F464381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 566 | 279 | 1132 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10452438|Ga0105243_104524382 |
| Length | 278 |
| Sequence | MQVLPAGLQAQHDRPAAAPDDHAHHPDGDVAMTARNTLDARARRGSETAGRDTAELREIVSHVGAELELAPAEDIIEWAVATFGERFCVTSSMSDAVLSHLASRVAPGVDVLFLDTGYHFAETIGTRDAVEATLPVNLVNVTPEQSVAEQDATHGKDLYKTDPDLCCALRKVAPLKNTLEQYDAWATGLRRAETHDRIIAPVIGWDARKGKVKVSPLARWSDEQVERYIEDNNVLVNPLVYDGYPSIGCWPCTRRVAPGDDPRSGRWAGTSKTECGIH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 120 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 121 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 139 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 140 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 151 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 152 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 153 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 154 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 155 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 156 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 157 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 158 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 159 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 164 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 165 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 255 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 256 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 257 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 261 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 262 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 263 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 264 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 265 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 266 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 267 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 268 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 269 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 270 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 271 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 272 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 273 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 274 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 275 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 276 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 277 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 278 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 279 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.88 |
| Metatranscriptomes | 1.94 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.83 |
| Nodule | 0.18 |
| Rhizoplane | 12.37 |
| Rhizosphere | 78.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105243_10452438 | 3300009148 | Bacteria | 1205 |
| 2 | JGI24740J21852_10007177 | 3300001979 | Bacteria | 4547 |
| 3 | JGI24737J22298_10048814 | 3300001990 | Bacteria | 1288 |
| 4 | JGI24743J22301_10010295 | 3300001991 | Bacteria | 1668 |
| 5 | JGI24738J21930_10017265 | 3300002075 | Bacteria | 1518 |
| 6 | JGI24749J21850_1015997 | 3300002076 | Bacteria | 1053 |
| 7 | JGI24744J21845_10023770 | 3300002077 | Bacteria | 1200 |
| 8 | JGI24742J22300_10024543 | 3300002244 | Bacteria | 1040 |
| 9 | JGI25406J46586_10010340 | 3300003203 | Bacteria | 4142 |
| 10 | Ga0007410J51695_1050572 | 3300003574 | Bacteria | 1372 |
| 11 | Ga0007429J51699_1031552 | 3300003579 | Bacteria | 1782 |
| 12 | Ga0032354_1014081 | 3300003693 | Bacteria | 2985 |
| 13 | JGI25405J52794_10033831 | 3300003911 | Bacteria | 1067 |
| 14 | Ga0070658_10223548 | 3300005327 | Bacteria | 1593 |
| 15 | Ga0070658_10559495 | 3300005327 | Bacteria | 990 |
| 16 | Ga0070683_100002939 | 3300005329 | Bacteria | 13656 |
| 17 | Ga0070683_100029967 | 3300005329 | Bacteria | 4934 |
| 18 | Ga0070683_100209014 | 3300005329 | Bacteria | 1854 |
| 19 | Ga0070683_100252624 | 3300005329 | Bacteria | 1677 |
| 20 | Ga0070683_100257571 | 3300005329 | Bacteria | 1660 |
| 21 | Ga0068868_100095769 | 3300005338 | Bacteria | 2396 |
| 22 | Ga0068868_100316056 | 3300005338 | Bacteria | 1329 |
| 23 | Ga0068868_100464909 | 3300005338 | Bacteria | 1102 |
| 24 | Ga0070660_100011196 | 3300005339 | Bacteria | 6365 |
| 25 | Ga0070660_100015411 | 3300005339 | Bacteria | 5519 |
| 26 | Ga0070689_100125879 | 3300005340 | Bacteria | 2050 |
| 27 | Ga0070691_10051221 | 3300005341 | Bacteria | 1971 |
| 28 | Ga0070687_100392046 | 3300005343 | Bacteria | 908 |
| 29 | Ga0070692_10000366 | 3300005345 | Bacteria | 13286 |
| 30 | Ga0070668_100025619 | 3300005347 | Bacteria | 4473 |
| 31 | Ga0070668_100030666 | 3300005347 | Bacteria | 4089 |
| 32 | Ga0070673_100482867 | 3300005364 | Bacteria | 1119 |
| 33 | Ga0070688_100313828 | 3300005365 | Bacteria | 1137 |
| 34 | Ga0070688_100349014 | 3300005365 | Bacteria | 1083 |
| 35 | Ga0070659_100016127 | 3300005366 | Bacteria | 5606 |
| 36 | Ga0070659_100165981 | 3300005366 | Bacteria | 1807 |
| 37 | Ga0070659_100190391 | 3300005366 | Bacteria | 1686 |
| 38 | Ga0070714_100069079 | 3300005435 | Bacteria | 3050 |
| 39 | Ga0070701_10004012 | 3300005438 | Bacteria | 5897 |
| 40 | Ga0070700_100001674 | 3300005441 | Bacteria | 11107 |
| 41 | Ga0070700_100136924 | 3300005441 | Bacteria | 1659 |
| 42 | Ga0070662_100126808 | 3300005457 | Bacteria | 1963 |
| 43 | Ga0070685_10118537 | 3300005466 | Bacteria | 1641 |
| 44 | Ga0070679_100029110 | 3300005530 | Bacteria | 5448 |
| 45 | Ga0070679_100253193 | 3300005530 | Bacteria | 1717 |
| 46 | Ga0070684_100012878 | 3300005535 | Bacteria | 6722 |
| 47 | Ga0070684_100072397 | 3300005535 | Bacteria | 3034 |
| 48 | Ga0070684_100159545 | 3300005535 | Bacteria | 2045 |
| 49 | Ga0070684_100232881 | 3300005535 | Bacteria | 1682 |
| 50 | Ga0068853_100032374 | 3300005539 | Bacteria | 4429 |
| 51 | Ga0068853_100388134 | 3300005539 | Bacteria | 1305 |
| 52 | Ga0070672_100015704 | 3300005543 | Bacteria | 5405 |
| 53 | Ga0070686_100199900 | 3300005544 | Bacteria | 1432 |
| 54 | Ga0070665_100004769 | 3300005548 | Bacteria | 14118 |
| 55 | Ga0068855_100139509 | 3300005563 | Bacteria | 2765 |
| 56 | Ga0068855_100650502 | 3300005563 | Bacteria | 1132 |
| 57 | Ga0070664_100029424 | 3300005564 | Bacteria | 4579 |
| 58 | Ga0068857_100080266 | 3300005577 | Bacteria | 2913 |
| 59 | Ga0068856_100406588 | 3300005614 | Bacteria | 1381 |
| 60 | Ga0070702_100044438 | 3300005615 | Bacteria | 2508 |
| 61 | Ga0070702_100465739 | 3300005615 | Bacteria | 920 |
| 62 | Ga0068852_100038082 | 3300005616 | Bacteria | 4038 |
| 63 | Ga0068852_100139354 | 3300005616 | Bacteria | 2243 |
| 64 | Ga0068864_100099470 | 3300005618 | Bacteria | 2576 |
| 65 | Ga0068864_100278881 | 3300005618 | Bacteria | 1559 |
| 66 | Ga0068864_100451991 | 3300005618 | Bacteria | 1229 |
| 67 | Ga0068861_100090257 | 3300005719 | Bacteria | 2417 |
| 68 | Ga0068861_100111515 | 3300005719 | Bacteria | 2192 |
| 69 | Ga0068861_100139113 | 3300005719 | Bacteria | 1980 |
| 70 | Ga0068870_10073141 | 3300005840 | Bacteria | 1875 |
