F464381

General Info

Members Datasets Scaffolds Average Seq Length
566 279 1132 248

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10452438|Ga0105243_104524382
Length 278
Sequence MQVLPAGLQAQHDRPAAAPDDHAHHPDGDVAMTARNTLDARARRGSETAGRDTAELREIVSHVGAELELAPAEDIIEWAVATFGERFCVTSSMSDAVLSHLASRVAPGVDVLFLDTGYHFAETIGTRDAVEATLPVNLVNVTPEQSVAEQDATHGKDLYKTDPDLCCALRKVAPLKNTLEQYDAWATGLRRAETHDRIIAPVIGWDARKGKVKVSPLARWSDEQVERYIEDNNVLVNPLVYDGYPSIGCWPCTRRVAPGDDPRSGRWAGTSKTECGIH

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
257 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
263 2643221561 Nocardioides sp. Root151 Isolate Unclassified
264 2643221615 Nocardioides sp. Root224 Isolate Unclassified
265 2643221641 Nocardioides sp. Root122 Isolate Unclassified
266 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
267 2643221696 Nocardioides sp. Root140 Isolate Unclassified
268 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
269 2739367898 Nocardioides sp. CF479 Isolate Unclassified
270 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
271 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
272 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
273 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
274 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
275 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
276 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
277 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
278 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
279 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 1.94
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0.18
Rhizoplane 12.37
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10452438 3300009148 Bacteria 1205
2 JGI24740J21852_10007177 3300001979 Bacteria 4547
3 JGI24737J22298_10048814 3300001990 Bacteria 1288
4 JGI24743J22301_10010295 3300001991 Bacteria 1668
5 JGI24738J21930_10017265 3300002075 Bacteria 1518
6 JGI24749J21850_1015997 3300002076 Bacteria 1053
7 JGI24744J21845_10023770 3300002077 Bacteria 1200
8 JGI24742J22300_10024543 3300002244 Bacteria 1040
9 JGI25406J46586_10010340 3300003203 Bacteria 4142
10 Ga0007410J51695_1050572 3300003574 Bacteria 1372
11 Ga0007429J51699_1031552 3300003579 Bacteria 1782
12 Ga0032354_1014081 3300003693 Bacteria 2985
13 JGI25405J52794_10033831 3300003911 Bacteria 1067
14 Ga0070658_10223548 3300005327 Bacteria 1593
15 Ga0070658_10559495 3300005327 Bacteria 990
16 Ga0070683_100002939 3300005329 Bacteria 13656
17 Ga0070683_100029967 3300005329 Bacteria 4934
18 Ga0070683_100209014 3300005329 Bacteria 1854
19 Ga0070683_100252624 3300005329 Bacteria 1677
20 Ga0070683_100257571 3300005329 Bacteria 1660
21 Ga0068868_100095769 3300005338 Bacteria 2396
22 Ga0068868_100316056 3300005338 Bacteria 1329
23 Ga0068868_100464909 3300005338 Bacteria 1102
24 Ga0070660_100011196 3300005339 Bacteria 6365
25 Ga0070660_100015411 3300005339 Bacteria 5519
26 Ga0070689_100125879 3300005340 Bacteria 2050
27 Ga0070691_10051221 3300005341 Bacteria 1971
28 Ga0070687_100392046 3300005343 Bacteria 908
29 Ga0070692_10000366 3300005345 Bacteria 13286
30 Ga0070668_100025619 3300005347 Bacteria 4473
31 Ga0070668_100030666 3300005347 Bacteria 4089
32 Ga0070673_100482867 3300005364 Bacteria 1119
33 Ga0070688_100313828 3300005365 Bacteria 1137
34 Ga0070688_100349014 3300005365 Bacteria 1083
35 Ga0070659_100016127 3300005366 Bacteria 5606
36 Ga0070659_100165981 3300005366 Bacteria 1807
37 Ga0070659_100190391 3300005366 Bacteria 1686
38 Ga0070714_100069079 3300005435 Bacteria 3050
39 Ga0070701_10004012 3300005438 Bacteria 5897
40 Ga0070700_100001674 3300005441 Bacteria 11107
41 Ga0070700_100136924 3300005441 Bacteria 1659
42 Ga0070662_100126808 3300005457 Bacteria 1963
43 Ga0070685_10118537 3300005466 Bacteria 1641
44 Ga0070679_100029110 3300005530 Bacteria 5448
45 Ga0070679_100253193 3300005530 Bacteria 1717
46 Ga0070684_100012878 3300005535 Bacteria 6722
47 Ga0070684_100072397 3300005535 Bacteria 3034
48 Ga0070684_100159545 3300005535 Bacteria 2045
49 Ga0070684_100232881 3300005535 Bacteria 1682
50 Ga0068853_100032374 3300005539 Bacteria 4429
51 Ga0068853_100388134 3300005539 Bacteria 1305
52 Ga0070672_100015704 3300005543 Bacteria 5405
53 Ga0070686_100199900 3300005544 Bacteria 1432
54 Ga0070665_100004769 3300005548 Bacteria 14118
55 Ga0068855_100139509 3300005563 Bacteria 2765
56 Ga0068855_100650502 3300005563 Bacteria 1132
57 Ga0070664_100029424 3300005564 Bacteria 4579
58 Ga0068857_100080266 3300005577 Bacteria 2913
59 Ga0068856_100406588 3300005614 Bacteria 1381
60 Ga0070702_100044438 3300005615 Bacteria 2508
61 Ga0070702_100465739 3300005615 Bacteria 920
62 Ga0068852_100038082 3300005616 Bacteria 4038
63 Ga0068852_100139354 3300005616 Bacteria 2243
64 Ga0068864_100099470 3300005618 Bacteria 2576
65 Ga0068864_100278881 3300005618 Bacteria 1559
66 Ga0068864_100451991 3300005618 Bacteria 1229
67 Ga0068861_100090257 3300005719 Bacteria 2417
68 Ga0068861_100111515 3300005719 Bacteria 2192
69 Ga0068861_100139113 3300005719 Bacteria 1980
70 Ga0068870_10073141 3300005840 Bacteria 1875
71 Ga0068858_100108933 3300005842 Bacteria 2586
72 Ga0068858_100255908 3300005842 Bacteria 1664
73 Ga0068862_100191815 3300005844 Bacteria 1839
74 Ga0081455_10000201 3300005937 Bacteria 76008
75 Ga0081455_10016265 3300005937 Bacteria 7188
