300046559 Bacteria 1707
452 Ga0495667_0206628 3300046559 Bacteria 1256
453 Ga0495634_0000607 3300046642 Bacteria 34699
454 Ga0495634_0114547 3300046642 Bacteria 1731
455 Ga0495634_0216991 3300046642 Unclassified 1182
456 Ga0495635_0095948 3300046663 Bacteria 2027
457 Ga0495635_0116367 3300046663 Bacteria 1825
458 Ga0495599_0016698 3300046678 Bacteria 4559
459 Ga0495599_0020872 3300046678 Bacteria 4083
460 Ga0495599_0102603 3300046678 Bacteria 1782
461 Ga0495646_0087848 3300046680 Unclassified 1801
462 Ga0495647_0169591 3300046681 Bacteria 944
463 Ga0495669_0037228 3300046684 Bacteria 2153
464 Ga0495613_0000430 3300046689 Bacteria 35890
465 Ga0495613_0326607 3300046689 Unclassified 1058
466 Ga0495624_0162778 3300046690 Unclassified 1363
467 Ga0495624_0326210 3300046690 Bacteria 924
468 Ga0495581_0005163 3300047315 Bacteria 7556
469 Ga0495674_0081901 3300047319 Bacteria 2768
470 Ga0495674_0180388 3300047319 Bacteria 1759
471 Ga0495680_0410554 3300047322 Bacteria 933
472 Ga0495680_0469261 3300047322 Unclassified 859
473 Ga0495675_0121607 3300047444 Bacteria 1626
474 Ga0495675_0216888 3300047444 Unclassified 1159
475 Ga0495684_0196202 3300047471 Bacteria 1490
476 Ga0495684_0240018 3300047471 Unclassified 1322
477 Ga0496101_0179434 3300048904 Bacteria 1630
478 Ga0496102_0313435 3300048905 Bacteria 1478
479 Ga0496104_0025968 3300048907 Bacteria 5402
480 Ga0496104_0061353 3300048907 Bacteria 3565
481 Ga0496104_0239121 3300048907 Bacteria 1728
482 Ga0496105_0071751 3300048908 Bacteria 2862
483 Ga0496105_0083977 3300048908 Unclassified 2630
484 Ga0496107_0260202 3300048910 Bacteria 1291
485 Ga0496108_0099268 3300048911 Bacteria 2482
486 Ga0496108_0343648 3300048911 Bacteria 1302
487 Ga0496109_0021551 3300048912 Bacteria 5700
488 Ga0496110_0512094 3300048913 Bacteria 1092
489 Ga0496111_0121187 3300048914 Unclassified 1932
490 Ga0496112_0134715 3300048915 Bacteria 2441
491 Ga0496112_0181588 3300048915 Unclassified 2068
492 Ga0496113_0053639 3300048916 Bacteria 3015
493 Ga0496113_0140426 3300048916 Bacteria 1900
494 Ga0496114_0045179 3300048917 Bacteria 3658
495 Ga0496114_0239516 3300048917 Bacteria 1595
496 Ga0496115_0011569 3300048918 Bacteria 6616
497 Ga0496115_0039220 3300048918 Unclassified 3760
498 Ga0496115_0433562 3300048918 Bacteria 1063
499 Ga0501031_0025927 3300049568 Bacteria 3823
500 Ga0501031_0094640 3300049568 Bacteria 1949
501 Ga0501032_0000106 3300049569 Bacteria 71183
502 Ga0501032_0029139 3300049569 Bacteria 3791
503 Ga0501032_0059928 3300049569 Bacteria 2553
504 Ga0501033_0003188 3300049570 Bacteria 13602
505 Ga0501033_0025906 3300049570 Bacteria 4415
506 Ga0501033_0097302 3300049570 Bacteria 2150
507 Ga0501034_0023072 3300049571 Bacteria 6341
508 Ga0501034_0055032 3300049571 Bacteria 4004
509 Ga0501034_0177668 3300049571 Unclassified 2094
510 Ga0501036_0105530 3300049572 Bacteria 2383
