F464339

General Info

Members Datasets Scaffolds Average Seq Length
566 351 485 326

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10035550|rootH1_100355501
Length 351
Sequence MDWFTDLFAQAQQALFESVIQPIVFHLGYGNLLEDAFDATGWLLVGLIQIVVMLAVIGSLQRWRPAEAVTDRQAIRVDIVYTLIQRLGVFRLAMFFSLDPVVDGLVGEMRMLGLPSFQLDAIWPGVTDQAWVSFVLYLVAFDLLQYWLHRAQHSWHWWWALHALHHSQRQMTMWSDSRNHLLDDLLIDSAVALTAVLIGVGPGQFVALVAISQLLENLQHANLRLSFGAIGERLLVSPRFHRLHHSIGIGHEGFGRGTLGGHNFAVMLPIWDVLFRTANFEDRWDPTGVRDQLPEEGGRDYGRGFWAQQWLGLKRLAGRDKIAAAPGSGSLPPGGATMDIAGQAPAGGNQG

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
12 2643221569 Achromobacter sp. Root565 Isolate Unclassified
13 2643221594 Achromobacter sp. Root170 Isolate Unclassified
14 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2643221672 Variovorax sp. Root434 Isolate Unclassified
20 2643221683 Variovorax sp. Root473 Isolate Unclassified
21 2738541277 Variovorax sp. GV051 Isolate Unclassified
22 2738541307 Variovorax sp. GV008 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
25 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
26 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
27 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
28 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
29 2818991436 Collimonas arenae 515 Isolate Unclassified
30 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
31 2818991446 Variovorax sp. 1180 Isolate Unclassified
32 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
33 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
34 2831864461 Roseateles noduli HZ7 Isolate Nodule
35 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
36 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
37 2842677519 Variovorax sp. R-72495 Isolate Unclassified
38 2842733646 Variovorax sp. R-72446 Isolate Unclassified
39 2842747753 Variovorax sp. R-72060 Isolate Unclassified
40 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
41 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
42 2858950400 Achromobacter sp. K91 Isolate Unclassified
43 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
44 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
45 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
46 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
47 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
48 2885198086 Variovorax sp. 679 Isolate Unclassified
49 2885211737 Variovorax sp. 553 Isolate Unclassified
50 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
51 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
52 2899924645 Variovorax sp. 369 Isolate Unclassified
53 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
54 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
55 2904456579 Variovorax sp. 2002 Isolate Unclassified
56 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
57 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
58 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
59 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
60 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
61 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
62 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
63 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
64 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
65 2928037797 Variovorax sp. 1126 Isolate Unclassified
66 2928044640 Variovorax sp. 1128 Isolate Unclassified
67 2928051484 Variovorax sp. 1133 Isolate Unclassified
68 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
69 2928070936 Variovorax gossypii 1167 Isolate Unclassified
70 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
71 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
72 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
73 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
74 2929520902 Variovorax beijingensis 502 Isolate Unclassified
75 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
76 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
77 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
78 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
79 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
80 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
81 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
82 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
83 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
84 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
85 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
86 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
87 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
88 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
91 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
92 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
93 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
94 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
95 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
102 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
103 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
104 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
105 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
106 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
107 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
108 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
109 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
110 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
111 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
112 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
113 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
114 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
115 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
116 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
117 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
118 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
119 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
124 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
131 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
132 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
133 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
141 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
142 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
164 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
168 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
177 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
181 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
182 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
219 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
220 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
237 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
238 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
239 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
246 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
247 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
248 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
249 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
250 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
251 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
271 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
335 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
339 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
341 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
342 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.34
Metatranscriptomes 0.18
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.39
Nodule 1.94
Rhizoplane 3.53
Rhizosphere 40.46
Stem 0
Stem Tuber 0
Unclassified 20.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000126 3300002704 Bacteria 37345
2 JGI25155J39150_1000177 3300002704 Bacteria 27568
3 JGI25156J39149_1000057 3300002705 Bacteria 86392
4 JGI25156J39149_1006062 3300002705 Bacteria 3363
5 JGI25162J39368_1000052 3300002737 Bacteria 152144
6 JGI25154J39366_1000087 3300002738 Bacteria 86392
7 JGI25154J39366_1000206 3300002738 Bacteria 42302
8 JGI25158J39367_1005046 3300002739 Bacteria 1952
9 JGI25157J39369_1000156 3300002741 Bacteria 56715
10 JGI25152J39213_1003884 3300002773 Bacteria 4914