76 Ga0081538_10000202 3300005981 Bacteria 66057
77 Ga0081538_10016835 3300005981 Bacteria 5580
78 Ga0081540_1058173 3300005983 Bacteria 1864
79 Ga0081539_10000657 3300005985 Bacteria 69568
80 Ga0081539_10001605 3300005985 Bacteria 37235
81 Ga0081539_10007450 3300005985 Bacteria 9974
82 Ga0081539_10137822 3300005985 Bacteria 1189
83 Ga0075365_10061359 3300006038 Bacteria 2510
84 Ga0075365_10073422 3300006038 Bacteria 2306
85 Ga0075364_10131118 3300006051 Bacteria 1682
86 Ga0075362_10112195 3300006177 Bacteria 1284
87 Ga0068871_100599416 3300006358 Bacteria 1002
88 Ga0075428_100253241 3300006844 Bacteria 1897
89 Ga0075430_100052764 3300006846 Bacteria 3424
90 Ga0075430_100157888 3300006846 Bacteria 1888
91 Ga0075431_100000633 3300006847 Bacteria 29722
92 Ga0075429_100002893 3300006880 Bacteria 14553
93 Ga0075429_100357499 3300006880 Bacteria 1279
94 Ga0068865_100007627 3300006881 Bacteria 6663
95 Ga0068865_100184496 3300006881 Bacteria 1609
96 Ga0111539_10006814 3300009094 Bacteria 14693
97 Ga0111539_10537504 3300009094 Bacteria 1362
98 Ga0105245_10005963 3300009098 Bacteria 10705
99 Ga0105245_10016221 3300009098 Bacteria 6493
100 Ga0105245_10156114 3300009098 Bacteria 2161
101 Ga0105245_10549114 3300009098 Bacteria 1177
102 Ga0105243_10095608 3300009148 Bacteria 2456
103 Ga0105243_10339822 3300009148 Bacteria 1375
104 Ga0105243_10342216 3300009148 Bacteria 1370
105 Ga0105242_10227329 3300009176 Bacteria 1670
106 Ga0105242_10609561 3300009176 Bacteria 1056
107 Ga0105242_10611728 3300009176 Bacteria 1054
108 Ga0105248_10099777 3300009177 Bacteria 3272
109 Ga0105238_10228786 3300009551 Bacteria 1836
110 Ga0105249_10111868 3300009553 Bacteria 2582
111 Ga0105249_10271327 3300009553 Bacteria 1690
112 Ga0105249_10934341 3300009553 Bacteria 935
113 Ga0105239_10010142 3300010375 Bacteria 10556
114 Ga0105239_10010437 3300010375 Bacteria 10384
115 Ga0105246_10017507 3300011119 Bacteria 4555
116 Ga0157369_10288292 3300013105 Bacteria 1709
117 Ga0157369_10958315 3300013105 Bacteria 877
118 Ga0157378_10463112 3300013297 Bacteria 1260
119 Ga0163162_10035229 3300013306 Bacteria 4983
120 Ga0157372_10013423 3300013307 Bacteria 8750
121 Ga0157372_10080017 3300013307 Bacteria 3696
122 Ga0157372_10180534 3300013307 Bacteria 2443
123 Ga0157372_11024017 3300013307 Bacteria 956
124 Ga0157375_10014182 3300013308 Bacteria 7104
125 Ga0157375_10638113 3300013308 Bacteria 1222
126 Ga0163163_10039203 3300014325 Bacteria 4622
127 Ga0163163_10052315 3300014325 Bacteria 4029
128 Ga0163163_11228285 3300014325 Bacteria 812
129 Ga0157380_10017242 3300014326 Bacteria 5342
130 Ga0157380_10069207 3300014326 Bacteria 2847
131 Ga0182008_10100191 3300014497 Bacteria 1431
132 Ga0157379_10015241 3300014968 Bacteria 6742
133 Ga0157379_10196993 3300014968 Bacteria 1821
134 Ga0157376_10107287 3300014969 Bacteria 2451
135 Ga0206354_11370483 3300020081 Bacteria 1798
136 Ga0206353_11839692 3300020082 Bacteria 977
137 Ga0207688_10018348 3300025901 Bacteria 3808
138 Ga0207688_10316849 3300025901 Bacteria 956
139 Ga0207680_10364547 3300025903 Bacteria 1016
140 Ga0207647_10015351 3300025904 Bacteria 5252
141 Ga0207643_10110122 3300025908 Bacteria 1622
142 Ga0207643_10162349 3300025908 Bacteria 1345
143 Ga0207705_10027564 3300025909 Bacteria 4052
144 Ga0207705_10054693 3300025909 Bacteria 2877
145 Ga0207705_10234842 3300025909 Bacteria 1395
146 Ga0207657_10009770 3300025919 Bacteria 9617
147 Ga0207657_10057136 3300025919 Bacteria 3364
148 Ga0207657_10066565 3300025919 Bacteria 3066
149 Ga0207657_10286644 3300025919 Bacteria 1306
150 Ga0207649_10208671 3300025920 Bacteria 1384
151 Ga0207652_10017458 3300025921 Bacteria 5874
152 Ga0207652_10179821 3300025921 Bacteria 1900
153 Ga0207694_10223799 3300025924 Bacteria 1535
154 Ga0207687_10026584 3300025927 Bacteria 3876
155 Ga0207687_10047858 3300025927 Bacteria 2966
156 Ga0207687_10503331 3300025927 Bacteria 1011
157 Ga0207664_10059251 3300025929 Bacteria 3048
158 Ga0207664_10404744 3300025929 Bacteria 1214
159 Ga0207690_10037105 3300025932 Bacteria 3162
160 Ga0207690_10046215 3300025932 Bacteria 2882
161 Ga0207690_10137311 3300025932 Bacteria 1797
162 Ga0207706_10035180 3300025933 Bacteria 4455
163 Ga0207706_10569108 3300025933 Bacteria 975
164 Ga0207709_10194818 3300025935 Bacteria 1443
165 Ga0207709_10249441 3300025935 Bacteria 1296
166 Ga0207704_10049015 3300025938 Bacteria 2537
167 Ga0207704_10127695 3300025938 Bacteria 1754
168 Ga0207691_10005898 3300025940 Bacteria 11834
169 Ga0207711_10087923 3300025941 Bacteria 2727
170 Ga0207689_10589937 3300025942 Bacteria 934
171 Ga0207661_10043878 3300025944 Bacteria 3530
172 Ga0207661_10094918 3300025944 Bacteria 2492
173 Ga0207661_10114393 3300025944 Bacteria 2288
174 Ga0207661_10246726 3300025944 Bacteria 1586
175 Ga0207661_10412452 3300025944 Bacteria 1226
176 Ga0207679_10059548 3300025945 Bacteria 2834
177 Ga0207667_10138989 3300025949 Bacteria 2501
178 Ga0207668_10019851 3300025972 Bacteria 4258
179 Ga0207668_10634680 3300025972 Bacteria 933
180 Ga0207658_10038059 3300025986 Bacteria 3463
181 Ga0207658_10108266 3300025986 Bacteria 2192
182 Ga0207703_10179832 3300026035 Bacteria 1866
183 Ga0207639_10299293 3300026041 Bacteria 1421
184 Ga0207639_10371046 3300026041 Bacteria 1283
185 Ga0207639_10392199 3300026041 Bacteria 1249
186 Ga0207678_10036546 3300026067 Bacteria 4275
187 Ga0207708_10000665 3300026075 Bacteria 26355