511 Ga0501036_0166559 3300049572 Bacteria 1857
512 Ga0501037_0029356 3300049573 Bacteria 4063
513 Ga0501037_0044389 3300049573 Bacteria 3264
514 Ga0501037_0190863 3300049573 Bacteria 1450
515 Ga0501038_0096068 3300049574 Bacteria 2474
516 Ga0501039_0009397 3300049575 Bacteria 7453
517 Ga0501042_0100792 3300049578 Bacteria 2076
518 Ga0501043_0077841 3300049579 Bacteria 2605
519 Ga0501043_0098347 3300049579 Bacteria 2300
520 Ga0501043_0213280 3300049579 Bacteria 1496
521 Ga0501043_0360795 3300049579 Bacteria 1103
522 Ga0501046_0001042 3300049580 Bacteria 27100
523 Ga0501046_0006895 3300049580 Bacteria 10013
524 Ga0501047_0005571 3300049581 Bacteria 11857
525 Ga0501047_0161597 3300049581 Unclassified 2111
526 Ga0501047_0293629 3300049581 Bacteria 1469
527 Ga0501047_0346253 3300049581 Bacteria 1323
528 Ga0501047_0347333 3300049581 Bacteria 1320
529 Ga0501048_0023116 3300049582 Bacteria 4544
530 Ga0501048_0205290 3300049582 Bacteria 1397
531 Ga0501070_0190607 3300049586 Bacteria 1685
532 Ga0501080_0033215 3300049742 Bacteria 4816
533 Ga0501080_0208635 3300049742 Bacteria 1791
534 Ga0501080_0257051 3300049742 Bacteria 1592
535 Ga0501083_0006985 3300049744 Bacteria 8011
536 Ga0501083_0015025 3300049744 Bacteria 5418
537 Ga0501083_0140250 3300049744 Bacteria 1583
538 Ga0501083_0166970 3300049744 Bacteria 1439
539 Ga0501035_0003593 3300049822 Bacteria 14811
540 Ga0501035_0016393 3300049822 Bacteria 6835
541 Ga0501035_0034874 3300049822 Bacteria 4571
542 Ga0501035_0042309 3300049822 Bacteria 4109
543 Ga0501044_0000288 3300049823 Bacteria 64311
544 Ga0501044_0000307 3300049823 Bacteria 61638
545 Ga0501044_0018728 3300049823 Bacteria 7415
546 Ga0501044_0028223 3300049823 Bacteria 5924
547 Ga0501044_0052481 3300049823 Bacteria 4201
548 Ga0501044_0185875 3300049823 Bacteria 2043
549 Ga0501044_0588989 3300049823 Bacteria 1006
550 Ga0501045_0162968 3300049824 Bacteria 1660
551 nmdc:mga05p37_5091_c1 3300050507 Bacteria 15415
552 nmdc:mga05p37_726644_c1 3300050507 Bacteria 1099
553 nmdc:mga06r32_152712_c1 3300050510 Bacteria 2288
554 nmdc:mga06r32_57077_c1 3300050510 Unclassified 3750
555 nmdc:mga06r32_755380_c1 3300050510 Bacteria 935
556 nmdc:mga0n895_209318_c1 3300050512 Bacteria 1980
557 nmdc:mga0n895_316567_c1 3300050512 Bacteria 1581
558 nmdc:mga0n895_892313_c1 3300050512 Unclassified 875
559 nmdc:mga0rr50_186351_c1 3300050513 Bacteria 1698
560 nmdc:mga0a205_228751_c1 3300050515 Unclassified 1743
561 Ga0495601_0069730 3300053077 Bacteria 2242
562 Ga0500643_031364 3300053087 Bacteria 1622
563 Ga0500566_0194679 3300053094 Bacteria 1029
564 Ga0501082_0047869 3300060353 Bacteria 3685
565 Ga0501082_0241166 3300060353 Bacteria 1573
566 2788434320 2786546940 Bacteria 6396474
567 Ga0207697_10019482
568 MRS1b_contig_6164211
569 MBSR1b_contig_4098306
570 CNXas_1000140
571 Ga0055542_1000409
572 Ga0065703_1018977
573 Ga0065712_10088686