11 JGI25152J39213_1009188 3300002773 Bacteria 2369
12 JGI25159J45721_1006323 3300002987 Bacteria 3565
13 JGI25151J46595_10004233 3300003187 Bacteria 7633
14 JGI25151J46595_10010350 3300003187 Bacteria 4346
15 JGI25151J46595_10022003 3300003187 Bacteria 2655
16 JGI25165J46597_1000105 3300003214 Bacteria 152144
17 JGI25153J46596_10018916 3300003215 Bacteria 2655
18 rootH1_10035550 3300003316 Bacteria 3538
19 rootH2_10065870 3300003320 Bacteria 1743
20 rootL2_10002813 3300003322 Bacteria 19046
21 rootL2_10055286 3300003322 Bacteria 1361
22 rootH1_10012523 3300003316 Bacteria 19300
23 rootH1_10012523 3300003323 Bacteria 7871
24 rootH1_10045942 3300003323 Bacteria 2423
25 rootH1_10074545 3300003323 Bacteria 4047
26 JGI25160J50197_1006552 3300003354 Bacteria 4697
27 JGI25161J50226_1004315 3300003374 Bacteria 3005
28 Ga0006562J51391_1028493 3300003578 Bacteria 8120
29 Ga0055538_1000043 3300003751 Bacteria 152144
30 Ga0055538_1000045 3300003751 Bacteria 139066
31 Ga0055539_1000057 3300003752 Bacteria 152144
32 Ga0055539_1000064 3300003752 Bacteria 139066
33 Ga0055533_1000071 3300003756 Bacteria 152144
34 Ga0055533_1000074 3300003756 Bacteria 139066
35 Ga0055532_1000016 3300003758 Bacteria 327509
36 Ga0055525_1000085 3300003759 Bacteria 152144
37 Ga0055525_1000092 3300003759 Bacteria 139066
38 Ga0055535_1000086 3300003761 Bacteria 104327
39 Ga0055542_1000009 3300003762 Bacteria 416550
40 Ga0055526_1001717 3300003771 Bacteria 15247
41 Ga0055537_1001318 3300003773 Bacteria 10151
42 Ga0055524_1000755 3300003775 Bacteria 21925
43 Ga0055536_1007090 3300003781 Bacteria 5086
44 Ga0055536_1013053 3300003781 Bacteria 3028
45 Ga0055536_1016192 3300003781 Bacteria 2505
46 Ga0055534_1000440 3300003784 Bacteria 24514
47 Ga0055534_1001277 3300003784 Bacteria 10222
48 Ga0055534_1001930 3300003784 Bacteria 7618
49 Ga0055528_1002574 3300003790 Bacteria 9607
50 Ga0055528_1005974 3300003790 Bacteria 5576
51 Ga0055530_10001144 3300003791 Bacteria 20648
52 Ga0055530_10006393 3300003791 Bacteria 5278
53 Ga0055540_1004372 3300003792 Bacteria 6407
54 Ga0055540_1004891 3300003792 Bacteria 5855
55 Ga0055540_1005964 3300003792 Bacteria 4952
56 Ga0055540_1011653 3300003792 Bacteria 2815
57 Ga0055531_10007619 3300003794 Bacteria 5865
58 Ga0055531_10007699 3300003794 Bacteria 5821
59 Ga0055531_10020389 3300003794 Bacteria 2624
60 Ga0055541_1000044 3300003841 Bacteria 152144
61 Ga0055541_1000046 3300003841 Bacteria 139066
62 Ga0055543_1006494 3300004625 Bacteria 2819
63 Ga0065165_1000354 3300005262 Bacteria 75337
64 Ga0065165_1000431 3300005262 Bacteria 65970
65 Ga0065714_10076198 3300005288 Bacteria 2818
66 Ga0070661_100330999 3300005344 Bacteria 1191
67 Ga0070675_100266576 3300005354 Bacteria 1502
68 Ga0070659_100125899 3300005366 Bacteria 2078
69 Ga0070667_100138569 3300005367 Bacteria 2129
70 Ga0070667_100218220 3300005367 Bacteria 1697
71 Ga0068853_100120219 3300005539 Bacteria 2342
72 Ga0070672_100146962 3300005543 Bacteria 1948
73 Ga0070665_100094358 3300005548 Bacteria 2997
74 Ga0068855_100000072 3300005563 Bacteria 121486
75 Ga0068855_100103100 3300005563 Bacteria 3283
76 Ga0070664_100008585 3300005564 Bacteria 8265
77 Ga0068857_100074832 3300005577 Bacteria 3019
78 Ga0068857_100250662 3300005577 Bacteria 1623
79 Ga0068854_100001277 3300005578 Bacteria 15138
80 Ga0068854_100112726 3300005578 Bacteria 2053
81 Ga0068852_100206566 3300005616 Bacteria 1861
82 Ga0068852_100400582 3300005616 Bacteria 1350
83 Ga0075365_10003506 3300006038 Bacteria 8109
84 Ga0075365_10056750 3300006038 Bacteria 2604
85 Ga0075368_10052364 3300006042 Bacteria 1624
86 Ga0075363_100005424 3300006048 Bacteria 5668
87 Ga0075363_100006287 3300006048 Bacteria 5379
88 Ga0075363_100071018 3300006048 Bacteria 1892
89 Ga0075364_10090964 3300006051 Bacteria 2024
90 Ga0075364_10291739 3300006051 Bacteria 1110
91 Ga0070712_100003224 3300006175 Bacteria 10054
92 Ga0075362_10002649 3300006177 Bacteria 6073
93 Ga0075362_10048373 3300006177 Bacteria 1897
94 Ga0075362_10071953 3300006177 Bacteria 1581
95 Ga0075362_10090791 3300006177 Bacteria 1418
96 Ga0075362_10134041 3300006177 Bacteria 1180
97 Ga0075367_10007008 3300006178 Bacteria 5742
98 Ga0075367_10086973 3300006178 Bacteria 1898
99 Ga0075366_10000846 3300006195 Bacteria 14740
100 Ga0075366_10023610 3300006195 Bacteria 3584
101 Ga0075366_10185927 3300006195 Bacteria 1262
102 Ga0075370_10000611 3300006353 Bacteria 13819
103 Ga0075370_10001545 3300006353 Bacteria 10070
104 Ga0075370_10013714 3300006353 Bacteria 4313
105 Ga0075370_10013900 3300006353 Bacteria 4285
106 Ga0075370_10016385 3300006353 Bacteria 3988
107 Ga0075370_10120476 3300006353 Bacteria 1527
108 Ga0075370_10170337 3300006353 Bacteria 1280
109 Ga0099823_1029870 3300006944 Bacteria 4595
110 Ga0079104_1030289 3300006946 Bacteria 1353
111 Ga0099826_10036324 3300006948 Bacteria 3489
112 Ga0099826_10039119 3300006948 Bacteria 3322
113 Ga0105244_10009292 3300009036 Bacteria 6059
114 Ga0105240_10000569 3300009093 Bacteria 68389
115 Ga0105240_10583770 3300009093 Bacteria 1232
116 Ga0105243_10001422 3300009148 Bacteria 21125
117 Ga0105243_10007750 3300009148 Bacteria 8257
118 Ga0105241_10101110 3300009174 Bacteria 2292
119 Ga0105242_10046905 3300009176 Bacteria 3507
120 Ga0105237_10008022 3300009545 Bacteria 11490
121 Ga0105237_10059955 3300009545 Bacteria 3807
122 Ga0105237_10265047 3300009545 Bacteria 1721
123 Ga0105238_10000318 3300009551 Bacteria 52620
124 Ga0105238_10062715 3300009551 Bacteria 3717
125 Ga0105239_10026228 3300010375 Bacteria 6414
126 Ga0105239_10194962 3300010375 Bacteria 2268
127 Ga0105246_10041769 3300011119 Bacteria 3102
128 Ga0157319_1000017 3300012497 Bacteria 110340
129 Ga0157373_10006156 3300013100 Bacteria 8971
130 Ga0157373_10076719 3300013100 Bacteria 2358
131 Ga0157371_10039685 3300013102 Bacteria 3366
132 Ga0157370_10045256 3300013104 Bacteria 4223
133 Ga0157369_10063158 3300013105 Bacteria 3990
134 Ga0157372_10161322 3300013307 Bacteria 2591
135 Ga0163163_10009104 3300014325 Bacteria 8847
136 Ga0182008_10005016 3300014497 Bacteria 7616
137 Ga0182008_10007288 3300014497 Bacteria 6116
138 Ga0182008_10037413 3300014497 Bacteria 2427
139 Ga0157379_10001985 3300014968 Bacteria 16922
140 Ga0182006_1005603 3300015261 Bacteria 5959
141 Ga0182006_1065838 3300015261 Bacteria 1356
142 Ga0182007_10001722 3300015262 Bacteria 11538
143 Ga0182007_10001954 3300015262 Bacteria 10660
144 Ga0182007_10007332 3300015262 Bacteria 4633
145 Ga0182005_1000365 3300015265 Bacteria 25241
146 Ga0183362_10003 3300015683 Bacteria 977584
147 Ga0163161_10000803 3300017792 Bacteria 24579
148 Ga0163161_10010378 3300017792 Bacteria 6449
149 Ga0163161_10035475 3300017792 Bacteria 3570
150 Ga0163161_10070642 3300017792 Bacteria 2553
151 Ga0163161_10199985 3300017792 Bacteria 1540
152 Ga0213872_10000034 3300021361 Bacteria 133158
153 Ga0213872_10008332 3300021361 Bacteria 5022
154 Ga0209435_100016 3300025206 Bacteria 305566
155 Ga0209435_100038 3300025206 Bacteria 120273
156 Ga0209435_100856 3300025206 Bacteria 4722
157 Ga0209784_100002 3300025224 Bacteria 1753105
158 Ga0209784_100069 3300025224 Bacteria 152424
159 Ga0209566_100003 3300025225 Bacteria 1753105
160 Ga0209566_100083 3300025225 Bacteria 152424
161 Ga0209674_100004 3300025226 Bacteria 1753105
162 Ga0209674_100106 3300025226 Bacteria 152424
163 Ga0209147_100023 3300025229 Bacteria 437803
164 Ga0209147_102894 3300025229 Bacteria 3770
165 Ga0209563_100006 3300025230 Bacteria 1753105
166 Ga0209563_100100 3300025230 Bacteria 152424
167 Ga0207427_100279 3300025231 Bacteria 37306
168 Ga0209437_100156 3300025233 Bacteria 152424
169 Ga0209437_100166 3300025233 Bacteria 144787
170 Ga0209258_100009 3300025242 Bacteria 996276
171 Ga0209258_100368 3300025242 Bacteria 59722
172 Ga0209646_1000033 3300025246 Bacteria 369507
173 Ga0209646_1000093 3300025246 Bacteria 183840
174 Ga0209026_1000031 3300025250 Bacteria 325747
175 Ga0209026_1003457 3300025250 Bacteria 5164
176 Ga0209677_100003 3300025253 Bacteria 1753105
177 Ga0209677_100061 3300025253 Bacteria 152424
178 Ga0209148_1000007 3300025254 Bacteria 1592273
179 Ga0209759_1000045 3300025256 Bacteria 235654
180 Ga0209759_1000248 3300025256 Bacteria 80537
181 Ga0209129_1000013 3300025258 Bacteria 524874
182 Ga0209129_1005263 3300025258 Bacteria 4663