| 71 | Ga0068858_100108933 | 3300005842 | Bacteria | 2586 |
| 72 | Ga0068858_100255908 | 3300005842 | Bacteria | 1664 |
| 73 | Ga0068862_100191815 | 3300005844 | Bacteria | 1839 |
| 74 | Ga0081455_10000201 | 3300005937 | Bacteria | 76008 |
| 75 | Ga0081455_10016265 | 3300005937 | Bacteria | 7188 |
| 76 | Ga0081538_10000202 | 3300005981 | Bacteria | 66057 |
| 77 | Ga0081538_10016835 | 3300005981 | Bacteria | 5580 |
| 78 | Ga0081540_1058173 | 3300005983 | Bacteria | 1864 |
| 79 | Ga0081539_10000657 | 3300005985 | Bacteria | 69568 |
| 80 | Ga0081539_10001605 | 3300005985 | Bacteria | 37235 |
| 81 | Ga0081539_10007450 | 3300005985 | Bacteria | 9974 |
| 82 | Ga0081539_10137822 | 3300005985 | Bacteria | 1189 |
| 83 | Ga0075365_10061359 | 3300006038 | Bacteria | 2510 |
| 84 | Ga0075365_10073422 | 3300006038 | Bacteria | 2306 |
| 85 | Ga0075364_10131118 | 3300006051 | Bacteria | 1682 |
| 86 | Ga0075362_10112195 | 3300006177 | Bacteria | 1284 |
| 87 | Ga0068871_100599416 | 3300006358 | Bacteria | 1002 |
| 88 | Ga0075428_100253241 | 3300006844 | Bacteria | 1897 |
| 89 | Ga0075430_100052764 | 3300006846 | Bacteria | 3424 |
| 90 | Ga0075430_100157888 | 3300006846 | Bacteria | 1888 |
| 91 | Ga0075431_100000633 | 3300006847 | Bacteria | 29722 |
| 92 | Ga0075429_100002893 | 3300006880 | Bacteria | 14553 |
| 93 | Ga0075429_100357499 | 3300006880 | Bacteria | 1279 |
| 94 | Ga0068865_100007627 | 3300006881 | Bacteria | 6663 |
| 95 | Ga0068865_100184496 | 3300006881 | Bacteria | 1609 |
| 96 | Ga0111539_10006814 | 3300009094 | Bacteria | 14693 |
| 97 | Ga0111539_10537504 | 3300009094 | Bacteria | 1362 |
| 98 | Ga0105245_10005963 | 3300009098 | Bacteria | 10705 |
| 99 | Ga0105245_10016221 | 3300009098 | Bacteria | 6493 |
| 100 | Ga0105245_10156114 | 3300009098 | Bacteria | 2161 |
| 101 | Ga0105245_10549114 | 3300009098 | Bacteria | 1177 |
| 102 | Ga0105243_10095608 | 3300009148 | Bacteria | 2456 |
| 103 | Ga0105243_10339822 | 3300009148 | Bacteria | 1375 |
| 104 | Ga0105243_10342216 | 3300009148 | Bacteria | 1370 |
| 105 | Ga0105242_10227329 | 3300009176 | Bacteria | 1670 |
| 106 | Ga0105242_10609561 | 3300009176 | Bacteria | 1056 |
| 107 | Ga0105242_10611728 | 3300009176 | Bacteria | 1054 |
| 108 | Ga0105248_10099777 | 3300009177 | Bacteria | 3272 |
| 109 | Ga0105238_10228786 | 3300009551 | Bacteria | 1836 |
| 110 | Ga0105249_10111868 | 3300009553 | Bacteria | 2582 |
| 111 | Ga0105249_10271327 | 3300009553 | Bacteria | 1690 |
| 112 | Ga0105249_10934341 | 3300009553 | Bacteria | 935 |
| 113 | Ga0105239_10010142 | 3300010375 | Bacteria | 10556 |
| 114 | Ga0105239_10010437 | 3300010375 | Bacteria | 10384 |
| 115 | Ga0105246_10017507 | 3300011119 | Bacteria | 4555 |
| 116 | Ga0157369_10288292 | 3300013105 | Bacteria | 1709 |
| 117 | Ga0157369_10958315 | 3300013105 | Bacteria | 877 |
| 118 | Ga0157378_10463112 | 3300013297 | Bacteria | 1260 |
| 119 | Ga0163162_10035229 | 3300013306 | Bacteria | 4983 |
| 120 | Ga0157372_10013423 | 3300013307 | Bacteria | 8750 |
| 121 | Ga0157372_10080017 | 3300013307 | Bacteria | 3696 |
| 122 | Ga0157372_10180534 | 3300013307 | Bacteria | 2443 |
| 123 | Ga0157372_11024017 | 3300013307 | Bacteria | 956 |
| 124 | Ga0157375_10014182 | 3300013308 | Bacteria | 7104 |
| 125 | Ga0157375_10638113 | 3300013308 | Bacteria | 1222 |
| 126 | Ga0163163_10039203 | 3300014325 | Bacteria | 4622 |
| 127 | Ga0163163_10052315 | 3300014325 | Bacteria | 4029 |
| 128 | Ga0163163_11228285 | 3300014325 | Bacteria | 812 |
| 129 | Ga0157380_10017242 | 3300014326 | Bacteria | 5342 |
| 130 | Ga0157380_10069207 | 3300014326 | Bacteria | 2847 |
| 131 | Ga0182008_10100191 | 3300014497 | Bacteria | 1431 |
| 132 | Ga0157379_10015241 | 3300014968 | Bacteria | 6742 |
| 133 | Ga0157379_10196993 | 3300014968 | Bacteria | 1821 |
| 134 | Ga0157376_10107287 | 3300014969 | Bacteria | 2451 |
| 135 | Ga0206354_11370483 | 3300020081 | Bacteria | 1798 |
| 136 | Ga0206353_11839692 | 3300020082 | Bacteria | 977 |
| 137 | Ga0207688_10018348 | 3300025901 | Bacteria | 3808 |
| 138 | Ga0207688_10316849 | 3300025901 | Bacteria | 956 |
| 139 | Ga0207680_10364547 | 3300025903 | Bacteria | 1016 |
| 140 | Ga0207647_10015351 | 3300025904 | Bacteria | 5252 |
| 141 | Ga0207643_10110122 | 3300025908 | Bacteria | 1622 |
| 142 | Ga0207643_10162349 | 3300025908 | Bacteria | 1345 |
| 143 | Ga0207705_10027564 | 3300025909 | Bacteria | 4052 |
| 144 | Ga0207705_10054693 | 3300025909 | Bacteria | 2877 |
| 145 | Ga0207705_10234842 | 3300025909 | Bacteria | 1395 |
| 146 | Ga0207657_10009770 | 3300025919 | Bacteria | 9617 |
| 147 | Ga0207657_10057136 | 3300025919 | Bacteria | 3364 |
| 148 | Ga0207657_10066565 | 3300025919 | Bacteria | 3066 |
| 149 | Ga0207657_10286644 | 3300025919 | Bacteria | 1306 |
| 150 | Ga0207649_10208671 | 3300025920 | Bacteria | 1384 |
| 151 | Ga0207652_10017458 | 3300025921 | Bacteria | 5874 |
| 152 | Ga0207652_10179821 | 3300025921 | Bacteria | 1900 |
| 153 | Ga0207694_10223799 | 3300025924 | Bacteria | 1535 |
| 154 | Ga0207687_10026584 | 3300025927 | Bacteria | 3876 |
| 155 | Ga0207687_10047858 | 3300025927 | Bacteria | 2966 |
| 156 | Ga0207687_10503331 | 3300025927 | Bacteria | 1011 |
| 157 | Ga0207664_10059251 | 3300025929 | Bacteria | 3048 |
| 158 | Ga0207664_10404744 | 3300025929 | Bacteria | 1214 |
| 159 | Ga0207690_10037105 | 3300025932 | Bacteria | 3162 |
| 160 | Ga0207690_10046215 | 3300025932 | Bacteria | 2882 |
| 161 | Ga0207690_10137311 | 3300025932 | Bacteria | 1797 |
| 162 | Ga0207706_10035180 | 3300025933 | Bacteria | 4455 |
| 163 | Ga0207706_10569108 | 3300025933 | Bacteria | 975 |
| 164 | Ga0207709_10194818 | 3300025935 | Bacteria | 1443 |
| 165 | Ga0207709_10249441 | 3300025935 | Bacteria | 1296 |
| 166 | Ga0207704_10049015 | 3300025938 | Bacteria | 2537 |
| 167 | Ga0207704_10127695 | 3300025938 | Bacteria | 1754 |
| 168 | Ga0207691_10005898 | 3300025940 | Bacteria | 11834 |
| 169 | Ga0207711_10087923 | 3300025941 | Bacteria | 2727 |
| 170 | Ga0207689_10589937 | 3300025942 | Bacteria | 934 |
| 171 | Ga0207661_10043878 | 3300025944 | Bacteria | 3530 |
| 172 | Ga0207661_10094918 | 3300025944 | Bacteria | 2492 |
| 173 | Ga0207661_10114393 | 3300025944 | Bacteria | 2288 |
| 174 | Ga0207661_10246726 | 3300025944 | Bacteria | 1586 |
| 175 | Ga0207661_10412452 | 3300025944 | Bacteria | 1226 |
| 176 | Ga0207679_10059548 | 3300025945 | Bacteria | 2834 |
| 177 | Ga0207667_10138989 | 3300025949 | Bacteria | 2501 |
| 178 | Ga0207668_10019851 | 3300025972 | Bacteria | 4258 |
| 179 | Ga0207668_10634680 | 3300025972 | Bacteria | 933 |
| 180 | Ga0207658_10038059 | 3300025986 | Bacteria | 3463 |
| 181 | Ga0207658_10108266 | 3300025986 | Bacteria | 2192 |
| 182 | Ga0207703_10179832 | 3300026035 | Bacteria | 1866 |
| 183 | Ga0207639_10299293 | 3300026041 | Bacteria | 1421 |
| 184 | Ga0207639_10371046 | 3300026041 | Bacteria | 1283 |
| 185 | Ga0207639_10392199 | 3300026041 | Bacteria | 1249 |
| 186 | Ga0207678_10036546 | 3300026067 | Bacteria | 4275 |
| 187 | Ga0207708_10000665 | 3300026075 | Bacteria | 26355 |
| 188 | Ga0207708_10039108 | 3300026075 | Bacteria | 3613 |