574 Ga0065712_10136769
575 Ga0065712_10142945
576 Ga0065715_10009912
577 Ga0065715_10037900
578 Ga0065715_10105334
579 Ga0065707_10025915
580 Ga0070658_10034470
581 Ga0070658_10256263
582 Ga0070676_10229209
583 Ga0070683_100006820
584 Ga0070683_100093817
585 Ga0070683_100128859
586 Ga0070683_100497463
587 Ga0070690_100046063
588 Ga0070690_100107391
589 Ga0070670_100004392
590 Ga0070670_100052416
591 Ga0070670_100079878
592 Ga0070666_10054279
593 Ga0068868_100239354
594 Ga0068868_100252834
595 Ga0068868_100419649
596 Ga0070660_100175126
597 Ga0070660_100175741
598 Ga0070689_100689656
599 Ga0070687_100414520
600 Ga0070661_100032908
601 Ga0070661_100141742
602 Ga0070692_10098822
603 Ga0070692_10342831
604 Ga0070675_100108999
605 Ga0070675_100233730
606 Ga0070675_100237338
607 Ga0070675_100382818
608 Ga0070675_100471975
609 Ga0070671_100008822
610 Ga0070671_100086563
611 Ga0070674_100447216
612 Ga0070673_100008347
613 Ga0070659_100072701
614 Ga0070659_100101372
615 Ga0070667_100095653
616 Ga0070667_100143955
617 Ga0070714_100653268
618 Ga0070713_100072865
619 Ga0070713_100292092
620 Ga0070713_100438943
621 Ga0070713_100480064
622 Ga0070710_10141567
623 Ga0070701_10121542
624 Ga0070711_100019817
625 Ga0070711_100020107
626 Ga0070705_100033287
627 Ga0070705_100037877
628 Ga0070694_100000430
629 Ga0070694_100041267
630 Ga0070694_100215695
631 Ga0070694_100247693
632 Ga0070708_100010987
633 Ga0070708_100054603
634 Ga0070708_100054841
635 Ga0070708_100072039
636 Ga0070678_100384690
637 Ga0070662_100075076
638 Ga0070681_10092756
639 Ga0070681_10120567
640 Ga0070681_10232770
641 Ga0070681_10336333
642 Ga0068867_100528497
643 Ga0070706_100001499
644 Ga0070706_100015363
645 Ga0070706_100030431
646 Ga0070706_100176480
647 Ga0070706_100177970
648 Ga0070707_100007451
649 Ga0070707_100011887
650 Ga0070707_100088568
651 Ga0070707_100195725
652 Ga0070698_100040380
653 Ga0070698_100104495
654 Ga0070698_100257077
655 Ga0070699_100188706
656 Ga0070684_100045114
657 Ga0070684_100047081
658 Ga0070684_100103057
659 Ga0070684_100418992
660 Ga0070684_100481142
661 Ga0070697_100010159
662 Ga0070697_100066193
663 Ga0070672_100093743
664 Ga0070672_100123126
665 Ga0070696_100038060
666 Ga0070696_100127882
667 Ga0070665_100078301
668 Ga0070665_100242068
669 Ga0070704_100006480
670 Ga0070704_100077368
671 Ga0070704_100097521
672 Ga0070704_100227473
673 Ga0070704_100332241
674 Ga0068855_100025268
675 Ga0070664_100408739
676 Ga0068857_100002331
677 Ga0068857_100120589
678 Ga0068856_100000160
679 Ga0068856_100053851
680 Ga0068856_100169316
681 Ga0068859_100063521
682 Ga0068859_100123505
683 Ga0068859_100203103
684 Ga0068859_100261150
685 Ga0068864_100169080
686 Ga0068864_100484891
687 Ga0068863_100028911
688 Ga0068863_100673777
689 Ga0068858_100003575
690 Ga0068862_100022542
691 Ga0068862_100097396
692 Ga0068862_100203025
693 Ga0081455_10031035