183 Ga0209129_1006522 3300025258 Bacteria 3743
184 Ga0209233_1000165 3300025261 Bacteria 152424
185 Ga0209565_1000058 3300025263 Bacteria 194126
186 Ga0209565_1001103 3300025263 Bacteria 13288
187 Ga0209565_1002218 3300025263 Bacteria 7267
188 Ga0209673_1000053 3300025273 Bacteria 279449
189 Ga0209673_1000648 3300025273 Bacteria 51507
190 Ga0209673_1002359 3300025273 Bacteria 13288
191 Ga0209673_1003441 3300025273 Bacteria 9331
192 Ga0209673_1003742 3300025273 Bacteria 8680
193 Ga0209130_1000230 3300025284 Bacteria 73335
194 Ga0209130_1000513 3300025284 Bacteria 39057
195 Ga0209675_1001191 3300025291 Bacteria 15776
196 Ga0209675_1001632 3300025291 Bacteria 12562
197 Ga0209675_1002205 3300025291 Bacteria 10208
198 Ga0209675_1002332 3300025291 Bacteria 9816
199 Ga0209676_1000004 3300025292 Bacteria 1138360
200 Ga0209676_1000368 3300025292 Bacteria 83764
201 Ga0209676_1000497 3300025292 Bacteria 63087
202 Ga0209676_1007221 3300025292 Bacteria 5284
203 Ga0209676_1009557 3300025292 Bacteria 4170
204 Ga0209025_1001889 3300025294 Bacteria 24471
205 Ga0209025_1002491 3300025294 Bacteria 19369
206 Ga0209025_1004165 3300025294 Bacteria 12806
207 Ga0209025_1009256 3300025294 Bacteria 6900
208 Ga0209025_1013248 3300025294 Bacteria 5201
209 Ga0209564_1000051 3300025295 Bacteria 357748
210 Ga0209564_1000214 3300025295 Bacteria 132937
211 Ga0209564_1000319 3300025295 Bacteria 93563
212 Ga0209758_1000067 3300025297 Bacteria 288575
213 Ga0209758_1005598 3300025297 Bacteria 9554
214 Ga0209050_1000002 3300025298 Bacteria 1792849
215 Ga0209050_1001264 3300025298 Bacteria 29155
216 Ga0209050_1003087 3300025298 Bacteria 12799
217 Ga0209050_1014864 3300025298 Bacteria 3317
218 Ga0209256_1000060 3300025299 Bacteria 262342
219 Ga0209256_1000166 3300025299 Bacteria 133549
220 Ga0209256_1000249 3300025299 Bacteria 95279
221 Ga0209256_1002607 3300025299 Bacteria 14284
222 Ga0209256_1038558 3300025299 Bacteria 1237
223 Ga0207426_1000100 3300025302 Bacteria 262342
224 Ga0207426_1000469 3300025302 Bacteria 62457
225 Ga0209051_1000002 3300025303 Bacteria 1631846
226 Ga0209051_1000240 3300025303 Bacteria 92221
227 Ga0209051_1000584 3300025303 Bacteria 43173
228 Ga0209051_1003160 3300025303 Bacteria 11050
229 Ga0209051_1003248 3300025303 Bacteria 10804
230 Ga0209257_1000002 3300025304 Bacteria 1767052
231 Ga0209257_1001174 3300025304 Bacteria 33130
232 Ga0209257_1002034 3300025304 Bacteria 21566
233 Ga0209257_1003692 3300025304 Bacteria 12746
234 Ga0209257_1011829 3300025304 Bacteria 4131
235 Ga0207656_10029113 3300025321 Bacteria 2272
236 Ga0207655_1012960 3300025728 Bacteria 4822
237 Ga0207682_10015262 3300025893 Bacteria 2989
238 Ga0207695_10004759 3300025913 Bacteria 18356
239 Ga0207695_10008793 3300025913 Bacteria 12589
240 Ga0207671_10030805 3300025914 Bacteria 3999
241 Ga0207693_10044719 3300025915 Bacteria 3480
242 Ga0207649_10278187 3300025920 Bacteria 1216
243 Ga0207681_10020395 3300025923 Bacteria 4200
244 Ga0207694_10003032 3300025924 Bacteria 13465
245 Ga0207694_10162275 3300025924 Bacteria 1806
246 Ga0207686_10172067 3300025934 Bacteria 1528
247 Ga0207709_10000589 3300025935 Bacteria 30358
248 Ga0207709_10000633 3300025935 Bacteria 28782
249 Ga0207711_10003782 3300025941 Bacteria 13027
250 Ga0207679_10008087 3300025945 Bacteria 6688
251 Ga0207667_10000055 3300025949 Bacteria 223770
252 Ga0207667_10133522 3300025949 Bacteria 2557
253 Ga0207658_10155507 3300025986 Bacteria 1868
254 Ga0207639_10014847 3300026041 Bacteria 5485
255 Ga0207674_10215183 3300026116 Bacteria 1870
256 Ga0207683_10030416 3300026121 Bacteria 4679
257 Ga0207698_10197962 3300026142 Bacteria 1796
258 Ga0207698_10315881 3300026142 Bacteria 1461
259 Ga0209389_1030170 3300027296 Bacteria 4581
260 Ga0209282_1000719 3300027666 Bacteria 16587
261 Ga0307515_10000487 3300028794 Bacteria 94783
262 Ga0307515_10054979 3300028794 Bacteria 5830
263 Ga0307515_10177942 3300028794 Bacteria 2090
264 Ga0314311_1178047 3300030733 Bacteria 4437
265 Ga0316183_1083828 3300030742 Bacteria 4072
266 Ga0316182_1000683 3300030745 Bacteria 3530
267 Ga0265331_10006808 3300031250 Bacteria 6695
268 Ga0265327_10000012 3300031251 Bacteria 530403
269 Ga0265327_10073313 3300031251 Bacteria 1708
270 Ga0265316_10000225 3300031344 Bacteria 65532
271 Ga0307509_10306189 3300031507 Bacteria 1334
272 Ga0307408_100011346 3300031548 Bacteria 5886
273 Ga0307408_100056343 3300031548 Bacteria 2850
274 Ga0307514_10001231 3300031649 Bacteria 33814
275 Ga0307514_10074985 3300031649 Bacteria 2524
276 Ga0307405_10011747 3300031731 Bacteria 4607
277 Ga0307405_10111340 3300031731 Bacteria 1855
278 Ga0307410_10379582 3300031852 Bacteria 1137
279 Ga0307406_10006477 3300031901 Bacteria 6467
280 Ga0307412_10000663 3300031911 Bacteria 19973
281 Ga0307412_10007893 3300031911 Bacteria 6062
282 Ga0307412_10008430 3300031911 Bacteria 5883
283 Ga0307412_10047588 3300031911 Bacteria 2817
284 Ga0307412_10061106 3300031911 Bacteria 2531
285 Ga0307416_100069235 3300032002 Bacteria 2919
286 Ga0307416_100118933 3300032002 Bacteria 2349
287 Ga0307414_10042711 3300032004 Bacteria 3082
288 Ga0307411_10149934 3300032005 Bacteria 1731
289 Ga0395905_0000455 3300037471 Bacteria 57161
290 Ga0436361_0254808 3300039447 Bacteria 14252
291 Ga0436361_0436689 3300039447 Bacteria 47478
292 Ga0436361_0767394 3300039447 Bacteria 56110
293 Ga0436361_0955311 3300039447 Bacteria 18858
294 Ga0439436_0006866 3300041404 Bacteria 3497
295 Ga0439436_0041546 3300041404 Bacteria 1316
296 Ga0439438_021887 3300041405 Bacteria 1779
297 Ga0439447_014866 3300041407 Bacteria 2172
298 Ga0439466_0003503 3300041411 Bacteria 6074
299 Ga0439466_0008567 3300041411 Bacteria 3854
300 Ga0439465_0001409 3300041413 Bacteria 7772
301 Ga0439431_0001296 3300041997 Bacteria 5499
302 Ga0439431_0004211 3300041997 Bacteria 3156
303 Ga0439431_0011614 3300041997 Bacteria 2014
304 Ga0439433_0000635 3300041999 Bacteria 6719
305 Ga0439442_001259 3300042002 Bacteria 5036
306 Ga0439442_002007 3300042002 Bacteria 4004
307 Ga0439445_0002064 3300042004 Bacteria 4441
308 Ga0439432_003666 3300042006 Bacteria 5679
309 Ga0439432_003984 3300042006 Bacteria 5425
310 Ga0439449_0000729 3300042007 Bacteria 12626
311 Ga0439449_0003132 3300042007 Bacteria 6437
312 Ga0439452_003831 3300042010 Bacteria 5165
313 Ga0439457_005060 3300042014 Bacteria 3360
314 Ga0439462_0001258 3300042015 Bacteria 5555
315 Ga0439462_0002443 3300042015 Bacteria 4316
316 Ga0450890_000849 3300042127 Bacteria 4398
317 Ga0450898_000672 3300042134 Bacteria 4119
318 Ga0439446_0004168 3300042156 Bacteria 3645
319 Ga0439446_0021143 3300042156 Bacteria 1838
320 Ga0450908_009618 3300042184 Bacteria 1793
321 Ga0439434_0002254 3300042435 Bacteria 5596
322 Ga0439434_0004921 3300042435 Bacteria 3905
323 Ga0450918_005117 3300042531 Bacteria 2362
324 Ga0451577_0007345 3300042876 Bacteria 10838
325 Ga0466969_0059020 3300044656 Bacteria 1866
326 Ga0466972_0000414 3300044658 Bacteria 22321
327 Ga0466977_0003004 3300044666 Bacteria 7969
328 Ga0453683_0001424 3300044673 Bacteria 20806
329 Ga0453684_0367405 3300044712 Bacteria 1618
330 Ga0451576_0001940 3300045051 Bacteria 33033
331 Ga0451576_0054907 3300045051 Bacteria 4169
332 Ga0451576_0220550 3300045051 Bacteria 1980
333 Ga0495627_021590 3300046453 Bacteria 2132
334 Ga0495627_025452 3300046453 Bacteria 1919
335 Ga0495592_0002730 3300046454 Bacteria 12500
336 Ga0495638_0030440 3300046460 Bacteria 3475
337 Ga0495651_0034068 3300046462 Bacteria 3970
338 Ga0495651_0044520 3300046462 Bacteria 3439
339 Ga0495653_0028155 3300046463 Bacteria 4495
340 Ga0495650_0010860 3300046471 Bacteria 5047
341 Ga0495608_0015808 3300046511 Bacteria 5224
342 Ga0495608_0018321 3300046511 Bacteria 4832
343 Ga0495610_0034596 3300046512 Bacteria 2601
344 Ga0495616_0015463 3300046513 Bacteria 4245
345 Ga0495620_0011223 3300046515 Bacteria 4683
346 Ga0495628_0002569 3300046516 Bacteria 16335
347 Ga0495628_0003270 3300046516 Bacteria 14508
348 Ga0495628_0259643 3300046516 Bacteria 1295
349 Ga0495631_0004099 3300046518 Bacteria 7825
350 Ga0495637_0010541 3300046520 Bacteria 4465
351 Ga0495652_0008564 3300046529 Bacteria 9329
352 Ga0495652_0037349 3300046529 Bacteria 4214
353 Ga0495609_0072151 3300046538 Bacteria 1516
354 Ga0495621_0007767 3300046539 Bacteria 3188
