F464334

General Info

Members Datasets Scaffolds Average Seq Length
565 384 446 115

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2970524798|2970529007
Length 134
Sequence IIIFGYAQWREEDMTVATSPQTASPSVPPIDGIFRALADPTRRRVVERLNRSPASVSELAQPFDMALPSFVEHLRVLEGCGLVHSEKAGRVRTYRLAPEPLKLAESWLAEQRALWERRLDQLDAYVMTLKEKDK

Samples

Sample ID Description Type Environment
1 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
2 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
5 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
6 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
7 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
8 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
9 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
10 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
11 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
12 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
16 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
17 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
18 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
19 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
20 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
21 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
22 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
23 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
24 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
25 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
26 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
27 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
28 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
29 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
30 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
31 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
32 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
33 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
34 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
35 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
36 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
37 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
38 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
39 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
40 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
41 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
42 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
43 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
44 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
45 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
46 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
47 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
48 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
49 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
50 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
51 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
52 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
53 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
54 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
55 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
56 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
57 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
58 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
59 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
60 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
61 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
62 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
63 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
64 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
65 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
66 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
67 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
68 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
69 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
70 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
71 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
72 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
73 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
74 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
75 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
76 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
77 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
78 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
79 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
80 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
81 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
82 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
83 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
84 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
85 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
86 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
87 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
88 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
89 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
90 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
91 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
92 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
93 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
94 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
95 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
96 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
97 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
98 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
99 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
100 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
101 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
102 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
103 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
104 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
105 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
106 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
107 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
108 3004167301 Mesorhizobium loti 582 Isolate Unclassified
109 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
110 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
111 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
112 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
113 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
114 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
115 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
116 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
117 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
118 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
119 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
126 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
127 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
128 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