694 Ga0081539_10001306
695 Ga0070717_10029185
696 Ga0070717_10034320
697 Ga0070717_10067240
698 Ga0070717_10106276
699 Ga0070717_10169098
700 Ga0075432_10113688
701 Ga0070715_10136917
702 Ga0070715_10202123
703 Ga0070716_100259822
704 Ga0070716_100507508
705 Ga0070712_100005048
706 Ga0070712_100194631
707 Ga0070712_100226196
708 Ga0075367_10247241
709 Ga0075366_10046479
710 Ga0097621_100288341
711 Ga0068871_100136957
712 Ga0068871_100150309
713 Ga0075431_100010378
714 Ga0097620_100063522
715 Ga0097620_100123507
716 Ga0097620_100203114
717 Ga0097620_100261158
718 Ga0075435_100060840
719 Ga0099795_10020100
720 Ga0105240_10002835
721 Ga0105240_10097559
722 Ga0105240_10272328
723 Ga0105240_11147525
724 Ga0105245_10589638
725 Ga0105247_10011097
726 Ga0105247_10041362
727 Ga0114129_10040264
728 Ga0114129_10075342
729 Ga0114129_10109863
730 Ga0114129_10208266
731 Ga0105243_10062034
732 Ga0105241_10133412
733 Ga0105242_10286681
734 Ga0105248_10192303
735 Ga0105237_10236820
736 Ga0105237_10326495
737 Ga0105238_10014396
738 Ga0105238_10765046
739 Ga0105238_10824650
740 Ga0105249_10020051
741 Ga0105249_10065296
742 Ga0105249_10292626
743 Ga0105249_10467126
744 Ga0105249_10565764
745 Ga0099796_10135534
746 Ga0105239_10237945
747 Ga0105239_10413437
748 Ga0105239_10496224
749 Ga0105246_10424269
750 Ga0157315_1001280
751 Ga0157370_10112332
752 Ga0157369_10157750
753 Ga0157374_10011295
754 Ga0157374_10318825
755 Ga0157378_10161252
756 Ga0157378_10179924
757 Ga0157378_10279843
758 Ga0163162_10007927
759 Ga0163162_10443198
760 Ga0157372_10135649
761 Ga0157372_11268656
762 Ga0157375_10004336
763 Ga0157375_10010789
764 Ga0157375_10011773
765 Ga0157375_10341869
766 Ga0163163_10617087
767 Ga0182008_10111903
768 Ga0157379_10182225
769 Ga0157379_10251293
770 Ga0157379_10296557
771 Ga0157376_10016501
772 Ga0157376_10020933
773 Ga0157376_10030822
774 Ga0157376_10071522
775 Ga0157376_10212533
776 Ga0182007_10039015
777 Ga0182005_1091888
778 Ga0209258_100149
779 Ga0209148_1000143
780 Ga0209455_1001395
781 Ga0207673_1011716
782 Ga0207697_10004774
783 Ga0207697_10010657
784 Ga0207697_10011490
785 Ga0207697_10014480
786 Ga0207697_10036704
787 Ga0207697_10042447
788 Ga0207653_10049889
789 Ga0207653_10084363
790 Ga0207692_10012305
791 Ga0207642_10187666
792 Ga0207647_10003697
793 Ga0207685_10103537
794 Ga0207685_10112492
795 Ga0207699_10069706
796 Ga0207645_10005978
797 Ga0207645_10038210
798 Ga0207645_10047317
799 Ga0207705_10285456
800 Ga0207684_10000662
801 Ga0207684_10015334
802 Ga0207684_10130980
803 Ga0207684_10216321
804 Ga0207684_10267391
805 Ga0207707_10216083
806 Ga0207695_10010863
807 Ga0207695_10079895
808 Ga0207695_10407530
809 Ga0207671_10261374
810 Ga0207693_10005286
811 Ga0207693_10005814
812 Ga0207693_10044942
813 Ga0207693_10095987
814 Ga0207693_10126730
815 Ga0207693_10564913
816 Ga0207663_10007812
817 Ga0207660_10176310