| 189 | Ga0207702_10640511 | 3300026078 | Bacteria | 1045 |
| 190 | Ga0207641_10108902 | 3300026088 | Bacteria | 2453 |
| 191 | Ga0207676_10214687 | 3300026095 | Bacteria | 1709 |
| 192 | Ga0207676_10218062 | 3300026095 | Bacteria | 1697 |
| 193 | Ga0207676_10379252 | 3300026095 | Bacteria | 1316 |
| 194 | Ga0207674_10094896 | 3300026116 | Bacteria | 2969 |
| 195 | Ga0207674_10227181 | 3300026116 | Bacteria | 1814 |
| 196 | Ga0207674_10703845 | 3300026116 | Bacteria | 975 |
| 197 | Ga0207675_100001223 | 3300026118 | Bacteria | 25636 |
| 198 | Ga0207675_100042973 | 3300026118 | Bacteria | 4220 |
| 199 | Ga0207675_100119286 | 3300026118 | Bacteria | 2495 |
| 200 | Ga0207683_10420025 | 3300026121 | Bacteria | 1232 |
| 201 | Ga0207683_10425228 | 3300026121 | Bacteria | 1224 |
| 202 | Ga0207698_10134091 | 3300026142 | Bacteria | 2121 |
| 203 | Ga0207428_10010519 | 3300027907 | Bacteria | 8258 |
| 204 | Ga0268266_10003110 | 3300028379 | Bacteria | 16907 |
| 205 | Ga0268265_10059885 | 3300028380 | Bacteria | 2916 |
| 206 | Ga0268265_10117951 | 3300028380 | Bacteria | 2181 |
| 207 | Ga0307515_10000065 | 3300028794 | Bacteria | 244497 |
| 208 | Ga0307515_10014064 | 3300028794 | Bacteria | 14888 |
| 209 | Ga0307512_10004466 | 3300030522 | Bacteria | 15314 |
| 210 | Ga0316178_1068862 | 3300030735 | Bacteria | 800 |
| 211 | Ga0316181_1000190 | 3300030744 | Bacteria | 1922 |
| 212 | Ga0307513_10011749 | 3300031456 | Bacteria | 10859 |
| 213 | Ga0307513_10344459 | 3300031456 | Bacteria | 1240 |
| 214 | Ga0307509_10031252 | 3300031507 | Bacteria | 5881 |
| 215 | Ga0307509_10090165 | 3300031507 | Bacteria | 3142 |
| 216 | Ga0307509_10191436 | 3300031507 | Bacteria | 1896 |
| 217 | Ga0307408_100145853 | 3300031548 | Bacteria | 1863 |
| 218 | Ga0307508_10000654 | 3300031616 | Bacteria | 41574 |
| 219 | Ga0307508_10002351 | 3300031616 | Bacteria | 20026 |
| 220 | Ga0307508_10116219 | 3300031616 | Bacteria | 2277 |
| 221 | Ga0307508_10263109 | 3300031616 | Bacteria | 1319 |
| 222 | Ga0307516_10004273 | 3300031730 | Bacteria | 17755 |
| 223 | Ga0307516_10025318 | 3300031730 | Bacteria | 6044 |
| 224 | Ga0307405_10013871 | 3300031731 | Bacteria | 4312 |
| 225 | Ga0307405_10035933 | 3300031731 | Bacteria | 2964 |
| 226 | Ga0307413_10127789 | 3300031824 | Bacteria | 1734 |
| 227 | Ga0307410_10109444 | 3300031852 | Bacteria | 1997 |
| 228 | Ga0307410_10163073 | 3300031852 | Bacteria | 1672 |
| 229 | Ga0307410_10209493 | 3300031852 | Bacteria | 1493 |
| 230 | Ga0307410_10456299 | 3300031852 | Bacteria | 1043 |
| 231 | Ga0307406_10210086 | 3300031901 | Bacteria | 1439 |
| 232 | Ga0307406_10367862 | 3300031901 | Bacteria | 1129 |
| 233 | Ga0307406_10522283 | 3300031901 | Bacteria | 966 |
| 234 | Ga0307407_10275992 | 3300031903 | Bacteria | 1162 |
| 235 | Ga0307412_10248579 | 3300031911 | Bacteria | 1380 |
| 236 | Ga0307409_100030350 | 3300031995 | Bacteria | 3882 |
| 237 | Ga0307409_100128053 | 3300031995 | Bacteria | 2164 |
| 238 | Ga0307409_100272737 | 3300031995 | Bacteria | 1559 |
| 239 | Ga0307416_100010387 | 3300032002 | Bacteria | 6146 |
| 240 | Ga0307416_100078566 | 3300032002 | Bacteria | 2777 |
| 241 | Ga0307416_100360720 | 3300032002 | Bacteria | 1475 |
| 242 | Ga0307414_10035449 | 3300032004 | Bacteria | 3321 |
| 243 | Ga0307414_10189385 | 3300032004 | Bacteria | 1663 |
| 244 | Ga0307414_10728125 | 3300032004 | Bacteria | 900 |
| 245 | Ga0307411_10191191 | 3300032005 | Bacteria | 1563 |
| 246 | Ga0307411_10570579 | 3300032005 | Bacteria | 968 |
| 247 | Ga0307415_100019274 | 3300032126 | Bacteria | 4139 |
| 248 | Ga0307415_100061384 | 3300032126 | Bacteria | 2602 |
| 249 | Ga0307415_100129326 | 3300032126 | Bacteria | 1908 |
| 250 | Ga0307415_100668497 | 3300032126 | Bacteria | 933 |
| 251 | Ga0307415_100801169 | 3300032126 | Bacteria | 860 |
| 252 | Ga0307507_10017573 | 3300033179 | Bacteria | 8206 |
| 253 | Ga0307510_10094232 | 3300033180 | Bacteria | 2821 |
| 254 | Ga0373951_0000058 | 3300035091 | Bacteria | 45018 |
| 255 | Ga0373935_0028068 | 3300035692 | Bacteria | 3478 |
| 256 | Ga0395899_0030500 | 3300037312 | Bacteria | 4055 |
| 257 | Ga0395900_0024436 | 3300037418 | Bacteria | 6188 |
| 258 | Ga0395900_0134564 | 3300037418 | Bacteria | 2532 |
| 259 | Ga0395900_0733275 | 3300037418 | Bacteria | 920 |
| 260 | Ga0395898_0037524 | 3300037466 | Bacteria | 4805 |
| 261 | Ga0395898_0376428 | 3300037466 | Bacteria | 1354 |
| 262 | Ga0395905_0693509 | 3300037471 | Bacteria | 921 |
| 263 | Ga0436364_1072955 | 3300037853 | Bacteria | 1301 |
| 264 | Ga0395901_0006468 | 3300038443 | Bacteria | 11866 |
| 265 | Ga0395901_0037579 | 3300038443 | Bacteria | 5008 |
| 266 | Ga0395901_0060266 | 3300038443 | Bacteria | 3949 |
| 267 | Ga0436365_1732162 | 3300039437 | Bacteria | 984 |
| 268 | Ga0451802_1964298 | 3300041460 | Bacteria | 856 |
| 269 | Ga0451837_1015006 | 3300041494 | Bacteria | 2100 |
| 270 | Ga0451853_1031450 | 3300041512 | Bacteria | 1727 |
| 271 | Ga0439431_0000696 | 3300041997 | Bacteria | 7250 |
| 272 | Ga0439442_005462 | 3300042002 | Bacteria | 2543 |
| 273 | Ga0439432_033117 | 3300042006 | Bacteria | 1664 |
| 274 | Ga0439463_056001 | 3300042016 | Bacteria | 1007 |
| 275 | Ga0439434_0010402 | 3300042435 | Bacteria | 2742 |
| 276 | Ga0466969_0028143 | 3300044656 | Bacteria | 2873 |
| 277 | Ga0466972_0033953 | 3300044658 | Bacteria | 2502 |
| 278 | Ga0466965_0035092 | 3300044683 | Bacteria | 2456 |
| 279 | Ga0466965_0160072 | 3300044683 | Bacteria | 1180 |
| 280 | Ga0466966_0060914 | 3300044684 | Bacteria | 2381 |
| 281 | Ga0466961_0011167 | 3300044693 | Bacteria | 5741 |
| 282 | Ga0466961_0029352 | 3300044693 | Bacteria | 3536 |
| 283 | Ga0466961_0145725 | 3300044693 | Bacteria | 1481 |
| 284 | Ga0466963_0039304 | 3300044694 | Bacteria | 3098 |
| 285 | Ga0466963_0109086 | 3300044694 | Bacteria | 1899 |
| 286 | Ga0466963_0123691 | 3300044694 | Bacteria | 1782 |
| 287 | Ga0466963_0203052 | 3300044694 | Bacteria | 1386 |
| 288 | Ga0466963_0269055 | 3300044694 | Bacteria | 1197 |
| 289 | Ga0466963_0296224 | 3300044694 | Bacteria | 1137 |
| 290 | Ga0466964_0158628 | 3300044706 | Bacteria | 1055 |
| 291 | Ga0466971_0009597 | 3300044719 | Bacteria | 4224 |
| 292 | Ga0466971_0050073 | 3300044719 | Bacteria | 1880 |
| 293 | Ga0466970_0000861 | 3300044765 | Bacteria | 14638 |
| 294 | Ga0466970_0018730 | 3300044765 | Bacteria | 3587 |
| 295 | Ga0466957_0043551 | 3300044842 | Bacteria | 2718 |
| 296 | Ga0466957_0162355 | 3300044842 | Bacteria | 1452 |
| 297 | Ga0466960_0006956 | 3300044901 | Bacteria | 4566 |
| 298 | Ga0466960_0009008 | 3300044901 | Bacteria | 4104 |
| 299 | Ga0466960_0032004 | 3300044901 | Bacteria | 2431 |
| 300 | Ga0466960_0051867 | 3300044901 | Bacteria | 1983 |
| 301 | Ga0466960_0173985 | 3300044901 | Bacteria | 1163 |
| 302 | Ga0466959_0054349 | 3300045049 | Bacteria | 2926 |
| 303 | Ga0466958_0073189 | 3300045836 | Bacteria | 2099 |
| 304 | Ga0466958_0157529 | 3300045836 | Bacteria | 1433 |
| 305 | Ga0466958_0385498 | 3300045836 | Bacteria | 904 |
| 306 | Ga0466967_0043575 | 3300045976 | Bacteria | 3886 |
| 307 | Ga0466967_0066736 | 3300045976 | Bacteria | 3207 |