188 Ga0207708_10039108 3300026075 Bacteria 3613
189 Ga0207702_10640511 3300026078 Bacteria 1045
190 Ga0207641_10108902 3300026088 Bacteria 2453
191 Ga0207676_10214687 3300026095 Bacteria 1709
192 Ga0207676_10218062 3300026095 Bacteria 1697
193 Ga0207676_10379252 3300026095 Bacteria 1316
194 Ga0207674_10094896 3300026116 Bacteria 2969
195 Ga0207674_10227181 3300026116 Bacteria 1814
196 Ga0207674_10703845 3300026116 Bacteria 975
197 Ga0207675_100001223 3300026118 Bacteria 25636
198 Ga0207675_100042973 3300026118 Bacteria 4220
199 Ga0207675_100119286 3300026118 Bacteria 2495
200 Ga0207683_10420025 3300026121 Bacteria 1232
201 Ga0207683_10425228 3300026121 Bacteria 1224
202 Ga0207698_10134091 3300026142 Bacteria 2121
203 Ga0207428_10010519 3300027907 Bacteria 8258
204 Ga0268266_10003110 3300028379 Bacteria 16907
205 Ga0268265_10059885 3300028380 Bacteria 2916
206 Ga0268265_10117951 3300028380 Bacteria 2181
207 Ga0307515_10000065 3300028794 Bacteria 244497
208 Ga0307515_10014064 3300028794 Bacteria 14888
209 Ga0307512_10004466 3300030522 Bacteria 15314
210 Ga0316178_1068862 3300030735 Bacteria 800
211 Ga0316181_1000190 3300030744 Bacteria 1922
212 Ga0307513_10011749 3300031456 Bacteria 10859
213 Ga0307513_10344459 3300031456 Bacteria 1240
214 Ga0307509_10031252 3300031507 Bacteria 5881
215 Ga0307509_10090165 3300031507 Bacteria 3142
216 Ga0307509_10191436 3300031507 Bacteria 1896
217 Ga0307408_100145853 3300031548 Bacteria 1863
218 Ga0307508_10000654 3300031616 Bacteria 41574
219 Ga0307508_10002351 3300031616 Bacteria 20026
220 Ga0307508_10116219 3300031616 Bacteria 2277
221 Ga0307508_10263109 3300031616 Bacteria 1319
222 Ga0307516_10004273 3300031730 Bacteria 17755
223 Ga0307516_10025318 3300031730 Bacteria 6044
224 Ga0307405_10013871 3300031731 Bacteria 4312
225 Ga0307405_10035933 3300031731 Bacteria 2964
226 Ga0307413_10127789 3300031824 Bacteria 1734
227 Ga0307410_10109444 3300031852 Bacteria 1997
228 Ga0307410_10163073 3300031852 Bacteria 1672
229 Ga0307410_10209493 3300031852 Bacteria 1493
230 Ga0307410_10456299 3300031852 Bacteria 1043
231 Ga0307406_10210086 3300031901 Bacteria 1439
232 Ga0307406_10367862 3300031901 Bacteria 1129
233 Ga0307406_10522283 3300031901 Bacteria 966
234 Ga0307407_10275992 3300031903 Bacteria 1162
235 Ga0307412_10248579 3300031911 Bacteria 1380
236 Ga0307409_100030350 3300031995 Bacteria 3882
237 Ga0307409_100128053 3300031995 Bacteria 2164
238 Ga0307409_100272737 3300031995 Bacteria 1559
239 Ga0307416_100010387 3300032002 Bacteria 6146
240 Ga0307416_100078566 3300032002 Bacteria 2777
241 Ga0307416_100360720 3300032002 Bacteria 1475
242 Ga0307414_10035449 3300032004 Bacteria 3321
243 Ga0307414_10189385 3300032004 Bacteria 1663
244 Ga0307414_10728125 3300032004 Bacteria 900
245 Ga0307411_10191191 3300032005 Bacteria 1563
246 Ga0307411_10570579 3300032005 Bacteria 968
247 Ga0307415_100019274 3300032126 Bacteria 4139
248 Ga0307415_100061384 3300032126 Bacteria 2602
249 Ga0307415_100129326 3300032126 Bacteria 1908
250 Ga0307415_100668497 3300032126 Bacteria 933
251 Ga0307415_100801169 3300032126 Bacteria 860
252 Ga0307507_10017573 3300033179 Bacteria 8206
253 Ga0307510_10094232 3300033180 Bacteria 2821
254 Ga0373951_0000058 3300035091 Bacteria 45018
255 Ga0373935_0028068 3300035692 Bacteria 3478
256 Ga0395899_0030500 3300037312 Bacteria 4055
257 Ga0395900_0024436 3300037418 Bacteria 6188
258 Ga0395900_0134564 3300037418 Bacteria 2532
259 Ga0395900_0733275 3300037418 Bacteria 920
260 Ga0395898_0037524 3300037466 Bacteria 4805
261 Ga0395898_0376428 3300037466 Bacteria 1354
262 Ga0395905_0693509 3300037471 Bacteria 921
263 Ga0436364_1072955 3300037853 Bacteria 1301
264 Ga0395901_0006468 3300038443 Bacteria 11866
265 Ga0395901_0037579 3300038443 Bacteria 5008
266 Ga0395901_0060266 3300038443 Bacteria 3949
267 Ga0436365_1732162 3300039437 Bacteria 984
268 Ga0451802_1964298 3300041460 Bacteria 856
269 Ga0451837_1015006 3300041494 Bacteria 2100
270 Ga0451853_1031450 3300041512 Bacteria 1727
271 Ga0439431_0000696 3300041997 Bacteria 7250
272 Ga0439442_005462 3300042002 Bacteria 2543
273 Ga0439432_033117 3300042006 Bacteria 1664
274 Ga0439463_056001 3300042016 Bacteria 1007
275 Ga0439434_0010402 3300042435 Bacteria 2742
276 Ga0466969_0028143 3300044656 Bacteria 2873
277 Ga0466972_0033953 3300044658 Bacteria 2502
278 Ga0466965_0035092 3300044683 Bacteria 2456
279 Ga0466965_0160072 3300044683 Bacteria 1180
280 Ga0466966_0060914 3300044684 Bacteria 2381
281 Ga0466961_0011167 3300044693 Bacteria 5741
282 Ga0466961_0029352 3300044693 Bacteria 3536
283 Ga0466961_0145725 3300044693 Bacteria 1481
284 Ga0466963_0039304 3300044694 Bacteria 3098
285 Ga0466963_0109086 3300044694 Bacteria 1899
286 Ga0466963_0123691 3300044694 Bacteria 1782
287 Ga0466963_0203052 3300044694 Bacteria 1386
288 Ga0466963_0269055 3300044694 Bacteria 1197
289 Ga0466963_0296224 3300044694 Bacteria 1137
290 Ga0466964_0158628 3300044706 Bacteria 1055
291 Ga0466971_0009597 3300044719 Bacteria 4224
292 Ga0466971_0050073 3300044719 Bacteria 1880
293 Ga0466970_0000861 3300044765 Bacteria 14638
294 Ga0466970_0018730 3300044765 Bacteria 3587
295 Ga0466957_0043551 3300044842 Bacteria 2718
296 Ga0466957_0162355 3300044842 Bacteria 1452
297 Ga0466960_0006956 3300044901 Bacteria 4566
298 Ga0466960_0009008 3300044901 Bacteria 4104
299 Ga0466960_0032004 3300044901 Bacteria 2431