818 Ga0207657_10217641
819 Ga0207657_10367889
820 Ga0207649_10013217
821 Ga0207649_10392009
822 Ga0207646_10005978
823 Ga0207646_10019129
824 Ga0207646_10086888
825 Ga0207681_10156171
826 Ga0207694_10014801
827 Ga0207650_10025406
828 Ga0207659_10033153
829 Ga0207659_10081973
830 Ga0207659_10214000
831 Ga0207659_10225625
832 Ga0207659_10289319
833 Ga0207700_10077939
834 Ga0207664_10032290
835 Ga0207644_10012286
836 Ga0207644_10054455
837 Ga0207644_10072025
838 Ga0207690_10052626
839 Ga0207690_10179579
840 Ga0207706_10088780
841 Ga0207706_10132798
842 Ga0207670_10041089
843 Ga0207670_10098399
844 Ga0207704_10174775
845 Ga0207665_10006438
846 Ga0207665_10073368
847 Ga0207665_10080401
848 Ga0207691_10021981
849 Ga0207711_10099172
850 Ga0207661_10132853
851 Ga0207679_10175562
852 Ga0207679_10477676
853 Ga0207667_10070941
854 Ga0207667_10287714
855 Ga0207667_10886068
856 Ga0207651_10428429
857 Ga0207712_10033662
858 Ga0207712_10037856
859 Ga0207712_10103005
860 Ga0207712_10243045
861 Ga0207668_10036133
862 Ga0207668_10418948
863 Ga0207668_10451512
864 Ga0207658_10413795
865 Ga0207677_10380932
866 Ga0207639_10143784
867 Ga0207702_10078454
868 Ga0207702_10283015
869 Ga0207641_10158334
870 Ga0207641_10450247
871 Ga0207676_10216229
872 Ga0207674_10042661
873 Ga0207675_100027610
874 Ga0207675_100063764
875 Ga0207683_10022716
876 Ga0207683_10024351
877 Ga0207683_10231510
878 Ga0268266_10098991
879 Ga0268265_10060327
880 Ga0268264_10261354
881 Ga0268264_10402958
882 Ga0265337_1000445
883 Ga0265337_1001456
884 Ga0265326_10000964
885 Ga0265319_1001567
886 Ga0265319_1002617
887 Ga0265319_1004592
888 Ga0265319_1004724
889 Ga0265319_1025690
890 Ga0265334_10008038
891 Ga0265318_10000016
892 Ga0265318_10001565
893 Ga0265318_10010742
894 Ga0265318_10026496
895 Ga0265318_10069318
896 Ga0265323_10004291
897 Ga0265323_10012072
898 Ga0265323_10024626
899 Ga0265323_10047224
900 Ga0265322_10010563
901 Ga0265338_10000177
902 Ga0265338_10000495
903 Ga0265338_10005525
904 Ga0265338_10034149
905 Ga0265338_10063030
906 Ga0265338_10148598
907 Ga0265324_10000785
908 Ga0265324_10004177
909 Ga0265324_10093299
910 Ga0265330_10025467
911 Ga0265332_10059051
912 Ga0265328_10030535
913 Ga0265320_10000375
914 Ga0265320_10001487
915 Ga0265320_10001561
916 Ga0265320_10012765
917 Ga0265320_10024304
918 Ga0265320_10043535
919 Ga0265320_10148125
920 Ga0265325_10005235
921 Ga0265340_10000564
922 Ga0265340_10000880
923 Ga0265340_10139767
924 Ga0265339_10043236
925 Ga0265331_10019621
926 Ga0265327_10000188
927 Ga0265327_10030270
928 Ga0265316_10009610
929 Ga0265316_10035792
930 Ga0265316_10039420
931 Ga0265316_10087195
932 Ga0307513_10018229
933 Ga0265313_10000905
934 Ga0265313_10002676
935 Ga0265313_10005753
936 Ga0265313_10006331
937 Ga0307508_10000116
938 Ga0265314_10000596
939 Ga0265314_10146868
940 Ga0265314_10165994
941 Ga0265342_10035384
942 Ga0265342_10071228