| 308 | Ga0466967_0094077 | 3300045976 | Bacteria | 2728 |
| 309 | Ga0466967_0102204 | 3300045976 | Bacteria | 2622 |
| 310 | Ga0466967_0389409 | 3300045976 | Bacteria | 1354 |
| 311 | Ga0466967_0604430 | 3300045976 | Bacteria | 1082 |
| 312 | Ga0495592_0000516 | 3300046454 | Bacteria | 27942 |
| 313 | Ga0495603_0067680 | 3300046455 | Bacteria | 2102 |
| 314 | Ga0495629_0020867 | 3300046459 | Bacteria | 4676 |
| 315 | Ga0495629_0385210 | 3300046459 | Bacteria | 954 |
| 316 | Ga0495653_0457835 | 3300046463 | Bacteria | 801 |
| 317 | Ga0495582_0040249 | 3300046473 | Bacteria | 2574 |
| 318 | Ga0495620_0056865 | 3300046515 | Bacteria | 1644 |
| 319 | Ga0495628_0020537 | 3300046516 | Bacteria | 5445 |
| 320 | Ga0495652_0008753 | 3300046529 | Bacteria | 9212 |
| 321 | Ga0495640_0023258 | 3300046533 | Bacteria | 4519 |
| 322 | Ga0495667_0155556 | 3300046559 | Bacteria | 1471 |
| 323 | Ga0495634_0023404 | 3300046642 | Bacteria | 4342 |
| 324 | Ga0495657_0022501 | 3300046675 | Bacteria | 4513 |
| 325 | Ga0495624_0071845 | 3300046690 | Bacteria | 2153 |
| 326 | Ga0495600_0145007 | 3300046809 | Bacteria | 1539 |
| 327 | Ga0495581_0200562 | 3300047315 | Bacteria | 1167 |
| 328 | Ga0495676_0056919 | 3300047321 | Bacteria | 3088 |
| 329 | Ga0495675_0015131 | 3300047444 | Bacteria | 4877 |
| 330 | Ga0496100_0079369 | 3300048903 | Bacteria | 2211 |
| 331 | Ga0496101_0031435 | 3300048904 | Bacteria | 3732 |
| 332 | Ga0496101_0060301 | 3300048904 | Bacteria | 2752 |
| 333 | Ga0496101_0132808 | 3300048904 | Bacteria | 1892 |
| 334 | Ga0496101_0313508 | 3300048904 | Bacteria | 1230 |
| 335 | Ga0496102_0020692 | 3300048905 | Bacteria | 5814 |
| 336 | Ga0496102_0070025 | 3300048905 | Bacteria | 3220 |
| 337 | Ga0496102_0077245 | 3300048905 | Bacteria | 3064 |
| 338 | Ga0496102_0120231 | 3300048905 | Bacteria | 2453 |
| 339 | Ga0496102_0203791 | 3300048905 | Bacteria | 1865 |
| 340 | Ga0496102_0298658 | 3300048905 | Bacteria | 1518 |
| 341 | Ga0496102_0517921 | 3300048905 | Bacteria | 1115 |
| 342 | Ga0496102_0607728 | 3300048905 | Bacteria | 1016 |
| 343 | Ga0496103_0023705 | 3300048906 | Bacteria | 3702 |
| 344 | Ga0496103_0044229 | 3300048906 | Bacteria | 2743 |
| 345 | Ga0496103_0211208 | 3300048906 | Bacteria | 1248 |
| 346 | Ga0496103_0397813 | 3300048906 | Bacteria | 885 |
| 347 | Ga0496104_0219872 | 3300048907 | Bacteria | 1812 |
| 348 | Ga0496104_0320088 | 3300048907 | Bacteria | 1464 |
| 349 | Ga0496105_0000548 | 3300048908 | Bacteria | 24761 |
| 350 | Ga0496106_0127307 | 3300048909 | Bacteria | 1995 |
| 351 | Ga0496106_0139977 | 3300048909 | Bacteria | 1903 |
| 352 | Ga0496106_0577730 | 3300048909 | Bacteria | 901 |
| 353 | Ga0496107_0008251 | 3300048910 | Bacteria | 7208 |
| 354 | Ga0496107_0047472 | 3300048910 | Bacteria | 3092 |
| 355 | Ga0496107_0105753 | 3300048910 | Bacteria | 2066 |
| 356 | Ga0496107_0227622 | 3300048910 | Bacteria | 1387 |
| 357 | Ga0496107_0283538 | 3300048910 | Bacteria | 1233 |
| 358 | Ga0496107_0392398 | 3300048910 | Bacteria | 1032 |
| 359 | Ga0496107_0397704 | 3300048910 | Bacteria | 1025 |
| 360 | Ga0496108_0123457 | 3300048911 | Bacteria | 2222 |
| 361 | Ga0496108_0381666 | 3300048911 | Bacteria | 1230 |
| 362 | Ga0496108_0392354 | 3300048911 | Bacteria | 1212 |
| 363 | Ga0496108_0562418 | 3300048911 | Bacteria | 994 |
| 364 | Ga0496108_0630882 | 3300048911 | Bacteria | 932 |
| 365 | Ga0496109_0012870 | 3300048912 | Bacteria | 7232 |
| 366 | Ga0496109_0014289 | 3300048912 | Bacteria | 6909 |
| 367 | Ga0496109_0051866 | 3300048912 | Bacteria | 3737 |
| 368 | Ga0496109_0057924 | 3300048912 | Bacteria | 3538 |
| 369 | Ga0496109_0060245 | 3300048912 | Bacteria | 3468 |
| 370 | Ga0496109_0098749 | 3300048912 | Bacteria | 2707 |
| 371 | Ga0496109_0218555 | 3300048912 | Bacteria | 1792 |
| 372 | Ga0496109_0300850 | 3300048912 | Bacteria | 1513 |
| 373 | Ga0496109_0490924 | 3300048912 | Bacteria | 1159 |
| 374 | Ga0496110_0004402 | 3300048913 | Bacteria | 10909 |
| 375 | Ga0496110_0009941 | 3300048913 | Bacteria | 7714 |
| 376 | Ga0496110_0022555 | 3300048913 | Bacteria | 5346 |
| 377 | Ga0496110_0260939 | 3300048913 | Bacteria | 1577 |
| 378 | Ga0496110_0278058 | 3300048913 | Bacteria | 1524 |
| 379 | Ga0496110_0507430 | 3300048913 | Bacteria | 1098 |
| 380 | Ga0496111_0009898 | 3300048914 | Bacteria | 6372 |
| 381 | Ga0496111_0077527 | 3300048914 | Bacteria | 2423 |
| 382 | Ga0496111_0085117 | 3300048914 | Bacteria | 2311 |
| 383 | Ga0496111_0380178 | 3300048914 | Bacteria | 1044 |
| 384 | Ga0496112_0209641 | 3300048915 | Bacteria | 1906 |
| 385 | Ga0496113_0163563 | 3300048916 | Bacteria | 1760 |
| 386 | Ga0496113_0175087 | 3300048916 | Bacteria | 1700 |
| 387 | Ga0496113_0520932 | 3300048916 | Bacteria | 954 |
| 388 | Ga0496114_0020780 | 3300048917 | Bacteria | 5329 |
| 389 | Ga0496114_0035118 | 3300048917 | Bacteria | 4138 |
| 390 | Ga0496114_0055159 | 3300048917 | Bacteria | 3314 |
| 391 | Ga0496114_0072273 | 3300048917 | Bacteria | 2901 |
| 392 | Ga0496114_0114475 | 3300048917 | Bacteria | 2313 |
| 393 | Ga0496114_0142626 | 3300048917 | Bacteria | 2075 |
| 394 | Ga0496114_0150917 | 3300048917 | Bacteria | 2016 |
| 395 | Ga0496114_0308533 | 3300048917 | Bacteria | 1397 |
| 396 | Ga0496115_0009116 | 3300048918 | Bacteria | 7364 |
| 397 | Ga0496115_0061030 | 3300048918 | Bacteria | 3039 |
| 398 | Ga0496115_0082940 | 3300048918 | Bacteria | 2613 |
| 399 | Ga0496126_0032061 | 3300048929 | Bacteria | 4956 |
| 400 | Ga0496126_0044983 | 3300048929 | Bacteria | 4060 |
| 401 | Ga0496126_0466018 | 3300048929 | Bacteria | 1015 |
| 402 | Ga0501311_000356 | 3300049527 | Bacteria | 3040 |
| 403 | Ga0501311_029538 | 3300049527 | Bacteria | 787 |
| 404 | Ga0501313_007561 | 3300049529 | Bacteria | 1199 |
| 405 | Ga0501317_005160 | 3300049533 | Bacteria | 1390 |
| 406 | Ga0501318_003461 | 3300049534 | Bacteria | 1447 |
| 407 | Ga0501320_007353 | 3300049536 | Bacteria | 1057 |
| 408 | Ga0501031_0021165 | 3300049568 | Bacteria | 4241 |
| 409 | Ga0501031_0066688 | 3300049568 | Bacteria | 2345 |
| 410 | Ga0501031_0078482 | 3300049568 | Bacteria | 2151 |
| 411 | Ga0501031_0091871 | 3300049568 | Bacteria | 1980 |
| 412 | Ga0501031_0173217 | 3300049568 | Bacteria | 1410 |
| 413 | Ga0501032_0121013 | 3300049569 | Bacteria | 1730 |
| 414 | Ga0501032_0147500 | 3300049569 | Bacteria | 1548 |
| 415 | Ga0501034_0050240 | 3300049571 | Bacteria | 4206 |
| 416 | Ga0501034_0234971 | 3300049571 | Bacteria | 1781 |
| 417 | Ga0501034_0603919 | 3300049571 | Bacteria | 1002 |
| 418 | Ga0501036_0058092 | 3300049572 | Bacteria | 3277 |
| 419 | Ga0501036_0064011 | 3300049572 | Bacteria | 3113 |
| 420 | Ga0501036_0108857 | 3300049572 | Bacteria | 2342 |
| 421 | Ga0501036_0154570 | 3300049572 | Bacteria | 1935 |
| 422 | Ga0501036_0310080 | 3300049572 | Bacteria | 1319 |
| 423 | Ga0501037_0105406 | 3300049573 | Bacteria | 2032 |
| 424 | Ga0501037_0115997 | 3300049573 | Bacteria | 1927 |
| 425 | Ga0501038_0017056 | 3300049574 | Bacteria | 6568 |
| 426 | Ga0501038_0130670 | 3300049574 | Bacteria | 2062 |
| 427 | Ga0501039_0044367 | 3300049575 | Bacteria | 3434 |