300 Ga0466960_0051867 3300044901 Bacteria 1983
301 Ga0466960_0173985 3300044901 Bacteria 1163
302 Ga0466959_0054349 3300045049 Bacteria 2926
303 Ga0466958_0073189 3300045836 Bacteria 2099
304 Ga0466958_0157529 3300045836 Bacteria 1433
305 Ga0466958_0385498 3300045836 Bacteria 904
306 Ga0466967_0043575 3300045976 Bacteria 3886
307 Ga0466967_0066736 3300045976 Bacteria 3207
308 Ga0466967_0094077 3300045976 Bacteria 2728
309 Ga0466967_0102204 3300045976 Bacteria 2622
310 Ga0466967_0389409 3300045976 Bacteria 1354
311 Ga0466967_0604430 3300045976 Bacteria 1082
312 Ga0495592_0000516 3300046454 Bacteria 27942
313 Ga0495603_0067680 3300046455 Bacteria 2102
314 Ga0495629_0020867 3300046459 Bacteria 4676
315 Ga0495629_0385210 3300046459 Bacteria 954
316 Ga0495653_0457835 3300046463 Bacteria 801
317 Ga0495582_0040249 3300046473 Bacteria 2574
318 Ga0495620_0056865 3300046515 Bacteria 1644
319 Ga0495628_0020537 3300046516 Bacteria 5445
320 Ga0495652_0008753 3300046529 Bacteria 9212
321 Ga0495640_0023258 3300046533 Bacteria 4519
322 Ga0495667_0155556 3300046559 Bacteria 1471
323 Ga0495634_0023404 3300046642 Bacteria 4342
324 Ga0495657_0022501 3300046675 Bacteria 4513
325 Ga0495624_0071845 3300046690 Bacteria 2153
326 Ga0495600_0145007 3300046809 Bacteria 1539
327 Ga0495581_0200562 3300047315 Bacteria 1167
328 Ga0495676_0056919 3300047321 Bacteria 3088
329 Ga0495675_0015131 3300047444 Bacteria 4877
330 Ga0496100_0079369 3300048903 Bacteria 2211
331 Ga0496101_0031435 3300048904 Bacteria 3732
332 Ga0496101_0060301 3300048904 Bacteria 2752
333 Ga0496101_0132808 3300048904 Bacteria 1892
334 Ga0496101_0313508 3300048904 Bacteria 1230
335 Ga0496102_0020692 3300048905 Bacteria 5814
336 Ga0496102_0070025 3300048905 Bacteria 3220
337 Ga0496102_0077245 3300048905 Bacteria 3064
338 Ga0496102_0120231 3300048905 Bacteria 2453
339 Ga0496102_0203791 3300048905 Bacteria 1865
340 Ga0496102_0298658 3300048905 Bacteria 1518
341 Ga0496102_0517921 3300048905 Bacteria 1115
342 Ga0496102_0607728 3300048905 Bacteria 1016
343 Ga0496103_0023705 3300048906 Bacteria 3702
344 Ga0496103_0044229 3300048906 Bacteria 2743
345 Ga0496103_0211208 3300048906 Bacteria 1248
346 Ga0496103_0397813 3300048906 Bacteria 885
347 Ga0496104_0219872 3300048907 Bacteria 1812
348 Ga0496104_0320088 3300048907 Bacteria 1464
349 Ga0496105_0000548 3300048908 Bacteria 24761
350 Ga0496106_0127307 3300048909 Bacteria 1995
351 Ga0496106_0139977 3300048909 Bacteria 1903
352 Ga0496106_0577730 3300048909 Bacteria 901
353 Ga0496107_0008251 3300048910 Bacteria 7208
354 Ga0496107_0047472 3300048910 Bacteria 3092
355 Ga0496107_0105753 3300048910 Bacteria 2066
356 Ga0496107_0227622 3300048910 Bacteria 1387
357 Ga0496107_0283538 3300048910 Bacteria 1233
358 Ga0496107_0392398 3300048910 Bacteria 1032
359 Ga0496107_0397704 3300048910 Bacteria 1025
360 Ga0496108_0123457 3300048911 Bacteria 2222
361 Ga0496108_0381666 3300048911 Bacteria 1230
362 Ga0496108_0392354 3300048911 Bacteria 1212
363 Ga0496108_0562418 3300048911 Bacteria 994
364 Ga0496108_0630882 3300048911 Bacteria 932
365 Ga0496109_0012870 3300048912 Bacteria 7232
366 Ga0496109_0014289 3300048912 Bacteria 6909
367 Ga0496109_0051866 3300048912 Bacteria 3737
368 Ga0496109_0057924 3300048912 Bacteria 3538
369 Ga0496109_0060245 3300048912 Bacteria 3468
370 Ga0496109_0098749 3300048912 Bacteria 2707
371 Ga0496109_0218555 3300048912 Bacteria 1792
372 Ga0496109_0300850 3300048912 Bacteria 1513
373 Ga0496109_0490924 3300048912 Bacteria 1159
374 Ga0496110_0004402 3300048913 Bacteria 10909
375 Ga0496110_0009941 3300048913 Bacteria 7714
376 Ga0496110_0022555 3300048913 Bacteria 5346
377 Ga0496110_0260939 3300048913 Bacteria 1577
378 Ga0496110_0278058 3300048913 Bacteria 1524
379 Ga0496110_0507430 3300048913 Bacteria 1098
380 Ga0496111_0009898 3300048914 Bacteria 6372
381 Ga0496111_0077527 3300048914 Bacteria 2423
382 Ga0496111_0085117 3300048914 Bacteria 2311
383 Ga0496111_0380178 3300048914 Bacteria 1044
384 Ga0496112_0209641 3300048915 Bacteria 1906
385 Ga0496113_0163563 3300048916 Bacteria 1760
386 Ga0496113_0175087 3300048916 Bacteria 1700
387 Ga0496113_0520932 3300048916 Bacteria 954
388 Ga0496114_0020780 3300048917 Bacteria 5329
389 Ga0496114_0035118 3300048917 Bacteria 4138
390 Ga0496114_0055159 3300048917 Bacteria 3314
391 Ga0496114_0072273 3300048917 Bacteria 2901
392 Ga0496114_0114475 3300048917 Bacteria 2313
393 Ga0496114_0142626 3300048917 Bacteria 2075
394 Ga0496114_0150917 3300048917 Bacteria 2016
395 Ga0496114_0308533 3300048917 Bacteria 1397
396 Ga0496115_0009116 3300048918 Bacteria 7364
397 Ga0496115_0061030 3300048918 Bacteria 3039
398 Ga0496115_0082940 3300048918 Bacteria 2613
399 Ga0496126_0032061 3300048929 Bacteria 4956
400 Ga0496126_0044983 3300048929 Bacteria 4060
401 Ga0496126_0466018 3300048929 Bacteria 1015
402 Ga0501311_000356 3300049527 Bacteria 3040
403 Ga0501311_029538 3300049527 Bacteria 787
404 Ga0501313_007561 3300049529 Bacteria 1199
405 Ga0501317_005160 3300049533 Bacteria 1390
406 Ga0501318_003461 3300049534 Bacteria 1447
407 Ga0501320_007353 3300049536 Bacteria 1057
408 Ga0501031_0021165 3300049568 Bacteria 4241
409 Ga0501031_0066688 3300049568 Bacteria 2345
410 Ga0501031_0078482 3300049568 Bacteria 2151
411 Ga0501031_0091871 3300049568 Bacteria 1980
412 Ga0501031_0173217 3300049568 Bacteria 1410
413 Ga0501032_0121013 3300049569 Bacteria 1730