355 Ga0495645_0047656 3300046543 Bacteria 3122
356 Ga0495656_0001934 3300046615 Bacteria 6833
357 Ga0495656_0006748 3300046615 Bacteria 4033
358 Ga0495656_0012528 3300046615 Bacteria 3132
359 Ga0495656_0040336 3300046615 Bacteria 1945
360 Ga0495625_0001424 3300046660 Bacteria 29199
361 Ga0495625_0006576 3300046660 Bacteria 10315
362 Ga0495625_0108270 3300046660 Bacteria 1901
363 Ga0495635_0044392 3300046663 Bacteria 3067
364 Ga0495588_0023958 3300046674 Bacteria 3028
365 Ga0495599_0015872 3300046678 Bacteria 4675
366 Ga0495623_0037936 3300046679 Bacteria 3081
367 Ga0495646_0002878 3300046680 Bacteria 10659
368 Ga0495646_0010618 3300046680 Bacteria 5849
369 Ga0495646_0153573 3300046680 Bacteria 1279
370 Ga0495658_0007369 3300046683 Bacteria 5441
371 Ga0495624_0020311 3300046690 Bacteria 4424
372 Ga0495670_0004700 3300046691 Bacteria 6703
373 Ga0495671_0076529 3300046692 Bacteria 1641
374 Ga0495600_0001814 3300046809 Bacteria 11949
375 Ga0495604_0003896 3300047317 Bacteria 11883
376 Ga0495676_0007117 3300047321 Bacteria 10270
377 Ga0495685_004759 3300047447 Bacteria 4402
378 Ga0495593_0013090 3300047673 Bacteria 4736
379 Ga0495602_0196695 3300048088 Bacteria 1541
380 Ga0495614_0007704 3300048089 Bacteria 4783
381 Ga0495615_0004143 3300048090 Bacteria 2502
382 Ga0496101_0012475 3300048904 Bacteria 5671
383 Ga0496101_0357480 3300048904 Bacteria 1148
384 Ga0496102_0008041 3300048905 Bacteria 9019
385 Ga0496102_0027699 3300048905 Bacteria 5061
386 Ga0496102_0107302 3300048905 Bacteria 2600
387 Ga0496102_0110881 3300048905 Bacteria 2558
388 Ga0496104_0071747 3300048907 Bacteria 3292
389 Ga0496105_0151813 3300048908 Bacteria 1904
390 Ga0496107_0028764 3300048910 Bacteria 3951
391 Ga0496107_0043227 3300048910 Bacteria 3237
392 Ga0496109_0109302 3300048912 Bacteria 2570
393 Ga0496110_0071844 3300048913 Bacteria 3069
394 Ga0496111_0099468 3300048914 Bacteria 2136
395 Ga0496112_0122968 3300048915 Bacteria 2565
396 Ga0496113_0054033 3300048916 Bacteria 3005
397 Ga0496114_0080420 3300048917 Bacteria 2752
398 Ga0496116_0007861 3300048919 Bacteria 9357
399 Ga0496116_0010729 3300048919 Bacteria 7648
400 Ga0496116_0022723 3300048919 Bacteria 4692
401 Ga0496116_0034981 3300048919 Bacteria 3534
402 Ga0496117_0014930 3300048920 Bacteria 6658
403 Ga0496117_0020711 3300048920 Bacteria 5353
404 Ga0496117_0025907 3300048920 Bacteria 4598
405 Ga0496117_0044726 3300048920 Bacteria 3204
406 Ga0496118_0009286 3300048921 Bacteria 9974
407 Ga0496118_0018500 3300048921 Bacteria 6283
408 Ga0496118_0024665 3300048921 Bacteria 5183
409 Ga0496118_0049911 3300048921 Bacteria 3217
410 Ga0496120_0010394 3300048923 Bacteria 6496
411 Ga0496121_0002843 3300048924 Bacteria 25547
412 Ga0496121_0009359 3300048924 Bacteria 11284
413 Ga0496121_0017745 3300048924 Bacteria 7240
414 Ga0496121_0043858 3300048924 Bacteria 3866
415 Ga0496121_0049833 3300048924 Bacteria 3545
416 Ga0496122_0000375 3300048925 Bacteria 95681
417 Ga0496122_0000410 3300048925 Bacteria 91128
418 Ga0496122_0023610 3300048925 Bacteria 5410
419 Ga0496122_0061738 3300048925 Bacteria 2748
420 Ga0496122_0212225 3300048925 Bacteria 1120
421 Ga0496123_0000267 3300048926 Bacteria 104282
422 Ga0496123_0001174 3300048926 Bacteria 38674
423 Ga0496123_0003782 3300048926 Bacteria 16575
424 Ga0496123_0059679 3300048926 Bacteria 2464
425 Ga0496124_0012150 3300048927 Bacteria 8529
426 Ga0496124_0014108 3300048927 Bacteria 7746
427 Ga0496124_0026702 3300048927 Bacteria 5203
428 Ga0496124_0098196 3300048927 Bacteria 2377
429 Ga0496124_0116832 3300048927 Bacteria 2138
430 Ga0496125_0000166 3300048928 Bacteria 147432
431 Ga0496125_0002855 3300048928 Bacteria 21745
432 Ga0496125_0011729 3300048928 Bacteria 8736
433 Ga0496125_0020196 3300048928 Bacteria 6260
434 Ga0496125_0021514 3300048928 Bacteria 6014
435 Ga0496125_0029723 3300048928 Bacteria 4904
436 Ga0496126_0031176 3300048929 Bacteria 5042
437 Ga0496126_0044376 3300048929 Bacteria 4094
438 Ga0496126_0280490 3300048929 Bacteria 1380
439 Ga0501249_026488 3300049679 Bacteria 1282
440 Ga0501225_0006610 3300049705 Bacteria 3382
441 Ga0501262_000681 3300049759 Bacteria 3937
442 nmdc:mga03683_58480_c1 3300050489 Bacteria 1625
443 nmdc:mga03683_9475_c1 3300050489 Bacteria 3465
444 nmdc:mga03n38_108918_c1 3300050490 Bacteria 1346
445 nmdc:mga03n38_2356_c1 3300050490 Bacteria 5815
446 nmdc:mga00v17_13035_c1 3300050491 Bacteria 4606
447 nmdc:mga0k408_24779_c1 3300050493 Bacteria 3394
448 nmdc:mga0k408_28690_c1 3300050493 Bacteria 3164
449 nmdc:mga0k408_4659_c1 3300050493 Bacteria 7267
450 nmdc:mga0k408_70364_c1 3300050493 Bacteria 2042
451 nmdc:mga0k408_8638_c1 3300050493 Bacteria 3527
452 nmdc:mga06z11_40543_c1 3300050494 Bacteria 2324
453 nmdc:mga06z11_57773_c1 3300050494 Bacteria 2011
454 nmdc:mga07m45_19058_c1 3300050496 Bacteria 3714
455 nmdc:mga07m45_41959_c1 3300050496 Bacteria 2563
456 nmdc:mga07m45_8257_c1 3300050496 Bacteria 5344
457 nmdc:mga07m45_85857_c1 3300050496 Bacteria 1800
458 nmdc:mga0sz30_75984_c1 3300050516 Bacteria 1450
459 Ga0495601_0018864 3300053077 Bacteria 4202
460 Ga0500610_0008482 3300053079 Bacteria 4482
461 Ga0500643_008611 3300053087 Bacteria 3994
462 Ga0500651_0000345 3300053093 Bacteria 26058
463 Ga0500571_002156 3300053110 Bacteria 9653
464 Ga0500593_000864 3300053117 Bacteria 11255
465 Ga0500593_003454 3300053117 Bacteria 5977
466 Ga0500594_0004886 3300053118 Bacteria 2964
467 Ga0500595_001911 3300053119 Bacteria 10732
468 Ga0500597_051894 3300053120 Bacteria 1749
469 Ga0500607_007464 3300053121 Bacteria 6755
470 Ga0500618_000877 3300053125 Bacteria 16018
471 Ga0500618_002085 3300053125 Bacteria 7968
472 Ga0500618_015056 3300053125 Bacteria 1962
473 Ga0500626_070558 3300053128 Bacteria 1555
474 Ga0500655_000997 3300053133 Bacteria 5464
475 Ga0500658_0000825 3300053134 Bacteria 12746
476 Ga0500658_0003061 3300053134 Bacteria 6398
477 Ga0500559_0005364 3300053136 Bacteria 5901
478 Ga0500559_0027063 3300053136 Bacteria 2446
479 Ga0500568_0013585 3300053139 Bacteria 3707
480 Ga0500574_000776 3300053141 Bacteria 4294
481 Ga0500619_000083 3300053154 Bacteria 26339
482 Ga0500622_0001025 3300053156 Bacteria 23432
483 Ga0500624_004921 3300053157 Bacteria 1768
484 Ga0500634_0031985 3300053161 Bacteria 2870
485 Ga0500638_050914 3300053162 Bacteria 2002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10009104 Ga0163163_100091048 308
2 3300014968 Ga0157379_10001985 Ga0157379_100019859 308
3 3300031548 Ga0307408_100011346 Ga0307408_1000113465 308
4 3300031901 Ga0307406_10006477 Ga0307406_100064774 308
5 iso_pu_bacteria 2643221683 2644465238 308
6 iso_pu_bacteria 2881101125 2881105423 312
7 3300005616 Ga0068852_100400582 Ga0068852_1004005821 313
8 3300006195 Ga0075366_10000846 Ga0075366_1000084611 313
9 3300026142 Ga0207698_10315881 Ga0207698_103158811 313
10 3300050493 nmdc:mga0k408_8638_c1 nmdc:mga0k408_8638_c1_327_1304 313
11 iso_pu_bacteria 2939631187 2939631593 314
12 3300048904 Ga0496101_0357480 Ga0496101_0357480_61_1014 316
13 3300048920 Ga0496117_0020711 Ga0496117_0020711_3168_4121 316
14 3300048924 Ga0496121_0049833 Ga0496121_0049833_592_1545 316
15 iso_pu_bacteria 2643221660 2644337521 316
16 3300039447 Ga0436361_0955311 Ga0436361_0955311_3039_3992 317
17 iso_pu_bacteria 2599185292 2599902613 317
18 iso_pu_bacteria 2643221569 2643861406 317
19 iso_pu_bacteria 2643221594 2643979599 317
20 iso_pu_bacteria 2643221621 2644123738 317
21 iso_pu_bacteria 2808606395 2809032963 317
22 iso_pu_bacteria 2857537821 2857541709 317
23 iso_pu_bacteria 2858950400 2858952324 317
24 iso_pu_bacteria 2941479691 2941482807 317
25 3300003323 rootH1_10045942 rootH1_100459423 318
26 3300006038 Ga0075365_10056750 Ga0075365_100567503 318
27 3300006042 Ga0075368_10052364 Ga0075368_100523642 318
28 3300006048 Ga0075363_100071018 Ga0075363_1000710182 318
29 3300006178 Ga0075367_10007008 Ga0075367_100070084 318
30 3300021361 Ga0213872_10000034 Ga0213872_1000003460 318
31 3300028794 Ga0307515_10054979 Ga0307515_100549794 318
32 3300032002 Ga0307416_100118933 Ga0307416_1001189332 318
33 3300039447 Ga0436361_0436689 Ga0436361_0436689_36341_37297 318
34 3300044673 Ga0453683_0001424 Ga0453683_0001424_6842_7825 318
35 3300045051 Ga0451576_0054907 Ga0451576_0054907_2405_3388 318
36 3300046615 Ga0495656_0006748 Ga0495656_0006748_2256_3212 318