| 428 | Ga0501039_0072032 | 3300049575 | Bacteria | 2686 |
| 429 | Ga0501039_0075037 | 3300049575 | Bacteria | 2628 |
| 430 | Ga0501039_0450861 | 3300049575 | Bacteria | 1010 |
| 431 | Ga0501040_0022358 | 3300049576 | Bacteria | 4231 |
| 432 | Ga0501040_0049525 | 3300049576 | Bacteria | 2872 |
| 433 | Ga0501040_0056444 | 3300049576 | Bacteria | 2695 |
| 434 | Ga0501040_0091831 | 3300049576 | Bacteria | 2111 |
| 435 | Ga0501041_0023087 | 3300049577 | Bacteria | 3729 |
| 436 | Ga0501041_0074050 | 3300049577 | Bacteria | 2092 |
| 437 | Ga0501042_0005582 | 3300049578 | Bacteria | 8107 |
| 438 | Ga0501043_0288993 | 3300049579 | Bacteria | 1255 |
| 439 | Ga0501046_0123249 | 3300049580 | Bacteria | 1971 |
| 440 | Ga0501046_0317573 | 3300049580 | Bacteria | 1135 |
| 441 | Ga0501046_0352029 | 3300049580 | Bacteria | 1069 |
| 442 | Ga0501047_0068498 | 3300049581 | Bacteria | 3418 |
| 443 | Ga0501047_0218332 | 3300049581 | Bacteria | 1763 |
| 444 | Ga0501047_0269172 | 3300049581 | Bacteria | 1550 |
| 445 | Ga0501048_0248135 | 3300049582 | Bacteria | 1263 |
| 446 | Ga0501048_0249590 | 3300049582 | Bacteria | 1259 |
| 447 | Ga0501048_0264782 | 3300049582 | Bacteria | 1221 |
| 448 | Ga0501067_0001257 | 3300049583 | Bacteria | 13778 |
| 449 | Ga0501067_0005296 | 3300049583 | Bacteria | 7165 |
| 450 | Ga0501067_0017223 | 3300049583 | Bacteria | 3994 |
| 451 | Ga0501067_0024162 | 3300049583 | Bacteria | 3369 |
| 452 | Ga0501067_0040603 | 3300049583 | Bacteria | 2584 |
| 453 | Ga0501067_0234920 | 3300049583 | Bacteria | 1020 |
| 454 | Ga0501067_0315136 | 3300049583 | Bacteria | 871 |
| 455 | Ga0501068_0008131 | 3300049584 | Bacteria | 5825 |
| 456 | Ga0501068_0008186 | 3300049584 | Bacteria | 5810 |
| 457 | Ga0501068_0025962 | 3300049584 | Bacteria | 3448 |
| 458 | Ga0501068_0049413 | 3300049584 | Bacteria | 2540 |
| 459 | Ga0501069_0055567 | 3300049585 | Bacteria | 2206 |
| 460 | Ga0501069_0091596 | 3300049585 | Bacteria | 1719 |
| 461 | Ga0501069_0142606 | 3300049585 | Bacteria | 1374 |
| 462 | Ga0501069_0198388 | 3300049585 | Bacteria | 1162 |
| 463 | Ga0501069_0229232 | 3300049585 | Bacteria | 1081 |
| 464 | Ga0501069_0294512 | 3300049585 | Bacteria | 951 |
| 465 | Ga0501070_0002454 | 3300049586 | Bacteria | 16250 |
| 466 | Ga0501070_0011989 | 3300049586 | Bacteria | 7315 |
| 467 | Ga0501070_0040980 | 3300049586 | Bacteria | 3859 |
| 468 | Ga0501070_0045578 | 3300049586 | Bacteria | 3647 |
| 469 | Ga0501070_0047146 | 3300049586 | Bacteria | 3582 |
| 470 | Ga0501070_0114279 | 3300049586 | Bacteria | 2230 |
| 471 | Ga0501070_0124776 | 3300049586 | Bacteria | 2128 |
| 472 | Ga0501070_0175935 | 3300049586 | Bacteria | 1762 |
| 473 | Ga0501070_0201532 | 3300049586 | Bacteria | 1634 |
| 474 | Ga0501070_0215243 | 3300049586 | Bacteria | 1576 |
| 475 | Ga0501071_0004654 | 3300049587 | Bacteria | 8716 |
| 476 | Ga0501071_0010875 | 3300049587 | Bacteria | 6106 |
| 477 | Ga0501071_0156736 | 3300049587 | Bacteria | 1700 |
| 478 | Ga0501072_0013538 | 3300049588 | Bacteria | 6242 |
| 479 | Ga0501072_0054152 | 3300049588 | Bacteria | 3160 |
| 480 | Ga0501072_0084522 | 3300049588 | Bacteria | 2516 |
| 481 | Ga0501072_0126070 | 3300049588 | Bacteria | 2040 |
| 482 | Ga0501072_0145802 | 3300049588 | Bacteria | 1887 |
| 483 | Ga0501072_0224841 | 3300049588 | Bacteria | 1496 |
| 484 | Ga0501073_0007125 | 3300049589 | Bacteria | 8329 |
| 485 | Ga0501073_0010800 | 3300049589 | Bacteria | 6687 |
| 486 | Ga0501074_0006288 | 3300049590 | Bacteria | 8576 |
| 487 | Ga0501074_0010173 | 3300049590 | Bacteria | 6828 |
| 488 | Ga0501074_0014523 | 3300049590 | Bacteria | 5730 |
| 489 | Ga0501074_0015241 | 3300049590 | Bacteria | 5586 |
| 490 | Ga0501075_0167009 | 3300049591 | Bacteria | 1679 |
| 491 | Ga0501075_0234120 | 3300049591 | Bacteria | 1400 |
| 492 | Ga0501076_0064120 | 3300049592 | Bacteria | 2928 |
| 493 | Ga0501076_0065031 | 3300049592 | Bacteria | 2907 |
| 494 | Ga0501076_0239111 | 3300049592 | Bacteria | 1485 |
| 495 | Ga0501077_0008549 | 3300049593 | Bacteria | 6344 |
| 496 | Ga0501077_0033631 | 3300049593 | Bacteria | 3262 |
| 497 | Ga0501077_0145301 | 3300049593 | Bacteria | 1504 |
| 498 | Ga0501079_0037036 | 3300049741 | Bacteria | 3758 |
| 499 | Ga0501080_0008497 | 3300049742 | Bacteria | 9308 |
| 500 | Ga0501080_0041440 | 3300049742 | Bacteria | 4290 |
| 501 | Ga0501080_0080089 | 3300049742 | Bacteria | 3036 |
| 502 | Ga0501080_0091949 | 3300049742 | Bacteria | 2818 |
| 503 | Ga0501080_0136174 | 3300049742 | Bacteria | 2273 |
| 504 | Ga0501083_0105391 | 3300049744 | Bacteria | 1856 |
| 505 | Ga0501083_0114851 | 3300049744 | Bacteria | 1768 |
| 506 | Ga0501035_0111053 | 3300049822 | Bacteria | 2403 |
| 507 | Ga0501035_0522599 | 3300049822 | Bacteria | 975 |
| 508 | Ga0501044_0013267 | 3300049823 | Bacteria | 8920 |
| 509 | Ga0501044_0034452 | 3300049823 | Bacteria | 5309 |
| 510 | Ga0501044_0173253 | 3300049823 | Bacteria | 2128 |
| 511 | Ga0501044_0194159 | 3300049823 | Bacteria | 1991 |
| 512 | Ga0501045_0011452 | 3300049824 | Bacteria | 6230 |
| 513 | Ga0501045_0044889 | 3300049824 | Bacteria | 3219 |
| 514 | Ga0501045_0055621 | 3300049824 | Bacteria | 2893 |
| 515 | Ga0501045_0062164 | 3300049824 | Bacteria | 2740 |
| 516 | Ga0501045_0347880 | 3300049824 | Bacteria | 1103 |
| 517 | nmdc:mga00v17_93186_c1 | 3300050491 | Bacteria | 1894 |
| 518 | nmdc:mga0yw44_112224_c1 | 3300050492 | Bacteria | 1748 |
| 519 | nmdc:mga0yw44_112801_c1 | 3300050492 | Bacteria | 1744 |
| 520 | nmdc:mga0yw44_31120_c1 | 3300050492 | Bacteria | 3100 |
| 521 | nmdc:mga0yw44_76209_c1 | 3300050492 | Bacteria | 2093 |
| 522 | nmdc:mga06z11_276776_c1 | 3300050494 | Bacteria | 993 |
| 523 | nmdc:mga05p37_587_c1 | 3300050507 | Bacteria | 40013 |
| 524 | nmdc:mga0qj67_51973_c1 | 3300050509 | Bacteria | 3242 |
| 525 | nmdc:mga06r32_2134_c1 | 3300050510 | Bacteria | 17665 |
| 526 | nmdc:mga06r32_9319_c1 | 3300050510 | Bacteria | 8851 |
| 527 | nmdc:mga08y16_26570_c1 | 3300050511 | Bacteria | 6102 |
| 528 | Ga0495601_0014317 | 3300053077 | Bacteria | 4778 |
| 529 | Ga0495601_0244118 | 3300053077 | Bacteria | 1173 |
| 530 | Ga0495612_0043046 | 3300053078 | Bacteria | 1844 |
| 531 | Ga0495595_0085217 | 3300053084 | Bacteria | 1510 |
| 532 | Ga0495619_0023731 | 3300053085 | Bacteria | 3932 |
| 533 | Ga0495619_0233661 | 3300053085 | Bacteria | 1274 |
| 534 | Ga0500644_0048433 | 3300053088 | Bacteria | 1446 |
| 535 | Ga0500556_0002046 | 3300053104 | Bacteria | 6998 |
| 536 | Ga0500593_000063 | 3300053117 | Bacteria | 39478 |
| 537 | Ga0500573_0037711 | 3300053140 | Bacteria | 2793 |
| 538 | Ga0500630_051617 | 3300053159 | Bacteria | 1986 |
| 539 | Ga0500611_065003 | 3300053727 | Bacteria | 874 |
| 540 | Ga0501084_0097277 | 3300054114 | Bacteria | 2471 |
| 541 | Ga0501084_0112803 | 3300054114 | Bacteria | 2284 |
| 542 | Ga0501082_0054898 | 3300060353 | Bacteria | 3433 |
| 543 | Ga0501082_0087222 | 3300060353 | Bacteria | 2692 |
| 544 | Ga0501082_0341478 | 3300060353 | Bacteria | 1305 |
| 545 | Ga0466962_0119680 | 3300061719 | Bacteria | 1270 |
| 546 | Ga0466962_0222756 | 3300061719 | Bacteria | 924 |