414 Ga0501032_0147500 3300049569 Bacteria 1548
415 Ga0501034_0050240 3300049571 Bacteria 4206
416 Ga0501034_0234971 3300049571 Bacteria 1781
417 Ga0501034_0603919 3300049571 Bacteria 1002
418 Ga0501036_0058092 3300049572 Bacteria 3277
419 Ga0501036_0064011 3300049572 Bacteria 3113
420 Ga0501036_0108857 3300049572 Bacteria 2342
421 Ga0501036_0154570 3300049572 Bacteria 1935
422 Ga0501036_0310080 3300049572 Bacteria 1319
423 Ga0501037_0105406 3300049573 Bacteria 2032
424 Ga0501037_0115997 3300049573 Bacteria 1927
425 Ga0501038_0017056 3300049574 Bacteria 6568
426 Ga0501038_0130670 3300049574 Bacteria 2062
427 Ga0501039_0044367 3300049575 Bacteria 3434
428 Ga0501039_0072032 3300049575 Bacteria 2686
429 Ga0501039_0075037 3300049575 Bacteria 2628
430 Ga0501039_0450861 3300049575 Bacteria 1010
431 Ga0501040_0022358 3300049576 Bacteria 4231
432 Ga0501040_0049525 3300049576 Bacteria 2872
433 Ga0501040_0056444 3300049576 Bacteria 2695
434 Ga0501040_0091831 3300049576 Bacteria 2111
435 Ga0501041_0023087 3300049577 Bacteria 3729
436 Ga0501041_0074050 3300049577 Bacteria 2092
437 Ga0501042_0005582 3300049578 Bacteria 8107
438 Ga0501043_0288993 3300049579 Bacteria 1255
439 Ga0501046_0123249 3300049580 Bacteria 1971
440 Ga0501046_0317573 3300049580 Bacteria 1135
441 Ga0501046_0352029 3300049580 Bacteria 1069
442 Ga0501047_0068498 3300049581 Bacteria 3418
443 Ga0501047_0218332 3300049581 Bacteria 1763
444 Ga0501047_0269172 3300049581 Bacteria 1550
445 Ga0501048_0248135 3300049582 Bacteria 1263
446 Ga0501048_0249590 3300049582 Bacteria 1259
447 Ga0501048_0264782 3300049582 Bacteria 1221
448 Ga0501067_0001257 3300049583 Bacteria 13778
449 Ga0501067_0005296 3300049583 Bacteria 7165
450 Ga0501067_0017223 3300049583 Bacteria 3994
451 Ga0501067_0024162 3300049583 Bacteria 3369
452 Ga0501067_0040603 3300049583 Bacteria 2584
453 Ga0501067_0234920 3300049583 Bacteria 1020
454 Ga0501067_0315136 3300049583 Bacteria 871
455 Ga0501068_0008131 3300049584 Bacteria 5825
456 Ga0501068_0008186 3300049584 Bacteria 5810
457 Ga0501068_0025962 3300049584 Bacteria 3448
458 Ga0501068_0049413 3300049584 Bacteria 2540
459 Ga0501069_0055567 3300049585 Bacteria 2206
460 Ga0501069_0091596 3300049585 Bacteria 1719
461 Ga0501069_0142606 3300049585 Bacteria 1374
462 Ga0501069_0198388 3300049585 Bacteria 1162
463 Ga0501069_0229232 3300049585 Bacteria 1081
464 Ga0501069_0294512 3300049585 Bacteria 951
465 Ga0501070_0002454 3300049586 Bacteria 16250
466 Ga0501070_0011989 3300049586 Bacteria 7315
467 Ga0501070_0040980 3300049586 Bacteria 3859
468 Ga0501070_0045578 3300049586 Bacteria 3647
469 Ga0501070_0047146 3300049586 Bacteria 3582
470 Ga0501070_0114279 3300049586 Bacteria 2230
471 Ga0501070_0124776 3300049586 Bacteria 2128
472 Ga0501070_0175935 3300049586 Bacteria 1762
473 Ga0501070_0201532 3300049586 Bacteria 1634
474 Ga0501070_0215243 3300049586 Bacteria 1576
475 Ga0501071_0004654 3300049587 Bacteria 8716
476 Ga0501071_0010875 3300049587 Bacteria 6106
477 Ga0501071_0156736 3300049587 Bacteria 1700
478 Ga0501072_0013538 3300049588 Bacteria 6242
479 Ga0501072_0054152 3300049588 Bacteria 3160
480 Ga0501072_0084522 3300049588 Bacteria 2516
481 Ga0501072_0126070 3300049588 Bacteria 2040
482 Ga0501072_0145802 3300049588 Bacteria 1887
483 Ga0501072_0224841 3300049588 Bacteria 1496
484 Ga0501073_0007125 3300049589 Bacteria 8329
485 Ga0501073_0010800 3300049589 Bacteria 6687
486 Ga0501074_0006288 3300049590 Bacteria 8576
487 Ga0501074_0010173 3300049590 Bacteria 6828
488 Ga0501074_0014523 3300049590 Bacteria 5730
489 Ga0501074_0015241 3300049590 Bacteria 5586
490 Ga0501075_0167009 3300049591 Bacteria 1679
491 Ga0501075_0234120 3300049591 Bacteria 1400
492 Ga0501076_0064120 3300049592 Bacteria 2928
493 Ga0501076_0065031 3300049592 Bacteria 2907
494 Ga0501076_0239111 3300049592 Bacteria 1485
495 Ga0501077_0008549 3300049593 Bacteria 6344
496 Ga0501077_0033631 3300049593 Bacteria 3262
497 Ga0501077_0145301 3300049593 Bacteria 1504
498 Ga0501079_0037036 3300049741 Bacteria 3758
499 Ga0501080_0008497 3300049742 Bacteria 9308
500 Ga0501080_0041440 3300049742 Bacteria 4290
501 Ga0501080_0080089 3300049742 Bacteria 3036
502 Ga0501080_0091949 3300049742 Bacteria 2818
503 Ga0501080_0136174 3300049742 Bacteria 2273
504 Ga0501083_0105391 3300049744 Bacteria 1856
505 Ga0501083_0114851 3300049744 Bacteria 1768
506 Ga0501035_0111053 3300049822 Bacteria 2403
507 Ga0501035_0522599 3300049822 Bacteria 975
508 Ga0501044_0013267 3300049823 Bacteria 8920
509 Ga0501044_0034452 3300049823 Bacteria 5309
510 Ga0501044_0173253 3300049823 Bacteria 2128
511 Ga0501044_0194159 3300049823 Bacteria 1991
512 Ga0501045_0011452 3300049824 Bacteria 6230
513 Ga0501045_0044889 3300049824 Bacteria 3219
514 Ga0501045_0055621 3300049824 Bacteria 2893
515 Ga0501045_0062164 3300049824 Bacteria 2740
516 Ga0501045_0347880 3300049824 Bacteria 1103
517 nmdc:mga00v17_93186_c1 3300050491 Bacteria 1894
518 nmdc:mga0yw44_112224_c1 3300050492 Bacteria 1748
519 nmdc:mga0yw44_112801_c1 3300050492 Bacteria 1744
520 nmdc:mga0yw44_31120_c1 3300050492 Bacteria 3100
521 nmdc:mga0yw44_76209_c1 3300050492 Bacteria 2093
522 nmdc:mga06z11_276776_c1 3300050494 Bacteria 993
523 nmdc:mga05p37_587_c1 3300050507 Bacteria 40013
524 nmdc:mga0qj67_51973_c1 3300050509 Bacteria 3242
525 nmdc:mga06r32_2134_c1 3300050510 Bacteria 17665