37 3300046615 Ga0495656_0040336 Ga0495656_0040336_510_1466 318
38 3300047447 Ga0495685_004759 Ga0495685_004759_2952_3908 318
39 3300048090 Ga0495615_0004143 Ga0495615_0004143_475_1431 318
40 3300050493 nmdc:mga0k408_28690_c1 nmdc:mga0k408_28690_c1_263_1219 318
41 3300050494 nmdc:mga06z11_57773_c1 nmdc:mga06z11_57773_c1_788_1744 318
42 iso_pu_bacteria 2842733646 2842734523 318
43 iso_pu_bacteria 2842747753 2842749245 318
44 iso_pu_bacteria 2885192300 2885195419 318
45 3300005344 Ga0070661_100330999 Ga0070661_1003309992 319
46 3300025920 Ga0207649_10278187 Ga0207649_102781871 319
47 3300037471 Ga0395905_0000455 Ga0395905_0000455_39236_40222 319
48 3300042435 Ga0439434_0004921 Ga0439434_0004921_747_1709 319
49 3300042531 Ga0450918_005117 Ga0450918_005117_389_1351 319
50 3300042876 Ga0451577_0007345 Ga0451577_0007345_3592_4551 319
51 3300045051 Ga0451576_0001940 Ga0451576_0001940_10572_11531 319
52 3300045051 Ga0451576_0220550 Ga0451576_0220550_323_1285 319
53 3300046471 Ga0495650_0010860 Ga0495650_0010860_1592_2554 319
54 3300053117 Ga0500593_000864 Ga0500593_000864_9891_10874 319
55 iso_pu_bacteria 2513020051 2513227212 319
56 iso_pu_bacteria 2599185214 2599627310 319
57 iso_pu_bacteria 2599185226 2599676725 319
58 iso_pu_bacteria 2599185227 2599679981 319
59 iso_pu_bacteria 2599185229 2599691997 319
60 iso_pu_bacteria 2643221628 2644160383 319
61 iso_pu_bacteria 2643221658 2644324779 319
62 iso_pu_bacteria 2643221672 2644396651 319
63 iso_pu_bacteria 2738541277 2738719685 319
64 iso_pu_bacteria 2738541307 2738879877 319
65 iso_pu_bacteria 2738543019 2739278884 319
66 iso_pu_bacteria 2818991446 2819600113 319
67 iso_pu_bacteria 2831265667 2831267529 319
68 iso_pu_bacteria 2831864461 2831865776 319
69 iso_pu_bacteria 2838054893 2838056034 319
70 iso_pu_bacteria 2842677519 2842678010 319
71 iso_pu_bacteria 2885198086 2885204970 319
72 iso_pu_bacteria 2885211737 2885218343 319
73 iso_pu_bacteria 2886848708 2886850990 319
74 iso_pu_bacteria 2886848708 2886851101 319
75 iso_pu_bacteria 2899924645 2899925948 319
76 iso_pu_bacteria 2904449895 2904450287 319
77 iso_pu_bacteria 2904456579 2904456891 319
78 iso_pu_bacteria 2904541872 2904544221 319
79 iso_pu_bacteria 2919462493 2919463274 319
80 iso_pu_bacteria 2928037797 2928041665 319
81 iso_pu_bacteria 2928044640 2928049229 319
82 iso_pu_bacteria 2928051484 2928052164 319
83 iso_pu_bacteria 2928064002 2928065157 319
84 iso_pu_bacteria 2928070936 2928076706 319
85 iso_pu_bacteria 2928084124 2928089180 319
86 iso_pu_bacteria 2929160207 2929162207 319
87 iso_pu_bacteria 2929520902 2929520991 319
88 iso_pu_bacteria 2945909444 2945913392 319
89 iso_pu_bacteria 2945945610 2945948951 319
90 iso_pu_bacteria 2945972063 2945973061 319
91 iso_pu_bacteria 2945984333 2945991216 319
92 iso_pu_bacteria 2954767861 2954773073 319
93 3300006177 Ga0075362_10071953 Ga0075362_100719532 320
94 3300021361 Ga0213872_10008332 Ga0213872_100083326 320
95 3300041997 Ga0439431_0011614 Ga0439431_0011614_367_1332 320
96 3300042156 Ga0439446_0021143 Ga0439446_0021143_828_1793 320
97 3300053120 Ga0500597_051894 Ga0500597_051894_396_1358 320
98 3300006048 Ga0075363_100005424 Ga0075363_1000054244 321
99 3300006051 Ga0075364_10291739 Ga0075364_102917391 321
100 3300006177 Ga0075362_10090791 Ga0075362_100907911 321
101 3300006177 Ga0075362_10134041 Ga0075362_101340412 321
102 3300006178 Ga0075367_10086973 Ga0075367_100869732 321
103 3300006353 Ga0075370_10120476 Ga0075370_101204761 321
104 3300031250 Ga0265331_10006808 Ga0265331_100068087 321
105 3300031251 Ga0265327_10000012 Ga0265327_10000012451 321
106 3300031251 Ga0265327_10073313 Ga0265327_100733132 321
107 3300031911 Ga0307412_10000663 Ga0307412_100006633 321
108 3300042015 Ga0439462_0002443 Ga0439462_0002443_906_1913 321
109 3300048919 Ga0496116_0010729 Ga0496116_0010729_6217_7224 321
110 3300048920 Ga0496117_0044726 Ga0496117_0044726_1094_2104 321
111 3300048921 Ga0496118_0009286 Ga0496118_0009286_722_1729 321
112 3300048921 Ga0496118_0049911 Ga0496118_0049911_1277_2287 321
113 3300048923 Ga0496120_0010394 Ga0496120_0010394_785_1792 321
114 3300048924 Ga0496121_0002843 Ga0496121_0002843_22370_23377 321
115 3300048924 Ga0496121_0017745 Ga0496121_0017745_2773_3780 321
116 3300048925 Ga0496122_0000410 Ga0496122_0000410_33466_34473 321
117 3300048925 Ga0496122_0061738 Ga0496122_0061738_589_1596 321
118 3300048926 Ga0496123_0001174 Ga0496123_0001174_33447_34454 321
119 3300048927 Ga0496124_0012150 Ga0496124_0012150_641_1648 321
120 3300048928 Ga0496125_0000166 Ga0496125_0000166_145489_146496 321
121 3300048928 Ga0496125_0011729 Ga0496125_0011729_6565_7575 321
122 3300048929 Ga0496126_0044376 Ga0496126_0044376_3063_4070 321
123 3300048929 Ga0496126_0280490 Ga0496126_0280490_319_1326 321
124 3300050490 nmdc:mga03n38_108918_c1 nmdc:mga03n38_108918_c1_177_1145 321
125 3300050493 nmdc:mga0k408_4659_c1 nmdc:mga0k408_4659_c1_2894_3862 321
126 iso_pu_bacteria 2928115317 2928116411 321
127 3300002987 JGI25159J45721_1006323 JGI25159J45721_10063233 322
128 3300005354 Ga0070675_100266576 Ga0070675_1002665761 322
129 3300005367 Ga0070667_100138569 Ga0070667_1001385692 322
130 3300005543 Ga0070672_100146962 Ga0070672_1001469622 322
131 3300005548 Ga0070665_100094358 Ga0070665_1000943584 322
132 3300006175 Ga0070712_100003224 Ga0070712_1000032242 322
133 3300006177 Ga0075362_10002649 Ga0075362_100026495 322
134 3300006195 Ga0075366_10023610 Ga0075366_100236103 322
135 3300006195 Ga0075366_10185927 Ga0075366_101859272 322
136 3300006353 Ga0075370_10001545 Ga0075370_100015454 322
137 3300009176 Ga0105242_10046905 Ga0105242_100469053 322
138 3300014497 Ga0182008_10007288 Ga0182008_100072884 322
139 3300015262 Ga0182007_10001722 Ga0182007_100017228 322
140 3300015683 Ga0183362_10003 Ga0183362_10003299 322
141 3300017792 Ga0163161_10070642 Ga0163161_100706422 322
142 3300017792 Ga0163161_10199985 Ga0163161_101999851 322
143 3300025893 Ga0207682_10015262 Ga0207682_100152623 322
144 3300025915 Ga0207693_10044719 Ga0207693_100447194 322
145 3300025923 Ga0207681_10020395 Ga0207681_100203955 322
146 3300025934 Ga0207686_10172067 Ga0207686_101720672 322
147 3300025941 Ga0207711_10003782 Ga0207711_100037823 322
148 3300025986 Ga0207658_10155507 Ga0207658_101555072 322
149 3300026121 Ga0207683_10030416 Ga0207683_100304165 322
150 3300028794 Ga0307515_10000487 Ga0307515_1000048782 322
151 3300031731 Ga0307405_10111340 Ga0307405_101113402 322
152 3300031911 Ga0307412_10047588 Ga0307412_100475883 322
153 3300032002 Ga0307416_100069235 Ga0307416_1000692352 322
154 3300041404 Ga0439436_0006866 Ga0439436_0006866_1124_2095 322
155 3300041405 Ga0439438_021887 Ga0439438_021887_186_1157 322
156 3300041407 Ga0439447_014866 Ga0439447_014866_472_1443 322
157 3300041411 Ga0439466_0003503 Ga0439466_0003503_2279_3250 322
158 3300041411 Ga0439466_0008567 Ga0439466_0008567_2743_3714 322
159 3300041413 Ga0439465_0001409 Ga0439465_0001409_2544_3515 322
160 3300041997 Ga0439431_0001296 Ga0439431_0001296_2189_3160 322
161 3300041997 Ga0439431_0004211 Ga0439431_0004211_927_1898 322
162 3300041999 Ga0439433_0000635 Ga0439433_0000635_2988_3959 322
163 3300042002 Ga0439442_001259 Ga0439442_001259_1440_2411 322
164 3300042002 Ga0439442_002007 Ga0439442_002007_1410_2381 322
165 3300042004 Ga0439445_0002064 Ga0439445_0002064_738_1709 322
166 3300042006 Ga0439432_003666 Ga0439432_003666_2673_3644 322
167 3300042006 Ga0439432_003984 Ga0439432_003984_1804_2775 322
168 3300042007 Ga0439449_0000729 Ga0439449_0000729_6333_7304 322
169 3300042007 Ga0439449_0003132 Ga0439449_0003132_2653_3624 322
170 3300042010 Ga0439452_003831 Ga0439452_003831_2785_3756 322
171 3300042014 Ga0439457_005060 Ga0439457_005060_1110_2081 322
172 3300042015 Ga0439462_0001258 Ga0439462_0001258_3178_4149 322
173 3300042134 Ga0450898_000672 Ga0450898_000672_1890_2861 322
174 3300042156 Ga0439446_0004168 Ga0439446_0004168_2482_3453 322
175 3300042184 Ga0450908_009618 Ga0450908_009618_648_1619 322
176 3300042435 Ga0439434_0002254 Ga0439434_0002254_2604_3575 322
177 3300046539 Ga0495621_0007767 Ga0495621_0007767_1445_2416 322
178 3300046615 Ga0495656_0001934 Ga0495656_0001934_2860_3831 322
179 3300046615 Ga0495656_0012528 Ga0495656_0012528_415_1386 322
180 3300048904 Ga0496101_0012475 Ga0496101_0012475_3114_4085 322