| 547 | Ga0530510_0065309 | 3300061734 | Bacteria | 2637 |
| 548 | Ga0530510_0467407 | 3300061734 | Bacteria | 955 |
| 549 | 2515851018 | 2515154155 | Bacteria | 7985436 |
| 550 | 2643825801 | 2643221561 | Bacteria | 4984412 |
| 551 | 2644093831 | 2643221615 | Bacteria | 5487866 |
| 552 | 2644230180 | 2643221641 | Bacteria | 4490190 |
| 553 | 2644323675 | 2643221657 | Bacteria | 5490246 |
| 554 | 2644531793 | 2643221696 | Bacteria | 5431823 |
| 555 | 2676474885 | 2675903058 | Bacteria | 6822861 |
| 556 | 2740169157 | 2739367898 | Bacteria | 4367674 |
| 557 | 2753267452 | 2751185782 | Bacteria | 11227053 |
| 558 | 2827630947 | 2827628540 | Bacteria | 6858585 |
| 559 | 2832007231 | 2832004796 | Bacteria | 6538017 |
| 560 | 2839989641 | 2839986021 | Bacteria | 3685650 |
| 561 | 2866066764 | 2866065130 | Bacteria | 6518152 |
| 562 | 2887447350 | 2887443736 | Bacteria | 4426037 |
| 563 | 2929225443 | 2929219909 | Bacteria | 6984360 |
| 564 | 2932432289 | 2932431166 | Bacteria | 4215299 |
| 565 | 8003863236 | 8003856774 | Bacteria | 7675274 |
| 566 | 8054611009 | 8054609563 | Bacteria | 5170090 |
| 567 | Ga0105243_10452438 | |||
| 568 | JGI24740J21852_10007177 | |||
| 569 | JGI24737J22298_10048814 | |||
| 570 | JGI24743J22301_10010295 | |||
| 571 | JGI24738J21930_10017265 | |||
| 572 | JGI24749J21850_1015997 | |||
| 573 | JGI24744J21845_10023770 | |||
| 574 | JGI24742J22300_10024543 | |||
| 575 | JGI25406J46586_10010340 | |||
| 576 | Ga0007410J51695_1050572 | |||
| 577 | Ga0007429J51699_1031552 | |||
| 578 | Ga0032354_1014081 | |||
| 579 | JGI25405J52794_10033831 | |||
| 580 | Ga0070658_10223548 | |||
| 581 | Ga0070658_10559495 | |||
| 582 | Ga0070683_100002939 | |||
| 583 | Ga0070683_100029967 | |||
| 584 | Ga0070683_100209014 | |||
| 585 | Ga0070683_100252624 | |||
| 586 | Ga0070683_100257571 | |||
| 587 | Ga0068868_100095769 | |||
| 588 | Ga0068868_100316056 | |||
| 589 | Ga0068868_100464909 | |||
| 590 | Ga0070660_100011196 | |||
| 591 | Ga0070660_100015411 | |||
| 592 | Ga0070689_100125879 | |||
| 593 | Ga0070691_10051221 | |||
| 594 | Ga0070687_100392046 | |||
| 595 | Ga0070692_10000366 | |||
| 596 | Ga0070668_100025619 | |||
| 597 | Ga0070668_100030666 | |||
| 598 | Ga0070673_100482867 | |||
| 599 | Ga0070688_100313828 | |||
| 600 | Ga0070688_100349014 | |||
| 601 | Ga0070659_100016127 | |||
| 602 | Ga0070659_100165981 | |||
| 603 | Ga0070659_100190391 | |||
| 604 | Ga0070714_100069079 | |||
| 605 | Ga0070701_10004012 | |||
| 606 | Ga0070700_100001674 | |||
| 607 | Ga0070700_100136924 | |||
| 608 | Ga0070662_100126808 | |||
| 609 | Ga0070685_10118537 | |||
| 610 | Ga0070679_100029110 | |||
| 611 | Ga0070679_100253193 | |||
| 612 | Ga0070684_100012878 | |||
| 613 | Ga0070684_100072397 | |||
| 614 | Ga0070684_100159545 | |||
| 615 | Ga0070684_100232881 | |||
| 616 | Ga0068853_100032374 | |||
| 617 | Ga0068853_100388134 | |||
| 618 | Ga0070672_100015704 | |||
| 619 | Ga0070686_100199900 | |||
| 620 | Ga0070665_100004769 | |||
| 621 | Ga0068855_100139509 | |||
| 622 | Ga0068855_100650502 | |||
| 623 | Ga0070664_100029424 | |||
| 624 | Ga0068857_100080266 | |||
| 625 | Ga0068856_100406588 | |||
| 626 | Ga0070702_100044438 | |||
| 627 | Ga0070702_100465739 | |||
| 628 | Ga0068852_100038082 | |||
| 629 | Ga0068852_100139354 | |||
| 630 | Ga0068864_100099470 | |||
| 631 | Ga0068864_100278881 | |||
| 632 | Ga0068864_100451991 | |||
| 633 | Ga0068861_100090257 | |||
| 634 | Ga0068861_100111515 | |||
| 635 | Ga0068861_100139113 | |||
| 636 | Ga0068870_10073141 | |||
| 637 | Ga0068858_100108933 | |||
| 638 | Ga0068858_100255908 | |||
| 639 | Ga0068862_100191815 | |||
| 640 | Ga0081455_10000201 | |||
| 641 | Ga0081455_10016265 | |||
| 642 | Ga0081538_10000202 | |||
| 643 | Ga0081538_10016835 | |||
| 644 | Ga0081540_1058173 | |||
| 645 | Ga0081539_10000657 | |||
| 646 | Ga0081539_10001605 | |||
| 647 | Ga0081539_10007450 | |||
| 648 | Ga0081539_10137822 | |||
| 649 | Ga0075365_10061359 | |||
| 650 | Ga0075365_10073422 | |||
| 651 | Ga0075364_10131118 | |||
| 652 | Ga0075362_10112195 | |||
| 653 | Ga0068871_100599416 | |||
| 654 | Ga0075428_100253241 | |||
| 655 | Ga0075430_100052764 | |||
| 656 | Ga0075430_100157888 | |||
| 657 | Ga0075431_100000633 | |||
| 658 | Ga0075429_100002893 | |||
| 659 | Ga0075429_100357499 | |||
| 660 | Ga0068865_100007627 | |||
| 661 | Ga0068865_100184496 | |||
| 662 | Ga0111539_10006814 | |||
| 663 | Ga0111539_10537504 | |||
| 664 | Ga0105245_10005963 | |||
| 665 | Ga0105245_10016221 | |||
| 666 | Ga0105245_10156114 | |||
| 667 | Ga0105245_10549114 | |||
| 668 | Ga0105243_10095608 | |||
| 669 | Ga0105243_10339822 | |||
| 670 | Ga0105243_10342216 | |||
| 671 | Ga0105242_10227329 | |||
| 672 | Ga0105242_10609561 | |||
| 673 | Ga0105242_10611728 | |||
| 674 | Ga0105248_10099777 | |||
| 675 | Ga0105238_10228786 | |||
| 676 | Ga0105249_10111868 | |||
| 677 | Ga0105249_10271327 | |||
| 678 | Ga0105249_10934341 | |||
| 679 | Ga0105239_10010142 | |||
| 680 | Ga0105239_10010437 | |||
| 681 | Ga0105246_10017507 | |||
| 682 | Ga0157369_10288292 | |||
| 683 | Ga0157369_10958315 | |||
| 684 | Ga0157378_10463112 | |||
| 685 | Ga0163162_10035229 | |||
| 686 | Ga0157372_10013423 | |||
| 687 | Ga0157372_10080017 | |||
| 688 | Ga0157372_10180534 | |||
| 689 | Ga0157372_11024017 | |||
| 690 | Ga0157375_10014182 | |||
| 691 | Ga0157375_10638113 | |||
| 692 | Ga0163163_10039203 | |||
| 693 | Ga0163163_10052315 | |||
| 694 | Ga0163163_11228285 | |||
| 695 | Ga0157380_10017242 | |||
| 696 | Ga0157380_10069207 | |||
| 697 | Ga0182008_10100191 | |||
| 698 | Ga0157379_10015241 | |||
| 699 | Ga0157379_10196993 | |||
| 700 | Ga0157376_10107287 | |||
| 701 | Ga0206354_11370483 | |||
| 702 | Ga0206353_11839692 | |||
| 703 | Ga0207688_10018348 | |||
| 704 | Ga0207688_10316849 | |||
| 705 | Ga0207680_10364547 | |||
| 706 | Ga0207647_10015351 | |||
| 707 | Ga0207643_10110122 | |||
| 708 | Ga0207643_10162349 | |||
| 709 | Ga0207705_10027564 | |||
| 710 | Ga0207705_10054693 | |||
| 711 | Ga0207705_10234842 | |||
| 712 | Ga0207657_10009770 | |||
| 713 | Ga0207657_10057136 | |||
| 714 | Ga0207657_10066565 | |||
| 715 | Ga0207657_10286644 | |||
| 716 | Ga0207649_10208671 | |||
| 717 | Ga0207652_10017458 | |||
| 718 | Ga0207652_10179821 | |||
| 719 | Ga0207694_10223799 | |||
| 720 | Ga0207687_10026584 | |||
| 721 | Ga0207687_10047858 | |||
| 722 | Ga0207687_10503331 | |||
| 723 | Ga0207664_10059251 | |||
| 724 | Ga0207664_10404744 | |||
| 725 | Ga0207690_10037105 | |||
| 726 | Ga0207690_10046215 | |||
| 727 | Ga0207690_10137311 | |||
| 728 | Ga0207706_10035180 | |||
| 729 | Ga0207706_10569108 | |||
| 730 | Ga0207709_10194818 | |||
| 731 | Ga0207709_10249441 | |||
| 732 | Ga0207704_10049015 | |||
| 733 | Ga0207704_10127695 | |||
| 734 | Ga0207691_10005898 | |||
| 735 | Ga0207711_10087923 | |||
| 736 | Ga0207689_10589937 | |||
| 737 | Ga0207661_10043878 | |||
| 738 | Ga0207661_10094918 | |||
| 739 | Ga0207661_10114393 | |||
| 740 | Ga0207661_10246726 | |||
| 741 | Ga0207661_10412452 | |||
| 742 | Ga0207679_10059548 | |||
| 743 | Ga0207667_10138989 | |||
| 744 | Ga0207668_10019851 | |||