129 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
130 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
131 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
132 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
133 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
136 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
137 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
138 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
139 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
140 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
141 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
142 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
143 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
144 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
145 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
146 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
147 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
150 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
151 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
152 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
153 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
154 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
155 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
156 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
157 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
158 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
159 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
160 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
161 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
162 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
163 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
164 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
165 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
168 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
169 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
170 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
171 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
173 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
174 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
175 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
176 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
177 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
178 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
179 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
180 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
181 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
182 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
183 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
184 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
185 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
186 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
187 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
188 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
189 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
190 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
191 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
192 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
193 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
194 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
195 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
196 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
197 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
198 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
199 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
200 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
201 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
202 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
203 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
204 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
205 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
206 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
207 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
264 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
265 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
266 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
267 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
268 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
297 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
346 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
347 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
363 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
379 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
380 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
381 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
382 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
383 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
384 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.94
Metatranscriptomes 0
Isolates 21.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.99
Nodule 17.17
Rhizoplane 2.65
Rhizosphere 58.05
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10195603 3300001979 Bacteria 501
2 JGI24739J22299_10192473 3300001989 Bacteria 599
3 JGI25165J46597_1000016 3300003214 Bacteria 377866
4 Ga0055542_1000172 3300003762 Bacteria 80034
5 Ga0065704_10079924 3300005289 Unclassified 4047
6 Ga0065715_10437595 3300005293 Bacteria 840
7 Ga0070658_10521933 3300005327 Bacteria 1027
8 Ga0070676_10004641 3300005328 Bacteria 7256
9 Ga0070683_100236060 3300005329 Unclassified 1739
10 Ga0070690_100043614 3300005330 Bacteria 2845
11 Ga0070670_100254643 3300005331 Bacteria 1530
12 Ga0070677_10593923 3300005333 Bacteria 612
13 Ga0068869_100434289 3300005334 Bacteria 1086
14 Ga0070666_10009622 3300005335 Bacteria 6032
15 Ga0070666_10134421 3300005335 Bacteria 1720
16 Ga0070689_100110142 3300005340 Bacteria 2189
17 Ga0070689_101076382 3300005340 Bacteria 718
18 Ga0070668_100350062 3300005347 Bacteria 1250
19 Ga0070668_100566270 3300005347 Unclassified 990
20 Ga0070668_101062029 3300005347 Bacteria 730
21 Ga0070669_100920442 3300005353 Bacteria 747
22 Ga0070675_100007265 3300005354 Bacteria 8546
23 Ga0070675_100951267 3300005354 Bacteria 788
24 Ga0070675_100958374 3300005354 Bacteria 785
25 Ga0070671_100046594 3300005355 Bacteria 3606
26 Ga0070671_100121661 3300005355 Bacteria 2197
27 Ga0070674_100918380 3300005356 Bacteria 763
28 Ga0070659_100089716 3300005366 Bacteria 2462
29 Ga0070667_100007565 3300005367 Bacteria 9012
30 Ga0070667_101016132 3300005367 Bacteria 774
31 Ga0070667_102325545 3300005367 Bacteria 505
32 Ga0070663_100315012 3300005455 Bacteria 1256
33 Ga0070678_100009598 3300005456 Bacteria 5872
34 Ga0070681_10477278 3300005458 Bacteria 1160
35 Ga0070681_10567970 3300005458 Bacteria 1048
36 Ga0068867_100004874 3300005459 Bacteria 9447
37 Ga0070706_100050889 3300005467 Bacteria 3822
38 Ga0070706_100959708 3300005467 Bacteria 789
39 Ga0070684_101533354 3300005535 Bacteria 628