943 Ga0265342_10071554
944 Ga0373953_0078990
945 Ga0373954_0080833
946 Ga0373954_0090092
947 Ga0373956_0006594
948 Ga0373957_0128036
949 Ga0373943_0023371
950 Ga0373943_0137107
951 Ga0373946_0065626
952 Ga0373955_0163029
953 Ga0373942_0068555
954 Ga0373924_0152082
955 Ga0373935_0095348
956 Ga0373933_0011081
957 Ga0373933_0223717
958 Ga0373947_0274705
959 Ga0373947_0342362
960 Ga0373937_0007073
961 Ga0373937_0079193
962 Ga0395898_0129393
963 Ga0395901_0094526
964 Ga0451841_1412240
965 Ga0439458_0005186
966 Ga0451577_0000017
967 Ga0439440_0032991
968 Ga0466969_0061279
969 Ga0453683_0045440
970 Ga0453684_0021335
971 Ga0466957_0465729
972 Ga0451576_0000443
973 Ga0451576_0001225
974 Ga0451576_0048695
975 Ga0451576_0086679
976 Ga0451576_0196530
977 Ga0451576_0434384
978 Ga0451576_0570672
979 Ga0451576_0707045
980 Ga0466967_0108245
981 Ga0466967_0223510
982 Ga0495592_0136323
983 Ga0495629_0016309
984 Ga0495629_0299706
985 Ga0495641_0150367
986 Ga0495651_0379549
987 Ga0495653_0172813
988 Ga0495580_0121511
989 Ga0495662_0021760
990 Ga0495664_0015106
991 Ga0495664_0051624
992 Ga0495594_0177943
993 Ga0495618_0000362
994 Ga0495618_0002205
995 Ga0495618_0156074
996 Ga0495628_0000028
997 Ga0495628_0128537
998 Ga0495630_0009365
999 Ga0495630_0069867
1000 Ga0495630_0089853
1001 Ga0495630_0140605
1002 Ga0495630_0571053
1003 Ga0495652_0016125
1004 Ga0495652_0038804
1005 Ga0495640_0020559
1006 Ga0495640_0240243
1007 Ga0495586_0000312
1008 Ga0495586_0000351
1009 Ga0495586_0035087
1010 Ga0495587_0100605
1011 Ga0495587_0129803
1012 Ga0495587_0236592
1013 Ga0495645_0027361
1014 Ga0495645_0056784
1015 Ga0495645_0059607
1016 Ga0495645_0218001
1017 Ga0495667_0118792
1018 Ga0495667_0206628
1019 Ga0495634_0000607
1020 Ga0495634_0114547
1021 Ga0495634_0216991
1022 Ga0495635_0095948
1023 Ga0495635_0116367
1024 Ga0495599_0016698
1025 Ga0495599_0020872
1026 Ga0495599_0102603
1027 Ga0495646_0087848
1028 Ga0495647_0169591
1029 Ga0495669_0037228
1030 Ga0495613_0000430
1031 Ga0495613_0326607
1032 Ga0495624_0162778
1033 Ga0495624_0326210
1034 Ga0495581_0005163
1035 Ga0495674_0081901
1036 Ga0495674_0180388
1037 Ga0495680_0410554
1038 Ga0495680_0469261
1039 Ga0495675_0121607
1040 Ga0495675_0216888
1041 Ga0495684_0196202
1042 Ga0495684_0240018
1043 Ga0496101_0179434
1044 Ga0496102_0313435
1045 Ga0496104_0025968
1046 Ga0496104_0061353
1047 Ga0496104_0239121
1048 Ga0496105_0071751
1049 Ga0496105_0083977
1050 Ga0496107_0260202
1051 Ga0496108_0099268
1052 Ga0496108_0343648
1053 Ga0496109_0021551
1054 Ga0496110_0512094
1055 Ga0496111_0121187
1056 Ga0496112_0134715
1057 Ga0496112_0181588
1058 Ga0496113_0053639
1059 Ga0496113_0140426
1060 Ga0496114_0045179
1061 Ga0496114_0239516
1062 Ga0496115_0011569
1063 Ga0496115_0039220
1064 Ga0496115_0433562
1065 Ga0501031_0025927
1066 Ga0501031_0094640
1067 Ga0501032_0000106
1068 Ga0501032_0029139