| 745 | Ga0207668_10634680 | |||
| 746 | Ga0207658_10038059 | |||
| 747 | Ga0207658_10108266 | |||
| 748 | Ga0207703_10179832 | |||
| 749 | Ga0207639_10299293 | |||
| 750 | Ga0207639_10371046 | |||
| 751 | Ga0207639_10392199 | |||
| 752 | Ga0207678_10036546 | |||
| 753 | Ga0207708_10000665 | |||
| 754 | Ga0207708_10039108 | |||
| 755 | Ga0207702_10640511 | |||
| 756 | Ga0207641_10108902 | |||
| 757 | Ga0207676_10214687 | |||
| 758 | Ga0207676_10218062 | |||
| 759 | Ga0207676_10379252 | |||
| 760 | Ga0207674_10094896 | |||
| 761 | Ga0207674_10227181 | |||
| 762 | Ga0207674_10703845 | |||
| 763 | Ga0207675_100001223 | |||
| 764 | Ga0207675_100042973 | |||
| 765 | Ga0207675_100119286 | |||
| 766 | Ga0207683_10420025 | |||
| 767 | Ga0207683_10425228 | |||
| 768 | Ga0207698_10134091 | |||
| 769 | Ga0207428_10010519 | |||
| 770 | Ga0268266_10003110 | |||
| 771 | Ga0268265_10059885 | |||
| 772 | Ga0268265_10117951 | |||
| 773 | Ga0307515_10000065 | |||
| 774 | Ga0307515_10014064 | |||
| 775 | Ga0307512_10004466 | |||
| 776 | Ga0316178_1068862 | |||
| 777 | Ga0316181_1000190 | |||
| 778 | Ga0307513_10011749 | |||
| 779 | Ga0307513_10344459 | |||
| 780 | Ga0307509_10031252 | |||
| 781 | Ga0307509_10090165 | |||
| 782 | Ga0307509_10191436 | |||
| 783 | Ga0307408_100145853 | |||
| 784 | Ga0307508_10000654 | |||
| 785 | Ga0307508_10002351 | |||
| 786 | Ga0307508_10116219 | |||
| 787 | Ga0307508_10263109 | |||
| 788 | Ga0307516_10004273 | |||
| 789 | Ga0307516_10025318 | |||
| 790 | Ga0307405_10013871 | |||
| 791 | Ga0307405_10035933 | |||
| 792 | Ga0307413_10127789 | |||
| 793 | Ga0307410_10109444 | |||
| 794 | Ga0307410_10163073 | |||
| 795 | Ga0307410_10209493 | |||
| 796 | Ga0307410_10456299 | |||
| 797 | Ga0307406_10210086 | |||
| 798 | Ga0307406_10367862 | |||
| 799 | Ga0307406_10522283 | |||
| 800 | Ga0307407_10275992 | |||
| 801 | Ga0307412_10248579 | |||
| 802 | Ga0307409_100030350 | |||
| 803 | Ga0307409_100128053 | |||
| 804 | Ga0307409_100272737 | |||
| 805 | Ga0307416_100010387 | |||
| 806 | Ga0307416_100078566 | |||
| 807 | Ga0307416_100360720 | |||
| 808 | Ga0307414_10035449 | |||
| 809 | Ga0307414_10189385 | |||
| 810 | Ga0307414_10728125 | |||
| 811 | Ga0307411_10191191 | |||
| 812 | Ga0307411_10570579 | |||
| 813 | Ga0307415_100019274 | |||
| 814 | Ga0307415_100061384 | |||
| 815 | Ga0307415_100129326 | |||
| 816 | Ga0307415_100668497 | |||
| 817 | Ga0307415_100801169 | |||
| 818 | Ga0307507_10017573 | |||
| 819 | Ga0307510_10094232 | |||
| 820 | Ga0373951_0000058 | |||
| 821 | Ga0373935_0028068 | |||
| 822 | Ga0395899_0030500 | |||
| 823 | Ga0395900_0024436 | |||
| 824 | Ga0395900_0134564 | |||
| 825 | Ga0395900_0733275 | |||
| 826 | Ga0395898_0037524 | |||
| 827 | Ga0395898_0376428 | |||
| 828 | Ga0395905_0693509 | |||
| 829 | Ga0436364_1072955 | |||
| 830 | Ga0395901_0006468 | |||
| 831 | Ga0395901_0037579 | |||
| 832 | Ga0395901_0060266 | |||
| 833 | Ga0436365_1732162 | |||
| 834 | Ga0451802_1964298 | |||
| 835 | Ga0451837_1015006 | |||
| 836 | Ga0451853_1031450 | |||
| 837 | Ga0439431_0000696 | |||
| 838 | Ga0439442_005462 | |||
| 839 | Ga0439432_033117 | |||
| 840 | Ga0439463_056001 | |||
| 841 | Ga0439434_0010402 | |||
| 842 | Ga0466969_0028143 | |||
| 843 | Ga0466972_0033953 | |||
| 844 | Ga0466965_0035092 | |||
| 845 | Ga0466965_0160072 | |||
| 846 | Ga0466966_0060914 | |||
| 847 | Ga0466961_0011167 | |||
| 848 | Ga0466961_0029352 | |||
| 849 | Ga0466961_0145725 | |||
| 850 | Ga0466963_0039304 | |||
| 851 | Ga0466963_0109086 | |||
| 852 | Ga0466963_0123691 | |||
| 853 | Ga0466963_0203052 | |||
| 854 | Ga0466963_0269055 | |||
| 855 | Ga0466963_0296224 | |||
| 856 | Ga0466964_0158628 | |||
| 857 | Ga0466971_0009597 | |||
| 858 | Ga0466971_0050073 | |||
| 859 | Ga0466970_0000861 | |||
| 860 | Ga0466970_0018730 | |||
| 861 | Ga0466957_0043551 | |||
| 862 | Ga0466957_0162355 | |||
| 863 | Ga0466960_0006956 | |||
| 864 | Ga0466960_0009008 | |||
| 865 | Ga0466960_0032004 | |||
| 866 | Ga0466960_0051867 | |||
| 867 | Ga0466960_0173985 | |||
| 868 | Ga0466959_0054349 | |||
| 869 | Ga0466958_0073189 | |||
| 870 | Ga0466958_0157529 | |||
| 871 | Ga0466958_0385498 | |||
| 872 | Ga0466967_0043575 | |||
| 873 | Ga0466967_0066736 | |||
| 874 | Ga0466967_0094077 | |||
| 875 | Ga0466967_0102204 | |||
| 876 | Ga0466967_0389409 | |||
| 877 | Ga0466967_0604430 | |||
| 878 | Ga0495592_0000516 | |||
| 879 | Ga0495603_0067680 | |||
| 880 | Ga0495629_0020867 | |||
| 881 | Ga0495629_0385210 | |||
| 882 | Ga0495653_0457835 | |||
| 883 | Ga0495582_0040249 | |||
| 884 | Ga0495620_0056865 | |||
| 885 | Ga0495628_0020537 | |||
| 886 | Ga0495652_0008753 | |||
| 887 | Ga0495640_0023258 | |||
| 888 | Ga0495667_0155556 | |||
| 889 | Ga0495634_0023404 | |||
| 890 | Ga0495657_0022501 | |||
| 891 | Ga0495624_0071845 | |||
| 892 | Ga0495600_0145007 | |||
| 893 | Ga0495581_0200562 | |||
| 894 | Ga0495676_0056919 | |||
| 895 | Ga0495675_0015131 | |||
| 896 | Ga0496100_0079369 | |||
| 897 | Ga0496101_0031435 | |||
| 898 | Ga0496101_0060301 | |||
| 899 | Ga0496101_0132808 | |||
| 900 | Ga0496101_0313508 | |||
| 901 | Ga0496102_0020692 | |||
| 902 | Ga0496102_0070025 | |||
| 903 | Ga0496102_0077245 | |||
| 904 | Ga0496102_0120231 | |||
| 905 | Ga0496102_0203791 | |||
| 906 | Ga0496102_0298658 | |||
| 907 | Ga0496102_0517921 | |||
| 908 | Ga0496102_0607728 | |||
| 909 | Ga0496103_0023705 | |||
| 910 | Ga0496103_0044229 | |||
| 911 | Ga0496103_0211208 | |||
| 912 | Ga0496103_0397813 | |||
| 913 | Ga0496104_0219872 | |||
| 914 | Ga0496104_0320088 | |||
| 915 | Ga0496105_0000548 | |||
| 916 | Ga0496106_0127307 | |||
| 917 | Ga0496106_0139977 | |||
| 918 | Ga0496106_0577730 | |||
| 919 | Ga0496107_0008251 | |||
| 920 | Ga0496107_0047472 | |||
| 921 | Ga0496107_0105753 | |||
| 922 | Ga0496107_0227622 | |||
| 923 | Ga0496107_0283538 | |||
| 924 | Ga0496107_0392398 | |||
| 925 | Ga0496107_0397704 | |||
| 926 | Ga0496108_0123457 | |||
| 927 | Ga0496108_0381666 | |||
| 928 | Ga0496108_0392354 | |||
| 929 | Ga0496108_0562418 | |||
| 930 | Ga0496108_0630882 | |||
| 931 | Ga0496109_0012870 | |||
| 932 | Ga0496109_0014289 | |||
| 933 | Ga0496109_0051866 | |||
| 934 | Ga0496109_0057924 | |||
| 935 | Ga0496109_0060245 | |||
| 936 | Ga0496109_0098749 | |||
| 937 | Ga0496109_0218555 | |||
| 938 | Ga0496109_0300850 | |||
| 939 | Ga0496109_0490924 | |||
| 940 | Ga0496110_0004402 | |||
| 941 | Ga0496110_0009941 | |||
| 942 | Ga0496110_0022555 | |||
| 943 | Ga0496110_0260939 | |||
| 944 | Ga0496110_0278058 | |||
| 945 | Ga0496110_0507430 | |||
| 946 | Ga0496111_0009898 | |||
| 947 | Ga0496111_0077527 | |||
| 948 | Ga0496111_0085117 | |||
| 949 | Ga0496111_0380178 | |||
| 950 | Ga0496112_0209641 | |||
| 951 | Ga0496113_0163563 | |||
| 952 | Ga0496113_0175087 | |||
| 953 | Ga0496113_0520932 | |||
| 954 | Ga0496114_0020780 | |||
| 955 | Ga0496114_0035118 | |||
| 956 | Ga0496114_0055159 | |||
| 957 | Ga0496114_0072273 | |||
| 958 | Ga0496114_0114475 | |||
| 959 | Ga0496114_0142626 | |||
| 960 | Ga0496114_0150917 | |||
| 961 | Ga0496114_0308533 | |||
| 962 | Ga0496115_0009116 | |||
| 963 | Ga0496115_0061030 | |||