181 3300048905 Ga0496102_0008041 Ga0496102_0008041_1118_2089 322
182 3300048905 Ga0496102_0110881 Ga0496102_0110881_1342_2337 322
183 3300048907 Ga0496104_0071747 Ga0496104_0071747_2028_2999 322
184 3300048908 Ga0496105_0151813 Ga0496105_0151813_328_1323 322
185 3300048910 Ga0496107_0043227 Ga0496107_0043227_2055_3026 322
186 3300048915 Ga0496112_0122968 Ga0496112_0122968_422_1417 322
187 3300048916 Ga0496113_0054033 Ga0496113_0054033_1538_2533 322
188 3300048917 Ga0496114_0080420 Ga0496114_0080420_672_1643 322
189 3300048925 Ga0496122_0023610 Ga0496122_0023610_1059_2030 322
190 3300048926 Ga0496123_0003782 Ga0496123_0003782_7384_8355 322
191 3300050489 nmdc:mga03683_58480_c1 nmdc:mga03683_58480_c1_427_1398 322
192 3300050496 nmdc:mga07m45_85857_c1 nmdc:mga07m45_85857_c1_424_1395 322
193 3300053125 Ga0500618_015056 Ga0500618_015056_170_1141 322
194 3300053136 Ga0500559_0005364 Ga0500559_0005364_2972_3943 322
195 3300053136 Ga0500559_0027063 Ga0500559_0027063_1454_2425 322
196 3300002739 JGI25158J39367_1005046 JGI25158J39367_10050462 323
197 3300002773 JGI25152J39213_1003884 JGI25152J39213_10038843 323
198 3300002773 JGI25152J39213_1009188 JGI25152J39213_10091882 323
199 3300003187 JGI25151J46595_10004233 JGI25151J46595_100042335 323
200 3300003187 JGI25151J46595_10010350 JGI25151J46595_100103504 323
201 3300003187 JGI25151J46595_10022003 JGI25151J46595_100220032 323
202 3300003215 JGI25153J46596_10018916 JGI25153J46596_100189163 323
203 3300003316 rootH1_10035550 rootH1_100355501 323
204 3300003320 rootH2_10065870 rootH2_100658702 323
205 3300003322 rootL2_10002813 rootL2_1000281318 323
206 3300003323 rootH1_10012523 rootH1_100125233 323
207 3300003354 JGI25160J50197_1006552 JGI25160J50197_10065523 323
208 3300003374 JGI25161J50226_1004315 JGI25161J50226_10043153 323
209 3300003578 Ga0006562J51391_1028493 Ga0006562J51391_10284935 323
210 3300003761 Ga0055535_1000086 Ga0055535_100008678 323
211 3300003762 Ga0055542_1000009 Ga0055542_1000009270 323
212 3300003771 Ga0055526_1001717 Ga0055526_10017174 323
213 3300003773 Ga0055537_1001318 Ga0055537_10013184 323
214 3300003775 Ga0055524_1000755 Ga0055524_10007553 323
215 3300003781 Ga0055536_1007090 Ga0055536_10070904 323
216 3300003781 Ga0055536_1013053 Ga0055536_10130532 323
217 3300003781 Ga0055536_1016192 Ga0055536_10161923 323
218 3300003784 Ga0055534_1000440 Ga0055534_10004403 323
219 3300003784 Ga0055534_1001277 Ga0055534_10012776 323
220 3300003790 Ga0055528_1002574 Ga0055528_10025744 323
221 3300003790 Ga0055528_1005974 Ga0055528_10059745 323
222 3300003791 Ga0055530_10001144 Ga0055530_100011444 323
223 3300003791 Ga0055530_10006393 Ga0055530_100063935 323
224 3300003792 Ga0055540_1004372 Ga0055540_10043725 323
225 3300003792 Ga0055540_1004891 Ga0055540_10048915 323
226 3300003792 Ga0055540_1005964 Ga0055540_10059645 323
227 3300003792 Ga0055540_1011653 Ga0055540_10116533 323
228 3300003794 Ga0055531_10007699 Ga0055531_100076995 323
229 3300003794 Ga0055531_10020389 Ga0055531_100203892 323
230 3300004625 Ga0055543_1006494 Ga0055543_10064942 323
231 3300005262 Ga0065165_1000354 Ga0065165_100035418 323
232 3300005262 Ga0065165_1000431 Ga0065165_100043147 323
233 3300005288 Ga0065714_10076198 Ga0065714_100761983 323
234 3300005366 Ga0070659_100125899 Ga0070659_1001258992 323
235 3300005367 Ga0070667_100218220 Ga0070667_1002182202 323
236 3300005539 Ga0068853_100120219 Ga0068853_1001202193 323
237 3300005564 Ga0070664_100008585 Ga0070664_1000085855 323
238 3300005577 Ga0068857_100250662 Ga0068857_1002506622 323
239 3300005578 Ga0068854_100112726 Ga0068854_1001127262 323
240 3300006038 Ga0075365_10003506 Ga0075365_100035064 323
241 3300006048 Ga0075363_100006287 Ga0075363_1000062874 323
242 3300006051 Ga0075364_10090964 Ga0075364_100909642 323
243 3300006177 Ga0075362_10048373 Ga0075362_100483732 323
244 3300006353 Ga0075370_10000611 Ga0075370_100006114 323
245 3300006353 Ga0075370_10013714 Ga0075370_100137143 323
246 3300006353 Ga0075370_10013900 Ga0075370_100139003 323
247 3300006353 Ga0075370_10016385 Ga0075370_100163853 323
248 3300006353 Ga0075370_10170337 Ga0075370_101703372 323
249 3300006948 Ga0099826_10036324 Ga0099826_100363243 323
250 3300006948 Ga0099826_10039119 Ga0099826_100391193 323
251 3300009036 Ga0105244_10009292 Ga0105244_100092923 323
252 3300009093 Ga0105240_10583770 Ga0105240_105837701 323
253 3300009148 Ga0105243_10001422 Ga0105243_100014224 323
254 3300009148 Ga0105243_10007750 Ga0105243_100077508 323
255 3300009174 Ga0105241_10101110 Ga0105241_101011102 323
256 3300009545 Ga0105237_10059955 Ga0105237_100599552 323
257 3300009545 Ga0105237_10265047 Ga0105237_102650472 323
258 3300009551 Ga0105238_10062715 Ga0105238_100627155 323
259 3300010375 Ga0105239_10194962 Ga0105239_101949622 323
260 3300011119 Ga0105246_10041769 Ga0105246_100417693 323
261 3300012497 Ga0157319_1000017 Ga0157319_100001721 323
262 3300013100 Ga0157373_10006156 Ga0157373_100061566 323
263 3300013100 Ga0157373_10076719 Ga0157373_100767192 323
264 3300013102 Ga0157371_10039685 Ga0157371_100396853 323
265 3300013104 Ga0157370_10045256 Ga0157370_100452564 323
266 3300013105 Ga0157369_10063158 Ga0157369_100631584 323
267 3300013307 Ga0157372_10161322 Ga0157372_101613222 323
268 3300014497 Ga0182008_10005016 Ga0182008_100050164 323
269 3300014497 Ga0182008_10037413 Ga0182008_100374132 323
270 3300015261 Ga0182006_1005603 Ga0182006_10056034 323
271 3300015261 Ga0182006_1065838 Ga0182006_10658382 323
272 3300015262 Ga0182007_10001954 Ga0182007_100019544 323
273 3300017792 Ga0163161_10000803 Ga0163161_100008039 323
274 3300017792 Ga0163161_10010378 Ga0163161_100103783 323
275 3300017792 Ga0163161_10035475 Ga0163161_100354753 323
276 3300025229 Ga0209147_102894 Ga0209147_1028942 323
277 3300025242 Ga0209258_100009 Ga0209258_100009383 323
278 3300025254 Ga0209148_1000007 Ga0209148_1000007383 323
279 3300025258 Ga0209129_1000013 Ga0209129_1000013231 323
280 3300025258 Ga0209129_1005263 Ga0209129_10052634 323
281 3300025258 Ga0209129_1006522 Ga0209129_10065223 323
282 3300025263 Ga0209565_1000058 Ga0209565_1000058189 323
283 3300025263 Ga0209565_1001103 Ga0209565_10011038 323
284 3300025263 Ga0209565_1002218 Ga0209565_10022185 323
285 3300025273 Ga0209673_1000053 Ga0209673_1000053265 323
286 3300025273 Ga0209673_1000648 Ga0209673_10006486 323
287 3300025273 Ga0209673_1002359 Ga0209673_10023598 323
288 3300025273 Ga0209673_1003441 Ga0209673_10034414 323
289 3300025273 Ga0209673_1003742 Ga0209673_10037426 323
290 3300025284 Ga0209130_1000230 Ga0209130_100023031 323
291 3300025284 Ga0209130_1000513 Ga0209130_10005138 323
292 3300025291 Ga0209675_1001191 Ga0209675_10011916 323
293 3300025291 Ga0209675_1001632 Ga0209675_100163210 323
294 3300025291 Ga0209675_1002205 Ga0209675_10022058 323
295 3300025291 Ga0209675_1002332 Ga0209675_10023323 323
296 3300025292 Ga0209676_1000004 Ga0209676_100000445 323
297 3300025292 Ga0209676_1000368 Ga0209676_100036849 323
298 3300025292 Ga0209676_1000497 Ga0209676_100049756 323
299 3300025292 Ga0209676_1009557 Ga0209676_10095573 323
300 3300025294 Ga0209025_1001889 Ga0209025_100188919 323
301 3300025294 Ga0209025_1002491 Ga0209025_10024916 323
302 3300025294 Ga0209025_1004165 Ga0209025_10041654 323
303 3300025294 Ga0209025_1009256 Ga0209025_10092564 323
304 3300025294 Ga0209025_1013248 Ga0209025_10132484 323
305 3300025295 Ga0209564_1000051 Ga0209564_1000051284 323
306 3300025295 Ga0209564_1000214 Ga0209564_10002148 323
307 3300025295 Ga0209564_1000319 Ga0209564_100031945 323
308 3300025297 Ga0209758_1000067 Ga0209758_100006724 323
309 3300025297 Ga0209758_1005598 Ga0209758_10055985 323
310 3300025298 Ga0209050_1000002 Ga0209050_1000002555 323
311 3300025298 Ga0209050_1003087 Ga0209050_10030874 323
312 3300025298 Ga0209050_1014864 Ga0209050_10148642 323
313 3300025299 Ga0209256_1000060 Ga0209256_10000608 323
314 3300025299 Ga0209256_1000166 Ga0209256_100016678 323
315 3300025299 Ga0209256_1000249 Ga0209256_100024921 323
316 3300025299 Ga0209256_1038558 Ga0209256_10385582 323
317 3300025302 Ga0207426_1000100 Ga0207426_10001008 323
318 3300025302 Ga0207426_1000469 Ga0207426_100046945 323
319 3300025303 Ga0209051_1000002 Ga0209051_1000002323 323
320 3300025303 Ga0209051_1000240 Ga0209051_100024089 323
321 3300025303 Ga0209051_1000584 Ga0209051_10005844 323