526 nmdc:mga06r32_9319_c1 3300050510 Bacteria 8851
527 nmdc:mga08y16_26570_c1 3300050511 Bacteria 6102
528 Ga0495601_0014317 3300053077 Bacteria 4778
529 Ga0495601_0244118 3300053077 Bacteria 1173
530 Ga0495612_0043046 3300053078 Bacteria 1844
531 Ga0495595_0085217 3300053084 Bacteria 1510
532 Ga0495619_0023731 3300053085 Bacteria 3932
533 Ga0495619_0233661 3300053085 Bacteria 1274
534 Ga0500644_0048433 3300053088 Bacteria 1446
535 Ga0500556_0002046 3300053104 Bacteria 6998
536 Ga0500593_000063 3300053117 Bacteria 39478
537 Ga0500573_0037711 3300053140 Bacteria 2793
538 Ga0500630_051617 3300053159 Bacteria 1986
539 Ga0500611_065003 3300053727 Bacteria 874
540 Ga0501084_0097277 3300054114 Bacteria 2471
541 Ga0501084_0112803 3300054114 Bacteria 2284
542 Ga0501082_0054898 3300060353 Bacteria 3433
543 Ga0501082_0087222 3300060353 Bacteria 2692
544 Ga0501082_0341478 3300060353 Bacteria 1305
545 Ga0466962_0119680 3300061719 Bacteria 1270
546 Ga0466962_0222756 3300061719 Bacteria 924
547 Ga0530510_0065309 3300061734 Bacteria 2637
548 Ga0530510_0467407 3300061734 Bacteria 955
549 2515851018 2515154155 Bacteria 7985436
550 2643825801 2643221561 Bacteria 4984412
551 2644093831 2643221615 Bacteria 5487866
552 2644230180 2643221641 Bacteria 4490190
553 2644323675 2643221657 Bacteria 5490246
554 2644531793 2643221696 Bacteria 5431823
555 2676474885 2675903058 Bacteria 6822861
556 2740169157 2739367898 Bacteria 4367674
557 2753267452 2751185782 Bacteria 11227053
558 2827630947 2827628540 Bacteria 6858585
559 2832007231 2832004796 Bacteria 6538017
560 2839989641 2839986021 Bacteria 3685650
561 2866066764 2866065130 Bacteria 6518152
562 2887447350 2887443736 Bacteria 4426037
563 2929225443 2929219909 Bacteria 6984360
564 2932432289 2932431166 Bacteria 4215299
565 8003863236 8003856774 Bacteria 7675274
566 8054611009 8054609563 Bacteria 5170090
567 Ga0105243_10452438
568 JGI24740J21852_10007177
569 JGI24737J22298_10048814
570 JGI24743J22301_10010295
571 JGI24738J21930_10017265
572 JGI24749J21850_1015997
573 JGI24744J21845_10023770
574 JGI24742J22300_10024543
575 JGI25406J46586_10010340
576 Ga0007410J51695_1050572
577 Ga0007429J51699_1031552
578 Ga0032354_1014081
579 JGI25405J52794_10033831
580 Ga0070658_10223548
581 Ga0070658_10559495
582 Ga0070683_100002939
583 Ga0070683_100029967
584 Ga0070683_100209014
585 Ga0070683_100252624
586 Ga0070683_100257571
587 Ga0068868_100095769
588 Ga0068868_100316056
589 Ga0068868_100464909
590 Ga0070660_100011196
591 Ga0070660_100015411
592 Ga0070689_100125879
593 Ga0070691_10051221
594 Ga0070687_100392046
595 Ga0070692_10000366
596 Ga0070668_100025619
597 Ga0070668_100030666
598 Ga0070673_100482867
599 Ga0070688_100313828
600 Ga0070688_100349014
601 Ga0070659_100016127
602 Ga0070659_100165981
603 Ga0070659_100190391
604 Ga0070714_100069079
605 Ga0070701_10004012
606 Ga0070700_100001674
607 Ga0070700_100136924
608 Ga0070662_100126808
609 Ga0070685_10118537
610 Ga0070679_100029110
611 Ga0070679_100253193
612 Ga0070684_100012878
613 Ga0070684_100072397
614 Ga0070684_100159545
615 Ga0070684_100232881
616 Ga0068853_100032374
617 Ga0068853_100388134
618 Ga0070672_100015704
619 Ga0070686_100199900
620 Ga0070665_100004769
621 Ga0068855_100139509
622 Ga0068855_100650502
623 Ga0070664_100029424
624 Ga0068857_100080266
625 Ga0068856_100406588
626 Ga0070702_100044438
627 Ga0070702_100465739
628 Ga0068852_100038082
629 Ga0068852_100139354
630 Ga0068864_100099470
631 Ga0068864_100278881
632 Ga0068864_100451991
633 Ga0068861_100090257
634 Ga0068861_100111515
635 Ga0068861_100139113
636 Ga0068870_10073141
637 Ga0068858_100108933
638 Ga0068858_100255908
639 Ga0068862_100191815
640 Ga0081455_10000201
641 Ga0081455_10016265
642 Ga0081538_10000202
643 Ga0081538_10016835
644 Ga0081540_1058173
645 Ga0081539_10000657
646 Ga0081539_10001605
647 Ga0081539_10007450
648 Ga0081539_10137822
649 Ga0075365_10061359
650 Ga0075365_10073422
651 Ga0075364_10131118
652 Ga0075362_10112195
653 Ga0068871_100599416
654 Ga0075428_100253241
655 Ga0075430_100052764
656 Ga0075430_100157888
657 Ga0075431_100000633
658 Ga0075429_100002893
659 Ga0075429_100357499
660 Ga0068865_100007627
661 Ga0068865_100184496
662 Ga0111539_10006814
663 Ga0111539_10537504
664 Ga0105245_10005963
665 Ga0105245_10016221
666 Ga0105245_10156114
667 Ga0105245_10549114
668 Ga0105243_10095608
669 Ga0105243_10339822
670 Ga0105243_10342216
671 Ga0105242_10227329
672 Ga0105242_10609561
673 Ga0105242_10611728
674 Ga0105248_10099777
675 Ga0105238_10228786
676 Ga0105249_10111868
677 Ga0105249_10271327
678 Ga0105249_10934341
679 Ga0105239_10010142
680 Ga0105239_10010437
681 Ga0105246_10017507
682 Ga0157369_10288292
683 Ga0157369_10958315
684 Ga0157378_10463112
685 Ga0163162_10035229
686 Ga0157372_10013423
687 Ga0157372_10080017
688 Ga0157372_10180534
689 Ga0157372_11024017
690 Ga0157375_10014182
691 Ga0157375_10638113
692 Ga0163163_10039203
693 Ga0163163_10052315
694 Ga0163163_11228285
695 Ga0157380_10017242
696 Ga0157380_10069207
697 Ga0182008_10100191
698 Ga0157379_10015241
699 Ga0157379_10196993
700 Ga0157376_10107287
701 Ga0206354_11370483
702 Ga0206353_11839692
703 Ga0207688_10018348
704 Ga0207688_10316849
705 Ga0207680_10364547
706 Ga0207647_10015351
707 Ga0207643_10110122
708 Ga0207643_10162349
709 Ga0207705_10027564
710 Ga0207705_10054693
711 Ga0207705_10234842
712 Ga0207657_10009770
713 Ga0207657_10057136