| 964 | Ga0496115_0082940 | |||
| 965 | Ga0496126_0032061 | |||
| 966 | Ga0496126_0044983 | |||
| 967 | Ga0496126_0466018 | |||
| 968 | Ga0501311_000356 | |||
| 969 | Ga0501311_029538 | |||
| 970 | Ga0501313_007561 | |||
| 971 | Ga0501317_005160 | |||
| 972 | Ga0501318_003461 | |||
| 973 | Ga0501320_007353 | |||
| 974 | Ga0501031_0021165 | |||
| 975 | Ga0501031_0066688 | |||
| 976 | Ga0501031_0078482 | |||
| 977 | Ga0501031_0091871 | |||
| 978 | Ga0501031_0173217 | |||
| 979 | Ga0501032_0121013 | |||
| 980 | Ga0501032_0147500 | |||
| 981 | Ga0501034_0050240 | |||
| 982 | Ga0501034_0234971 | |||
| 983 | Ga0501034_0603919 | |||
| 984 | Ga0501036_0058092 | |||
| 985 | Ga0501036_0064011 | |||
| 986 | Ga0501036_0108857 | |||
| 987 | Ga0501036_0154570 | |||
| 988 | Ga0501036_0310080 | |||
| 989 | Ga0501037_0105406 | |||
| 990 | Ga0501037_0115997 | |||
| 991 | Ga0501038_0017056 | |||
| 992 | Ga0501038_0130670 | |||
| 993 | Ga0501039_0044367 | |||
| 994 | Ga0501039_0072032 | |||
| 995 | Ga0501039_0075037 | |||
| 996 | Ga0501039_0450861 | |||
| 997 | Ga0501040_0022358 | |||
| 998 | Ga0501040_0049525 | |||
| 999 | Ga0501040_0056444 | |||
| 1000 | Ga0501040_0091831 | |||
| 1001 | Ga0501041_0023087 | |||
| 1002 | Ga0501041_0074050 | |||
| 1003 | Ga0501042_0005582 | |||
| 1004 | Ga0501043_0288993 | |||
| 1005 | Ga0501046_0123249 | |||
| 1006 | Ga0501046_0317573 | |||
| 1007 | Ga0501046_0352029 | |||
| 1008 | Ga0501047_0068498 | |||
| 1009 | Ga0501047_0218332 | |||
| 1010 | Ga0501047_0269172 | |||
| 1011 | Ga0501048_0248135 | |||
| 1012 | Ga0501048_0249590 | |||
| 1013 | Ga0501048_0264782 | |||
| 1014 | Ga0501067_0001257 | |||
| 1015 | Ga0501067_0005296 | |||
| 1016 | Ga0501067_0017223 | |||
| 1017 | Ga0501067_0024162 | |||
| 1018 | Ga0501067_0040603 | |||
| 1019 | Ga0501067_0234920 | |||
| 1020 | Ga0501067_0315136 | |||
| 1021 | Ga0501068_0008131 | |||
| 1022 | Ga0501068_0008186 | |||
| 1023 | Ga0501068_0025962 | |||
| 1024 | Ga0501068_0049413 | |||
| 1025 | Ga0501069_0055567 | |||
| 1026 | Ga0501069_0091596 | |||
| 1027 | Ga0501069_0142606 | |||
| 1028 | Ga0501069_0198388 | |||
| 1029 | Ga0501069_0229232 | |||
| 1030 | Ga0501069_0294512 | |||
| 1031 | Ga0501070_0002454 | |||
| 1032 | Ga0501070_0011989 | |||
| 1033 | Ga0501070_0040980 | |||
| 1034 | Ga0501070_0045578 | |||
| 1035 | Ga0501070_0047146 | |||
| 1036 | Ga0501070_0114279 | |||
| 1037 | Ga0501070_0124776 | |||
| 1038 | Ga0501070_0175935 | |||
| 1039 | Ga0501070_0201532 | |||
| 1040 | Ga0501070_0215243 | |||
| 1041 | Ga0501071_0004654 | |||
| 1042 | Ga0501071_0010875 | |||
| 1043 | Ga0501071_0156736 | |||
| 1044 | Ga0501072_0013538 | |||
| 1045 | Ga0501072_0054152 | |||
| 1046 | Ga0501072_0084522 | |||
| 1047 | Ga0501072_0126070 | |||
| 1048 | Ga0501072_0145802 | |||
| 1049 | Ga0501072_0224841 | |||
| 1050 | Ga0501073_0007125 | |||
| 1051 | Ga0501073_0010800 | |||
| 1052 | Ga0501074_0006288 | |||
| 1053 | Ga0501074_0010173 | |||
| 1054 | Ga0501074_0014523 | |||
| 1055 | Ga0501074_0015241 | |||
| 1056 | Ga0501075_0167009 | |||
| 1057 | Ga0501075_0234120 | |||
| 1058 | Ga0501076_0064120 | |||
| 1059 | Ga0501076_0065031 | |||
| 1060 | Ga0501076_0239111 | |||
| 1061 | Ga0501077_0008549 | |||
| 1062 | Ga0501077_0033631 | |||
| 1063 | Ga0501077_0145301 | |||
| 1064 | Ga0501079_0037036 | |||
| 1065 | Ga0501080_0008497 | |||
| 1066 | Ga0501080_0041440 | |||
| 1067 | Ga0501080_0080089 | |||
| 1068 | Ga0501080_0091949 | |||
| 1069 | Ga0501080_0136174 | |||
| 1070 | Ga0501083_0105391 | |||
| 1071 | Ga0501083_0114851 | |||
| 1072 | Ga0501035_0111053 | |||
| 1073 | Ga0501035_0522599 | |||
| 1074 | Ga0501044_0013267 | |||
| 1075 | Ga0501044_0034452 | |||
| 1076 | Ga0501044_0173253 | |||
| 1077 | Ga0501044_0194159 | |||
| 1078 | Ga0501045_0011452 | |||
| 1079 | Ga0501045_0044889 | |||
| 1080 | Ga0501045_0055621 | |||
| 1081 | Ga0501045_0062164 | |||
| 1082 | Ga0501045_0347880 | |||
| 1083 | nmdc:mga00v17_93186_c1 | |||
| 1084 | nmdc:mga0yw44_112224_c1 | |||
| 1085 | nmdc:mga0yw44_112801_c1 | |||
| 1086 | nmdc:mga0yw44_31120_c1 | |||
| 1087 | nmdc:mga0yw44_76209_c1 | |||
| 1088 | nmdc:mga06z11_276776_c1 | |||
| 1089 | nmdc:mga05p37_587_c1 | |||
| 1090 | nmdc:mga0qj67_51973_c1 | |||
| 1091 | nmdc:mga06r32_2134_c1 | |||
| 1092 | nmdc:mga06r32_9319_c1 | |||
| 1093 | nmdc:mga08y16_26570_c1 | |||
| 1094 | Ga0495601_0014317 | |||
| 1095 | Ga0495601_0244118 | |||
| 1096 | Ga0495612_0043046 | |||
| 1097 | Ga0495595_0085217 | |||
| 1098 | Ga0495619_0023731 | |||
| 1099 | Ga0495619_0233661 | |||
| 1100 | Ga0500644_0048433 | |||
| 1101 | Ga0500556_0002046 | |||
| 1102 | Ga0500593_000063 | |||
| 1103 | Ga0500573_0037711 | |||
| 1104 | Ga0500630_051617 | |||
| 1105 | Ga0500611_065003 | |||
| 1106 | Ga0501084_0097277 | |||
| 1107 | Ga0501084_0112803 | |||
| 1108 | Ga0501082_0054898 | |||
| 1109 | Ga0501082_0087222 | |||
| 1110 | Ga0501082_0341478 | |||
| 1111 | Ga0466962_0119680 | |||
| 1112 | Ga0466962_0222756 | |||
| 1113 | Ga0530510_0065309 | |||
| 1114 | Ga0530510_0467407 | |||
| 1115 | 2515851018 | |||
| 1116 | 2643825801 | |||
| 1117 | 2644093831 | |||
| 1118 | 2644230180 | |||
| 1119 | 2644323675 | |||
| 1120 | 2644531793 | |||
| 1121 | 2676474885 | |||
| 1122 | 2740169157 | |||
| 1123 | 2753267452 | |||
| 1124 | 2827630947 | |||
| 1125 | 2832007231 | |||
| 1126 | 2839989641 | |||
| 1127 | 2866066764 | |||
| 1128 | 2887447350 | |||
| 1129 | 2929225443 | |||
| 1130 | 2932432289 | |||
| 1131 | 8003863236 | |||
| 1132 | 8054611009 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lhu-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.9763 | 21 | 225 |
| 7lhs-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.9725 | 21 | 226 |
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.9692 | 21 | 226 |
| 7lhu-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.9661 | 21 | 226 |
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.96 | 21 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIK3_10_254_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8954 | 23 | 248 | 3.40.50.620 |
| af_P17854_2_216_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8828 | 18 | 218 | 3.40.50.620 |
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.856 | 29 | 236 | 3.40.50.620 |
| 2oq2D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8455 | 26 | 238 | 3.40.50.620 |
| af_P9WIK3_10_254_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8259 | 23 | 248 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2LX36-F1-model_v4 | Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) | 0.9932 | 20 | 220 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A6B3GXH0-F1-model_v4 | Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) | 0.9878 | 21 | 190 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-X8AR96-F1-model_v4 | Phosphoadenosine phosphosulfate reductase family protein | 0.978 | 57 | 143 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A2S8MBC0-F1-model_v4 | deleted | 0.9727 | 25 | 163 |
|
| AF-A0A7X7V8U6-F1-model_v4 | Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) | 0.9715 | 20 | 205 |
GO:0004604
GO:0005737 GO:0019379 |