1069 Ga0501032_0059928
1070 Ga0501033_0003188
1071 Ga0501033_0025906
1072 Ga0501033_0097302
1073 Ga0501034_0023072
1074 Ga0501034_0055032
1075 Ga0501034_0177668
1076 Ga0501036_0105530
1077 Ga0501036_0166559
1078 Ga0501037_0029356
1079 Ga0501037_0044389
1080 Ga0501037_0190863
1081 Ga0501038_0096068
1082 Ga0501039_0009397
1083 Ga0501042_0100792
1084 Ga0501043_0077841
1085 Ga0501043_0098347
1086 Ga0501043_0213280
1087 Ga0501043_0360795
1088 Ga0501046_0001042
1089 Ga0501046_0006895
1090 Ga0501047_0005571
1091 Ga0501047_0161597
1092 Ga0501047_0293629
1093 Ga0501047_0346253
1094 Ga0501047_0347333
1095 Ga0501048_0023116
1096 Ga0501048_0205290
1097 Ga0501070_0190607
1098 Ga0501080_0033215
1099 Ga0501080_0208635
1100 Ga0501080_0257051
1101 Ga0501083_0006985
1102 Ga0501083_0015025
1103 Ga0501083_0140250
1104 Ga0501083_0166970
1105 Ga0501035_0003593
1106 Ga0501035_0016393
1107 Ga0501035_0034874
1108 Ga0501035_0042309
1109 Ga0501044_0000288
1110 Ga0501044_0000307
1111 Ga0501044_0018728
1112 Ga0501044_0028223
1113 Ga0501044_0052481
1114 Ga0501044_0185875
1115 Ga0501044_0588989
1116 Ga0501045_0162968
1117 nmdc:mga05p37_5091_c1
1118 nmdc:mga05p37_726644_c1
1119 nmdc:mga06r32_152712_c1
1120 nmdc:mga06r32_57077_c1
1121 nmdc:mga06r32_755380_c1
1122 nmdc:mga0n895_209318_c1
1123 nmdc:mga0n895_316567_c1
1124 nmdc:mga0n895_892313_c1
1125 nmdc:mga0rr50_186351_c1
1126 nmdc:mga0a205_228751_c1
1127 Ga0495601_0069730
1128 Ga0500643_031364
1129 Ga0500566_0194679
1130 Ga0501082_0047869
1131 Ga0501082_0241166
1132 2788434320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j75-assembly1.cif.gz_B crystal structure of a parasite trna synthetase, product-bound 0.8372 4 46
4hjx-assembly1.cif.gz_B crystal structure of f2yrs complexed with f2y 0.8357 4 45
3foc-assembly1.cif.gz_A-2 tryptophanyl-trna synthetase from giardia lamblia 0.8339 3 46
3hv0-assembly1.cif.gz_B tryptophanyl-trna synthetase from cryptosporidium parvum 0.8328 5 46
4j75-assembly1.cif.gz_A crystal structure of a parasite trna synthetase, product-bound 0.8325 4 46
ID Description Score Start End Superfamily
1zh0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8324 4 45 3.40.50.620
af_Q2G2Q2_2_185_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8212 1 45 3.40.50.620
af_Q7XJ15_66_191_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7842 5 52 3.40.50.620
3tzeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7783 3 45 3.40.50.620
af_P9WFD5_146_272_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7659 1 43 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2A2PW84-F1-model_v4 Uncharacterized protein 0.995 1 253
AF-A0A3M1QQ96-F1-model_v4 Uncharacterized protein 0.9936 37 252
AF-A0A2A2PW84-F1-model_v4 Uncharacterized protein 0.9872 1 253
AF-A0A3D4H9D6-F1-model_v4 Uncharacterized protein 0.9816 1 193
AF-A0A7W1CUR6-F1-model_v4 Uncharacterized protein 0.9796 1 185

Map