322 3300025303 Ga0209051_1003248 Ga0209051_10032484 323
323 3300025304 Ga0209257_1000002 Ga0209257_1000002464 323
324 3300025304 Ga0209257_1002034 Ga0209257_10020346 323
325 3300025304 Ga0209257_1003692 Ga0209257_100369213 323
326 3300025304 Ga0209257_1011829 Ga0209257_10118294 323
327 3300025321 Ga0207656_10029113 Ga0207656_100291132 323
328 3300025728 Ga0207655_1012960 Ga0207655_10129604 323
329 3300025924 Ga0207694_10162275 Ga0207694_101622752 323
330 3300025935 Ga0207709_10000589 Ga0207709_100005896 323
331 3300025935 Ga0207709_10000633 Ga0207709_1000063323 323
332 3300025945 Ga0207679_10008087 Ga0207679_100080875 323
333 3300026041 Ga0207639_10014847 Ga0207639_100148473 323
334 3300027666 Ga0209282_1000719 Ga0209282_10007194 323
335 3300028794 Ga0307515_10177942 Ga0307515_101779422 323
336 3300030733 Ga0314311_1178047 Ga0314311_11780472 323
337 3300030742 Ga0316183_1083828 Ga0316183_10838282 323
338 3300030745 Ga0316182_1000683 Ga0316182_10006833 323
339 3300031548 Ga0307408_100056343 Ga0307408_1000563431 323
340 3300031649 Ga0307514_10074985 Ga0307514_100749852 323
341 3300031731 Ga0307405_10011747 Ga0307405_100117473 323
342 3300031852 Ga0307410_10379582 Ga0307410_103795821 323
343 3300031911 Ga0307412_10007893 Ga0307412_100078935 323
344 3300031911 Ga0307412_10008430 Ga0307412_100084304 323
345 3300031911 Ga0307412_10061106 Ga0307412_100611063 323
346 3300032004 Ga0307414_10042711 Ga0307414_100427114 323
347 3300032005 Ga0307411_10149934 Ga0307411_101499341 323
348 3300039447 Ga0436361_0254808 Ga0436361_0254808_11173_12168 323
349 3300039447 Ga0436361_0767394 Ga0436361_0767394_572_1567 323
350 3300042127 Ga0450890_000849 Ga0450890_000849_1632_2687 323
351 3300044658 Ga0466972_0000414 Ga0466972_0000414_16638_17687 323
352 3300046453 Ga0495627_021590 Ga0495627_021590_133_1107 323
353 3300046453 Ga0495627_025452 Ga0495627_025452_628_1602 323
354 3300046460 Ga0495638_0030440 Ga0495638_0030440_27_1001 323
355 3300046462 Ga0495651_0044520 Ga0495651_0044520_2067_3038 323
356 3300046511 Ga0495608_0015808 Ga0495608_0015808_2015_2986 323
357 3300046515 Ga0495620_0011223 Ga0495620_0011223_3092_4066 323
358 3300046516 Ga0495628_0002569 Ga0495628_0002569_10178_11149 323
359 3300046520 Ga0495637_0010541 Ga0495637_0010541_578_1552 323
360 3300046529 Ga0495652_0037349 Ga0495652_0037349_2133_3104 323
361 3300046538 Ga0495609_0072151 Ga0495609_0072151_352_1326 323
362 3300046660 Ga0495625_0006576 Ga0495625_0006576_6410_7384 323
363 3300046674 Ga0495588_0023958 Ga0495588_0023958_1570_2544 323
364 3300046679 Ga0495623_0037936 Ga0495623_0037936_2053_3024 323
365 3300046683 Ga0495658_0007369 Ga0495658_0007369_759_1733 323
366 3300046691 Ga0495670_0004700 Ga0495670_0004700_2711_3685 323
367 3300046692 Ga0495671_0076529 Ga0495671_0076529_291_1265 323
368 3300047321 Ga0495676_0007117 Ga0495676_0007117_3435_4409 323
369 3300047673 Ga0495593_0013090 Ga0495593_0013090_3181_4155 323
370 3300048088 Ga0495602_0196695 Ga0495602_0196695_231_1202 323
371 3300048089 Ga0495614_0007704 Ga0495614_0007704_3049_4023 323
372 3300048905 Ga0496102_0107302 Ga0496102_0107302_966_1940 323
373 3300048919 Ga0496116_0022723 Ga0496116_0022723_1048_2022 323
374 3300048919 Ga0496116_0034981 Ga0496116_0034981_2148_3122 323
375 3300048920 Ga0496117_0014930 Ga0496117_0014930_2505_3479 323
376 3300048920 Ga0496117_0025907 Ga0496117_0025907_3449_4423 323
377 3300048921 Ga0496118_0018500 Ga0496118_0018500_2142_3116 323
378 3300048921 Ga0496118_0024665 Ga0496118_0024665_2707_3681 323
379 3300048925 Ga0496122_0212225 Ga0496122_0212225_37_1011 323
380 3300048926 Ga0496123_0059679 Ga0496123_0059679_458_1432 323
381 3300048927 Ga0496124_0014108 Ga0496124_0014108_4570_5589 323
382 3300048927 Ga0496124_0026702 Ga0496124_0026702_2288_3262 323
383 3300048927 Ga0496124_0116832 Ga0496124_0116832_716_1690 323
384 3300048928 Ga0496125_0020196 Ga0496125_0020196_1970_2944 323
385 3300049679 Ga0501249_026488 Ga0501249_026488_50_1024 323
386 3300049705 Ga0501225_0006610 Ga0501225_0006610_1752_2726 323
387 3300049759 Ga0501262_000681 Ga0501262_000681_557_1531 323
388 3300050489 nmdc:mga03683_9475_c1 nmdc:mga03683_9475_c1_141_1115 323
389 3300050490 nmdc:mga03n38_2356_c1 nmdc:mga03n38_2356_c1_1943_2917 323
390 3300050491 nmdc:mga00v17_13035_c1 nmdc:mga00v17_13035_c1_373_1347 323
391 3300050493 nmdc:mga0k408_24779_c1 nmdc:mga0k408_24779_c1_1943_2917 323
392 3300050493 nmdc:mga0k408_70364_c1 nmdc:mga0k408_70364_c1_569_1624 323
393 3300050494 nmdc:mga06z11_40543_c1 nmdc:mga06z11_40543_c1_1185_2159 323
394 3300050496 nmdc:mga07m45_41959_c1 nmdc:mga07m45_41959_c1_552_1526 323
395 3300050496 nmdc:mga07m45_8257_c1 nmdc:mga07m45_8257_c1_1394_2368 323
396 3300050516 nmdc:mga0sz30_75984_c1 nmdc:mga0sz30_75984_c1_253_1227 323
397 3300053079 Ga0500610_0008482 Ga0500610_0008482_1644_2618 323
398 3300053087 Ga0500643_008611 Ga0500643_008611_299_1273 323
399 3300053093 Ga0500651_0000345 Ga0500651_0000345_2307_3281 323
400 3300053110 Ga0500571_002156 Ga0500571_002156_5526_6500 323
401 3300053117 Ga0500593_003454 Ga0500593_003454_2086_3060 323
402 3300053121 Ga0500607_007464 Ga0500607_007464_3086_4060 323
403 3300053128 Ga0500626_070558 Ga0500626_070558_493_1467 323
404 3300053133 Ga0500655_000997 Ga0500655_000997_2121_3095 323
405 3300053134 Ga0500658_0000825 Ga0500658_0000825_1925_2899 323
406 3300053134 Ga0500658_0003061 Ga0500658_0003061_1925_2899 323
407 3300053139 Ga0500568_0013585 Ga0500568_0013585_696_1670 323
408 3300053141 Ga0500574_000776 Ga0500574_000776_435_1409 323
409 3300053156 Ga0500622_0001025 Ga0500622_0001025_16350_17402 323
410 3300053157 Ga0500624_004921 Ga0500624_004921_656_1630 323
411 3300053161 Ga0500634_0031985 Ga0500634_0031985_695_1669 323
412 3300053162 Ga0500638_050914 Ga0500638_050914_588_1562 323
413 3300003322 rootL2_10055286 rootL2_100552861 324
414 3300003323 rootH1_10074545 rootH1_100745454 324
415 3300003784 Ga0055534_1001930 Ga0055534_10019302 324
416 3300003794 Ga0055531_10007619 Ga0055531_100076193 324
417 3300006944 Ga0099823_1029870 Ga0099823_10298702 324
418 3300025292 Ga0209676_1007221 Ga0209676_10072214 324
419 3300025298 Ga0209050_1001264 Ga0209050_100126418 324
420 3300025299 Ga0209256_1002607 Ga0209256_10026076 324
421 3300025303 Ga0209051_1003160 Ga0209051_100316010 324
422 3300025304 Ga0209257_1001174 Ga0209257_100117421 324
423 3300027296 Ga0209389_1030170 Ga0209389_10301702 324
424 3300041404 Ga0439436_0041546 Ga0439436_0041546_281_1270 324
425 3300044712 Ga0453684_0367405 Ga0453684_0367405_417_1394 324
426 3300046454 Ga0495592_0002730 Ga0495592_0002730_5355_6329 324
427 3300046462 Ga0495651_0034068 Ga0495651_0034068_1861_2835 324
428 3300046511 Ga0495608_0018321 Ga0495608_0018321_1998_2972 324
429 3300046516 Ga0495628_0003270 Ga0495628_0003270_404_1378 324
430 3300046678 Ga0495599_0015872 Ga0495599_0015872_1689_2663 324
431 3300046680 Ga0495646_0010618 Ga0495646_0010618_4178_5152 324
432 3300046690 Ga0495624_0020311 Ga0495624_0020311_1576_2550 324
433 3300046809 Ga0495600_0001814 Ga0495600_0001814_9872_10846 324
434 3300047317 Ga0495604_0003896 Ga0495604_0003896_10037_11011 324
435 3300048927 Ga0496124_0098196 Ga0496124_0098196_628_1605 324
436 3300048928 Ga0496125_0021514 Ga0496125_0021514_2149_3180 324
437 3300053077 Ga0495601_0018864 Ga0495601_0018864_964_1938 324
438 3300053119 Ga0500595_001911 Ga0500595_001911_255_1229 324
439 3300053154 Ga0500619_000083 Ga0500619_000083_19620_20594 324
440 iso_pu_bacteria 2511231026 2511387485 324
441 iso_pu_bacteria 2521172590 2521557591 324
442 iso_pu_bacteria 2551306416 2553006620 324
443 iso_pu_bacteria 2643221603 2644026698 324
444 iso_pu_bacteria 2765235838 2765570244 324
445 iso_pu_bacteria 2808606386 2808984383 324
446 iso_pu_bacteria 2808606415 2809130737 324
447 iso_pu_bacteria 2808606419 2809149785 324
448 iso_pu_bacteria 2818991436 2819544237 324
449 iso_pu_bacteria 2818991449 2819615269 324
450 iso_pu_bacteria 2839094727 2839096811 324
451 iso_pu_bacteria 2852618963 2852620074 324
452 iso_pu_bacteria 2904439833 2904441698 324
453 iso_pu_bacteria 2904530477 2904531380 324
454 iso_pu_bacteria 2904584206 2904586965 324
455 iso_pu_bacteria 2904589729 2904593002 324
456 iso_pu_bacteria 2904601388 2904603185 324
457 iso_pu_bacteria 2919079590 2919082036 324