714 Ga0207657_10066565
715 Ga0207657_10286644
716 Ga0207649_10208671
717 Ga0207652_10017458
718 Ga0207652_10179821
719 Ga0207694_10223799
720 Ga0207687_10026584
721 Ga0207687_10047858
722 Ga0207687_10503331
723 Ga0207664_10059251
724 Ga0207664_10404744
725 Ga0207690_10037105
726 Ga0207690_10046215
727 Ga0207690_10137311
728 Ga0207706_10035180
729 Ga0207706_10569108
730 Ga0207709_10194818
731 Ga0207709_10249441
732 Ga0207704_10049015
733 Ga0207704_10127695
734 Ga0207691_10005898
735 Ga0207711_10087923
736 Ga0207689_10589937
737 Ga0207661_10043878
738 Ga0207661_10094918
739 Ga0207661_10114393
740 Ga0207661_10246726
741 Ga0207661_10412452
742 Ga0207679_10059548
743 Ga0207667_10138989
744 Ga0207668_10019851
745 Ga0207668_10634680
746 Ga0207658_10038059
747 Ga0207658_10108266
748 Ga0207703_10179832
749 Ga0207639_10299293
750 Ga0207639_10371046
751 Ga0207639_10392199
752 Ga0207678_10036546
753 Ga0207708_10000665
754 Ga0207708_10039108
755 Ga0207702_10640511
756 Ga0207641_10108902
757 Ga0207676_10214687
758 Ga0207676_10218062
759 Ga0207676_10379252
760 Ga0207674_10094896
761 Ga0207674_10227181
762 Ga0207674_10703845
763 Ga0207675_100001223
764 Ga0207675_100042973
765 Ga0207675_100119286
766 Ga0207683_10420025
767 Ga0207683_10425228
768 Ga0207698_10134091
769 Ga0207428_10010519
770 Ga0268266_10003110
771 Ga0268265_10059885
772 Ga0268265_10117951
773 Ga0307515_10000065
774 Ga0307515_10014064
775 Ga0307512_10004466
776 Ga0316178_1068862
777 Ga0316181_1000190
778 Ga0307513_10011749
779 Ga0307513_10344459
780 Ga0307509_10031252
781 Ga0307509_10090165
782 Ga0307509_10191436
783 Ga0307408_100145853
784 Ga0307508_10000654
785 Ga0307508_10002351
786 Ga0307508_10116219
787 Ga0307508_10263109
788 Ga0307516_10004273
789 Ga0307516_10025318
790 Ga0307405_10013871
791 Ga0307405_10035933
792 Ga0307413_10127789
793 Ga0307410_10109444
794 Ga0307410_10163073
795 Ga0307410_10209493
796 Ga0307410_10456299
797 Ga0307406_10210086
798 Ga0307406_10367862
799 Ga0307406_10522283
800 Ga0307407_10275992
801 Ga0307412_10248579
802 Ga0307409_100030350
803 Ga0307409_100128053
804 Ga0307409_100272737
805 Ga0307416_100010387
806 Ga0307416_100078566
807 Ga0307416_100360720
808 Ga0307414_10035449
809 Ga0307414_10189385
810 Ga0307414_10728125
811 Ga0307411_10191191
812 Ga0307411_10570579
813 Ga0307415_100019274
814 Ga0307415_100061384
815 Ga0307415_100129326
816 Ga0307415_100668497
817 Ga0307415_100801169
818 Ga0307507_10017573
819 Ga0307510_10094232
820 Ga0373951_0000058
821 Ga0373935_0028068
822 Ga0395899_0030500
823 Ga0395900_0024436
824 Ga0395900_0134564
825 Ga0395900_0733275
826 Ga0395898_0037524
827 Ga0395898_0376428
828 Ga0395905_0693509
829 Ga0436364_1072955
830 Ga0395901_0006468
831 Ga0395901_0037579
832 Ga0395901_0060266
833 Ga0436365_1732162
834 Ga0451802_1964298
835 Ga0451837_1015006
836 Ga0451853_1031450
837 Ga0439431_0000696
838 Ga0439442_005462
839 Ga0439432_033117
840 Ga0439463_056001
841 Ga0439434_0010402
842 Ga0466969_0028143
843 Ga0466972_0033953
844 Ga0466965_0035092
845 Ga0466965_0160072
846 Ga0466966_0060914
847 Ga0466961_0011167
848 Ga0466961_0029352
849 Ga0466961_0145725
850 Ga0466963_0039304
851 Ga0466963_0109086
852 Ga0466963_0123691
853 Ga0466963_0203052
854 Ga0466963_0269055
855 Ga0466963_0296224
856 Ga0466964_0158628
857 Ga0466971_0009597
858 Ga0466971_0050073
859 Ga0466970_0000861
860 Ga0466970_0018730
861 Ga0466957_0043551
862 Ga0466957_0162355
863 Ga0466960_0006956
864 Ga0466960_0009008
865 Ga0466960_0032004
866 Ga0466960_0051867
867 Ga0466960_0173985
868 Ga0466959_0054349
869 Ga0466958_0073189
870 Ga0466958_0157529
871 Ga0466958_0385498
872 Ga0466967_0043575
873 Ga0466967_0066736
874 Ga0466967_0094077
875 Ga0466967_0102204
876 Ga0466967_0389409
877 Ga0466967_0604430
878 Ga0495592_0000516
879 Ga0495603_0067680
880 Ga0495629_0020867
881 Ga0495629_0385210
882 Ga0495653_0457835
883 Ga0495582_0040249
884 Ga0495620_0056865
885 Ga0495628_0020537
886 Ga0495652_0008753
887 Ga0495640_0023258
888 Ga0495667_0155556
889 Ga0495634_0023404
890 Ga0495657_0022501
891 Ga0495624_0071845
892 Ga0495600_0145007
893 Ga0495581_0200562
894 Ga0495676_0056919
895 Ga0495675_0015131
896 Ga0496100_0079369
897 Ga0496101_0031435
898 Ga0496101_0060301
899 Ga0496101_0132808
900 Ga0496101_0313508
901 Ga0496102_0020692
902 Ga0496102_0070025
903 Ga0496102_0077245
904 Ga0496102_0120231
905 Ga0496102_0203791
906 Ga0496102_0298658
907 Ga0496102_0517921
908 Ga0496102_0607728
909 Ga0496103_0023705
910 Ga0496103_0044229
911 Ga0496103_0211208
912 Ga0496103_0397813
913 Ga0496104_0219872
914 Ga0496104_0320088
915 Ga0496105_0000548
916 Ga0496106_0127307
917 Ga0496106_0139977
918 Ga0496106_0577730
919 Ga0496107_0008251
920 Ga0496107_0047472
921 Ga0496107_0105753
922 Ga0496107_0227622
923 Ga0496107_0283538
924 Ga0496107_0392398
925 Ga0496107_0397704
926 Ga0496108_0123457
927 Ga0496108_0381666
928 Ga0496108_0392354
929 Ga0496108_0562418
930 Ga0496108_0630882
931 Ga0496109_0012870
932 Ga0496109_0014289
933 Ga0496109_0051866
934 Ga0496109_0057924
935 Ga0496109_0060245
936 Ga0496109_0098749
937 Ga0496109_0218555
938 Ga0496109_0300850
939 Ga0496109_0490924
940 Ga0496110_0004402
941 Ga0496110_0009941
942 Ga0496110_0022555
943 Ga0496110_0260939
944 Ga0496110_0278058
945 Ga0496110_0507430
946 Ga0496111_0009898
947 Ga0496111_0077527
948 Ga0496111_0085117
949 Ga0496111_0380178
950 Ga0496112_0209641
951 Ga0496113_0163563
952 Ga0496113_0175087
953 Ga0496113_0520932
954 Ga0496114_0020780
955 Ga0496114_0035118
956 Ga0496114_0055159
957 Ga0496114_0072273
958 Ga0496114_0114475
959 Ga0496114_0142626
960 Ga0496114_0150917
961 Ga0496114_0308533
962 Ga0496115_0009116
963 Ga0496115_0061030
964 Ga0496115_0082940
965 Ga0496126_0032061
966 Ga0496126_0044983
967 Ga0496126_0466018
968 Ga0501311_000356
969 Ga0501311_029538
970 Ga0501313_007561
971 Ga0501317_005160
972 Ga0501318_003461
973 Ga0501320_007353
974 Ga0501031_0021165
975 Ga0501031_0066688
976 Ga0501031_0078482
977 Ga0501031_0091871
978 Ga0501031_0173217
979 Ga0501032_0121013
980 Ga0501032_0147500
981 Ga0501034_0050240
982 Ga0501034_0234971
983 Ga0501034_0603919
984 Ga0501036_0058092
985 Ga0501036_0064011
986 Ga0501036_0108857
987 Ga0501036_0154570
988 Ga0501036_0310080
989 Ga0501037_0105406
990 Ga0501037_0115997
991 Ga0501038_0017056
992 Ga0501038_0130670
993 Ga0501039_0044367
994 Ga0501039_0072032
995 Ga0501039_0075037
996 Ga0501039_0450861
997 Ga0501040_0022358
998 Ga0501040_0049525
999 Ga0501040_0056444
1000 Ga0501040_0091831
1001 Ga0501041_0023087
1002 Ga0501041_0074050
1003 Ga0501042_0005582
1004 Ga0501043_0288993
1005 Ga0501046_0123249
1006 Ga0501046_0317573
1007 Ga0501046_0352029
1008 Ga0501047_0068498
1009 Ga0501047_0218332
1010 Ga0501047_0269172
1011 Ga0501048_0248135
1012 Ga0501048_0249590
1013 Ga0501048_0264782
1014 Ga0501067_0001257
1015 Ga0501067_0005296
1016 Ga0501067_0017223
1017 Ga0501067_0024162
1018 Ga0501067_0040603
1019 Ga0501067_0234920
1020 Ga0501067_0315136
1021 Ga0501068_0008131
1022 Ga0501068_0008186
1023 Ga0501068_0025962
1024 Ga0501068_0049413
1025 Ga0501069_0055567
1026 Ga0501069_0091596
1027 Ga0501069_0142606
1028 Ga0501069_0198388
1029 Ga0501069_0229232
1030 Ga0501069_0294512
1031 Ga0501070_0002454
1032 Ga0501070_0011989
1033 Ga0501070_0040980
1034 Ga0501070_0045578
1035 Ga0501070_0047146
1036 Ga0501070_0114279
1037 Ga0501070_0124776
1038 Ga0501070_0175935
1039 Ga0501070_0201532
1040 Ga0501070_0215243
1041 Ga0501071_0004654
1042 Ga0501071_0010875
1043 Ga0501071_0156736
1044 Ga0501072_0013538
1045 Ga0501072_0054152
1046 Ga0501072_0084522
1047 Ga0501072_0126070
1048 Ga0501072_0145802
1049 Ga0501072_0224841
1050 Ga0501073_0007125
1051 Ga0501073_0010800
1052 Ga0501074_0006288
1053 Ga0501074_0010173
1054 Ga0501074_0014523
1055 Ga0501074_0015241
1056 Ga0501075_0167009
1057 Ga0501075_0234120
1058 Ga0501076_0064120
1059 Ga0501076_0065031
1060 Ga0501076_0239111
1061 Ga0501077_0008549
1062 Ga0501077_0033631
1063 Ga0501077_0145301
1064 Ga0501079_0037036
1065 Ga0501080_0008497
1066 Ga0501080_0041440
1067 Ga0501080_0080089
1068 Ga0501080_0091949
1069 Ga0501080_0136174
1070 Ga0501083_0105391
1071 Ga0501083_0114851
1072 Ga0501035_0111053
1073 Ga0501035_0522599
1074 Ga0501044_0013267
1075 Ga0501044_0034452
1076 Ga0501044_0173253
1077 Ga0501044_0194159
1078 Ga0501045_0011452
1079 Ga0501045_0044889
1080 Ga0501045_0055621
1081 Ga0501045_0062164
1082 Ga0501045_0347880
1083 nmdc:mga00v17_93186_c1
1084 nmdc:mga0yw44_112224_c1
1085 nmdc:mga0yw44_112801_c1
1086 nmdc:mga0yw44_31120_c1
1087 nmdc:mga0yw44_76209_c1
1088 nmdc:mga06z11_276776_c1
1089 nmdc:mga05p37_587_c1
1090 nmdc:mga0qj67_51973_c1
1091 nmdc:mga06r32_2134_c1
1092 nmdc:mga06r32_9319_c1
1093 nmdc:mga08y16_26570_c1
1094 Ga0495601_0014317
1095 Ga0495601_0244118
1096 Ga0495612_0043046
1097 Ga0495595_0085217
1098 Ga0495619_0023731
1099 Ga0495619_0233661
1100 Ga0500644_0048433
1101 Ga0500556_0002046
1102 Ga0500593_000063
1103 Ga0500573_0037711
1104 Ga0500630_051617
1105 Ga0500611_065003
1106 Ga0501084_0097277
1107 Ga0501084_0112803
1108 Ga0501082_0054898
1109 Ga0501082_0087222
1110 Ga0501082_0341478
1111 Ga0466962_0119680
1112 Ga0466962_0222756
1113 Ga0530510_0065309
1114 Ga0530510_0467407
1115 2515851018
1116 2643825801
1117 2644093831
1118 2644230180
1119 2644323675
1120 2644531793
1121 2676474885
1122 2740169157
1123 2753267452
1124 2827630947
1125 2832007231
1126 2839989641
1127 2866066764
1128 2887447350
1129 2929225443
1130 2932432289
1131 8003863236
1132 8054611009

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

86

255

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9763 21 225
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9725 21 226
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9692 21 226
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9661 21 226
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.96 21 226
ID Description Score Start End Superfamily
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8954 23 248 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8828 18 218 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.856 29 236 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8455 26 238 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8259 23 248 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7K2LX36-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9932 20 220 GO:0004604
GO:0005737
GO:0019379
AF-A0A6B3GXH0-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9878 21 190 GO:0004604
GO:0005737
GO:0019379
AF-X8AR96-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.978 57 143 GO:0004604
GO:0005737
GO:0019379
AF-A0A2S8MBC0-F1-model_v4 deleted 0.9727 25 163
AF-A0A7X7V8U6-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9715 20 205 GO:0004604
GO:0005737
GO:0019379

Map