458 iso_pu_bacteria 2923510766 2923516289 324
459 iso_pu_bacteria 2928130867 2928135082 324
460 3300048905 Ga0496102_0027699 Ga0496102_0027699_18_995 325
461 3300048910 Ga0496107_0028764 Ga0496107_0028764_857_1834 325
462 3300048912 Ga0496109_0109302 Ga0496109_0109302_1196_2173 325
463 3300048913 Ga0496110_0071844 Ga0496110_0071844_1472_2449 325
464 3300048914 Ga0496111_0099468 Ga0496111_0099468_47_1024 325
465 iso_pu_bacteria 2919046199 2919050980 325
466 3300031344 Ga0265316_10000225 Ga0265316_1000022536 326
467 3300031649 Ga0307514_10001231 Ga0307514_1000123122 326
468 3300046512 Ga0495610_0034596 Ga0495610_0034596_671_1675 326
469 3300046513 Ga0495616_0015463 Ga0495616_0015463_74_1078 326
470 3300046518 Ga0495631_0004099 Ga0495631_0004099_4059_5063 326
471 3300046660 Ga0495625_0108270 Ga0495625_0108270_668_1672 326
472 3300048924 Ga0496121_0043858 Ga0496121_0043858_1122_2126 326
473 3300048929 Ga0496126_0031176 Ga0496126_0031176_2042_3046 326
474 3300050496 nmdc:mga07m45_19058_c1 nmdc:mga07m45_19058_c1_19_1050 326
475 3300053118 Ga0500594_0004886 Ga0500594_0004886_479_1483 326
476 3300044656 Ga0466969_0059020 Ga0466969_0059020_110_1147 327
477 3300044666 Ga0466977_0003004 Ga0466977_0003004_6623_7660 327
478 iso_pu_bacteria 2511231003 2511248963 327
479 iso_pu_bacteria 2548876994 2550696240 327
480 iso_pu_bacteria 2818991445 2819591426 327
481 iso_pu_bacteria 2884811622 2884815608 327
482 iso_pu_bacteria 2884836552 2884837230 327
483 iso_pu_bacteria 2884852848 2884853521 327
484 iso_pu_bacteria 2896154374 2896155362 327
485 3300002737 JGI25162J39368_1000052 JGI25162J39368_100005230 328
486 3300003214 JGI25165J46597_1000105 JGI25165J46597_1000105122 328
487 3300003751 Ga0055538_1000043 Ga0055538_1000043122 328
488 3300003751 Ga0055538_1000045 Ga0055538_1000045112 328
489 3300003752 Ga0055539_1000057 Ga0055539_1000057122 328
490 3300003752 Ga0055539_1000064 Ga0055539_1000064112 328
491 3300003756 Ga0055533_1000071 Ga0055533_1000071122 328
492 3300003756 Ga0055533_1000074 Ga0055533_1000074112 328
493 3300003759 Ga0055525_1000085 Ga0055525_1000085122 328
494 3300003759 Ga0055525_1000092 Ga0055525_1000092112 328
495 3300003841 Ga0055541_1000044 Ga0055541_100004430 328
496 3300003841 Ga0055541_1000046 Ga0055541_100004635 328
497 3300005563 Ga0068855_100000072 Ga0068855_100000072100 328
498 3300005577 Ga0068857_100074832 Ga0068857_1000748322 328
499 3300005578 Ga0068854_100001277 Ga0068854_10000127711 328
500 3300006946 Ga0079104_1030289 Ga0079104_10302891 328
501 3300009545 Ga0105237_10008022 Ga0105237_1000802210 328
502 3300009551 Ga0105238_10000318 Ga0105238_1000031826 328
503 3300010375 Ga0105239_10026228 Ga0105239_100262287 328
504 3300015262 Ga0182007_10007332 Ga0182007_100073322 328
505 3300015265 Ga0182005_1000365 Ga0182005_100036514 328
506 3300025224 Ga0209784_100002 Ga0209784_1000021309 328
507 3300025224 Ga0209784_100069 Ga0209784_100069124 328
508 3300025225 Ga0209566_100003 Ga0209566_1000031309 328
509 3300025225 Ga0209566_100083 Ga0209566_100083124 328
510 3300025226 Ga0209674_100004 Ga0209674_1000041309 328
511 3300025226 Ga0209674_100106 Ga0209674_100106124 328
512 3300025230 Ga0209563_100006 Ga0209563_1000061309 328
513 3300025230 Ga0209563_100100 Ga0209563_100100124 328
514 3300025231 Ga0207427_100279 Ga0207427_1002796 328
515 3300025233 Ga0209437_100156 Ga0209437_100156124 328
516 3300025253 Ga0209677_100003 Ga0209677_1000031309 328
517 3300025253 Ga0209677_100061 Ga0209677_100061124 328
518 3300025261 Ga0209233_1000165 Ga0209233_1000165124 328
519 3300025913 Ga0207695_10004759 Ga0207695_100047599 328
520 3300025914 Ga0207671_10030805 Ga0207671_100308053 328
521 3300025924 Ga0207694_10003032 Ga0207694_1000303213 328
522 3300025949 Ga0207667_10000055 Ga0207667_10000055123 328
523 3300026116 Ga0207674_10215183 Ga0207674_102151832 328
524 3300031507 Ga0307509_10306189 Ga0307509_103061892 328
525 3300046463 Ga0495653_0028155 Ga0495653_0028155_1883_2869 328
526 3300046516 Ga0495628_0259643 Ga0495628_0259643_187_1173 328
527 3300046529 Ga0495652_0008564 Ga0495652_0008564_4794_5780 328
528 3300046543 Ga0495645_0047656 Ga0495645_0047656_1038_2024 328
529 3300046663 Ga0495635_0044392 Ga0495635_0044392_874_1860 328
530 3300046680 Ga0495646_0002878 Ga0495646_0002878_3002_3988 328
531 3300046680 Ga0495646_0153573 Ga0495646_0153573_241_1227 328
532 3300053125 Ga0500618_000877 Ga0500618_000877_7654_8640 328
533 3300053125 Ga0500618_002085 Ga0500618_002085_388_1374 328
534 3300048925 Ga0496122_0000375 Ga0496122_0000375_89830_90822 330
535 3300048926 Ga0496123_0000267 Ga0496123_0000267_12236_13228 330
536 3300002704 JGI25155J39150_1000126 JGI25155J39150_100012635 331
537 3300002704 JGI25155J39150_1000177 JGI25155J39150_100017721 331
538 3300002705 JGI25156J39149_1000057 JGI25156J39149_100005768 331
539 3300002705 JGI25156J39149_1006062 JGI25156J39149_10060623 331
540 3300002738 JGI25154J39366_1000087 JGI25154J39366_100008721 331
541 3300002738 JGI25154J39366_1000206 JGI25154J39366_10002062 331
542 3300002741 JGI25157J39369_1000156 JGI25157J39369_100015621 331
543 3300003758 Ga0055532_1000016 Ga0055532_1000016310 331
544 3300005563 Ga0068855_100103100 Ga0068855_1001031003 331
545 3300005616 Ga0068852_100206566 Ga0068852_1002065662 331
546 3300009093 Ga0105240_10000569 Ga0105240_1000056963 331
547 3300025206 Ga0209435_100016 Ga0209435_100016194 331
548 3300025206 Ga0209435_100038 Ga0209435_10003876 331
549 3300025206 Ga0209435_100856 Ga0209435_1008562 331
550 3300025229 Ga0209147_100023 Ga0209147_100023134 331
551 3300025233 Ga0209437_100166 Ga0209437_10016655 331
552 3300025242 Ga0209258_100368 Ga0209258_10036813 331
553 3300025246 Ga0209646_1000033 Ga0209646_1000033115 331
554 3300025246 Ga0209646_1000093 Ga0209646_100009380 331
555 3300025250 Ga0209026_1000031 Ga0209026_1000031134 331
556 3300025250 Ga0209026_1003457 Ga0209026_10034572 331
557 3300025256 Ga0209759_1000045 Ga0209759_100004540 331
558 3300025256 Ga0209759_1000248 Ga0209759_100024886 331
559 3300025913 Ga0207695_10008793 Ga0207695_100087937 331
560 3300025949 Ga0207667_10133522 Ga0207667_101335222 331
561 3300026142 Ga0207698_10197962 Ga0207698_101979622 331
562 3300046660 Ga0495625_0001424 Ga0495625_0001424_18757_19752 331
563 3300048919 Ga0496116_0007861 Ga0496116_0007861_2513_3508 331
564 3300048924 Ga0496121_0009359 Ga0496121_0009359_8936_9931 331
565 3300048928 Ga0496125_0002855 Ga0496125_0002855_15370_16365 331
566 3300048928 Ga0496125_0029723 Ga0496125_0029723_2411_3406 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

134

277

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l22-assembly1.cif.gz_A prtd t1ss abc transporter 0.2731 9 225
7zc2-assembly1.cif.gz_A dipeptide and tripeptide permease c (dtpc) 0.2703 3 223
7ki0-assembly1.cif.gz_R semaglutide-bound glucagon-like peptide-1 (glp-1) receptor in complex with gs protein 0.2426 36 234
6xox-assembly1.cif.gz_R cryo-em of human glp-1r bound to non-peptide agonist ly3502970 0.2391 35 235
7ki1-assembly1.cif.gz_R taspoglutide-bound glucagon-like peptide-1 (glp-1) receptor in complex with gs protein 0.2334 38 235
ID Description Score Start End Superfamily
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3003 2 211 1.20.1640.10
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2658 2 211 1.20.1640.10
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2645 49 225 1.20.1080.10
af_I1MDI7_1_157_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2438 49 225 1.20.1080.10
af_Q9BXK5_11_208_1.10.437.10 Mainly Alpha;Orthogonal Bundle;Apoptosis Regulator Bcl-x;Blc2-like 0.2376 45 218 1.10.437.10
ID Description Score Start End GO Terms
AF-J3C2T7-F1-model_v4 Sterol desaturase 0.9746 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-J3C2T7-F1-model_v4 Sterol desaturase 0.9688 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-G0F0F4-F1-model_v4 C-5 sterol desaturase Erg 0.9684 6 324 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A0U3MSA0-F1-model_v4 Fatty acid hydroxylase superfamily protein 0.9667 6 325 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A7X4GLJ4-F1-model_v4 Fatty acid hydroxylase 0.9652 5 331 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479

Feature Viewer

pLDDT pTM Quality
88.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map