40 Ga0068853_100009790 3300005539 Bacteria 7736
41 Ga0068853_100152218 3300005539 Bacteria 2082
42 Ga0068853_100747910 3300005539 Bacteria 934
43 Ga0070672_100004907 3300005543 Bacteria 8800
44 Ga0070695_100620698 3300005545 Bacteria 851
45 Ga0070695_101396365 3300005545 Unclassified 581
46 Ga0070696_100221454 3300005546 Bacteria 1420
47 Ga0070665_100028490 3300005548 Bacteria 5624
48 Ga0070704_100207832 3300005549 Unclassified 1584
49 Ga0068855_100225116 3300005563 Bacteria 2102
50 Ga0068855_101513486 3300005563 Bacteria 689
51 Ga0068857_100007844 3300005577 Bacteria 9206
52 Ga0068857_102228687 3300005577 Bacteria 538
53 Ga0068856_101143853 3300005614 Bacteria 795
54 Ga0070702_101133844 3300005615 Unclassified 627
55 Ga0068852_100175522 3300005616 Bacteria 2012
56 Ga0068859_100155575 3300005617 Bacteria 2363
57 Ga0068859_100213471 3300005617 Bacteria 2016
58 Ga0068864_100007408 3300005618 Bacteria 9034
59 Ga0068864_100367631 3300005618 Unclassified 1360
60 Ga0068866_10114917 3300005718 Unclassified 1508
61 Ga0068861_101762318 3300005719 Bacteria 614
62 Ga0068870_10009071 3300005840 Bacteria 4505
63 Ga0068863_100064252 3300005841 Bacteria 3471
64 Ga0068863_100258004 3300005841 Unclassified 1685
65 Ga0068858_100025579 3300005842 Bacteria 5492
66 Ga0068858_100199918 3300005842 Bacteria 1890
67 Ga0068858_100291962 3300005842 Unclassified 1554
68 Ga0068858_100938407 3300005842 Bacteria 847
69 Ga0068860_100006112 3300005843 Bacteria 12110
70 Ga0068860_100013607 3300005843 Bacteria 7975
71 Ga0068860_100124056 3300005843 Unclassified 2475
72 Ga0068860_100283735 3300005843 Bacteria 1619
73 Ga0068862_100196144 3300005844 Bacteria 1819
74 Ga0068862_100524830 3300005844 Bacteria 1127
75 Ga0081455_10602368 3300005937 Bacteria 716
76 Ga0075365_10010622 3300006038 Bacteria 5375
77 Ga0075365_10011552 3300006038 Bacteria 5197
78 Ga0075365_10083877 3300006038 Bacteria 2162
79 Ga0075365_10155982 3300006038 Bacteria 1589
80 Ga0075365_10192328 3300006038 Bacteria 1428
81 Ga0075365_10229147 3300006038 Bacteria 1304
82 Ga0075365_10394381 3300006038 Bacteria 977
83 Ga0075365_10417795 3300006038 Bacteria 947
84 Ga0075368_10123415 3300006042 Bacteria 1074
85 Ga0075368_10304650 3300006042 Bacteria 688
86 Ga0075368_10398936 3300006042 Bacteria 604
87 Ga0075363_100114661 3300006048 Bacteria 1500
88 Ga0075364_10115826 3300006051 Bacteria 1791
89 Ga0075364_10354760 3300006051 Bacteria 1000
90 Ga0075364_10646453 3300006051 Bacteria 722
91 Ga0075362_10016284 3300006177 Bacteria 3041
92 Ga0075362_10026139 3300006177 Bacteria 2491
93 Ga0075362_10054880 3300006177 Bacteria 1792
94 Ga0075362_10136168 3300006177 Bacteria 1171
95 Ga0075362_10285990 3300006177 Bacteria 816
96 Ga0075367_10055496 3300006178 Bacteria 2351
97 Ga0075367_10103053 3300006178 Bacteria 1746
98 Ga0075367_10228070 3300006178 Bacteria 1166
99 Ga0075367_10477211 3300006178 Bacteria 791
100 Ga0075369_10004094 3300006186 Bacteria 5365
101 Ga0075369_10207651 3300006186 Bacteria 905
102 Ga0075369_10326044 3300006186 Bacteria 719
103 Ga0075366_10129952 3300006195 Bacteria 1520
104 Ga0075366_10133416 3300006195 Bacteria 1499
105 Ga0075366_10257512 3300006195 Bacteria 1065
106 Ga0075366_10609354 3300006195 Bacteria 677
107 Ga0097621_100011941 3300006237 Bacteria 6424
108 Ga0097621_101528807 3300006237 Bacteria 634
109 Ga0075370_10243353 3300006353 Bacteria 1065
110 Ga0075370_10246098 3300006353 Bacteria 1059
111 Ga0075370_10644535 3300006353 Bacteria 643
112 Ga0068871_100010536 3300006358 Bacteria 6753
113 Ga0068871_100076035 3300006358 Bacteria 2773
114 Ga0075428_100045172 3300006844 Bacteria 4841
115 Ga0075428_100118979 3300006844 Bacteria 2877
116 Ga0075428_100840968 3300006844 Bacteria 975
117 Ga0075430_100000987 3300006846 Bacteria 22451
118 Ga0075430_100507389 3300006846 Bacteria 995
119 Ga0075431_100007436 3300006847 Bacteria 10909
120 Ga0075431_100093249 3300006847 Bacteria 3108
121 Ga0075431_101925512 3300006847 Bacteria 547
122 Ga0075433_10087097 3300006852 Bacteria 2758
123 Ga0075434_100005931 3300006871 Bacteria 11178
124 Ga0075429_100003695 3300006880 Bacteria 13035
125 Ga0075429_100067171 3300006880 Bacteria 3120
126 Ga0075429_100790391 3300006880 Bacteria 831
127 Ga0075429_100871653 3300006880 Unclassified 788
128 Ga0068865_100006382 3300006881 Bacteria 7187
129 Ga0075436_100953843 3300006914 Bacteria 643
130 Ga0097620_100155571 3300006931 Bacteria 2363
131 Ga0097620_100213463 3300006931 Bacteria 2016
132 Ga0075435_101189982 3300007076 Bacteria 667
133 Ga0099795_10227851 3300007788 Bacteria 796
134 Ga0105251_10450926 3300009011 Unclassified 596
135 Ga0105240_10041488 3300009093 Bacteria 5873
136 Ga0105247_11223055 3300009101 Unclassified 599
137 Ga0114129_10013251 3300009147 Bacteria 11743
138 Ga0114129_10173444 3300009147 Bacteria 2938
139 Ga0114129_10450423 3300009147 Bacteria 1688
140 Ga0114129_11826534 3300009147 Bacteria 738
141 Ga0114129_12430833 3300009147 Bacteria 627
142 Ga0105243_10423399 3300009148 Bacteria 1243
143 Ga0105243_12393024 3300009148 Unclassified 566
144 Ga0105241_10013134 3300009174 Bacteria 6077
145 Ga0105241_10153764 3300009174 Bacteria 1884
146 Ga0105241_10524994 3300009174 Bacteria 1059
147 Ga0105248_10001222 3300009177 Bacteria 28675
148 Ga0105248_10214679 3300009177 Bacteria 2167
149 Ga0105248_10274189 3300009177 Bacteria 1899
150 Ga0105237_10027026 3300009545 Bacteria 5861
151 Ga0105237_10537599 3300009545 Bacteria 1175
152 Ga0105237_10572824 3300009545 Bacteria 1136
153 Ga0105237_11137840 3300009545 Bacteria 787
154 Ga0105238_10002917 3300009551 Bacteria 17078
155 Ga0105238_10652726 3300009551 Bacteria 1062
156 Ga0105238_11019382 3300009551 Bacteria 849
157 Ga0105249_10061692 3300009553 Bacteria 3441
158 Ga0105249_10338327 3300009553 Bacteria 1521
159 Ga0105249_11884673 3300009553 Bacteria 670
160 Ga0105249_12911190 3300009553 Bacteria 549
161 Ga0105239_10063343 3300010375 Bacteria 4060
162 Ga0105239_10101350 3300010375 Bacteria 3185
163 Ga0105239_11262766 3300010375 Bacteria 852
164 Ga0105239_11732074 3300010375 Bacteria 724
165 Ga0105239_12881395 3300010375 Bacteria 561
166 Ga0157370_10153410 3300013104 Bacteria 2143
167 Ga0157370_10638273 3300013104 Bacteria 974
168 Ga0157369_10153056 3300013105 Bacteria 2437
169 Ga0157369_10714163 3300013105 Bacteria 1032
170 Ga0157374_10003730 3300013296 Bacteria 12803
171 Ga0157374_11181262 3300013296 Unclassified 786
172 Ga0157374_11220324 3300013296 Bacteria 773
173 Ga0157378_10852950 3300013297 Bacteria 939
174 Ga0163162_10024800 3300013306 Bacteria 5925
175 Ga0163162_10193758 3300013306 Bacteria 2160
176 Ga0157372_10265707 3300013307 Bacteria 1992
177 Ga0157375_10131589 3300013308 Bacteria 2622
178 Ga0163163_11347715 3300014325 Bacteria 775
179 Ga0163163_11435874 3300014325 Bacteria 751
180 Ga0163163_12608712 3300014325 Bacteria 563
181 Ga0157377_11495523 3300014745 Bacteria 536
182 Ga0157379_10003011 3300014968 Bacteria 14227
183 Ga0157379_10381896 3300014968 Bacteria 1292
184 Ga0157376_10175529 3300014969 Bacteria 1954
185 Ga0157376_10732966 3300014969 Bacteria 996
186 Ga0209148_1000057 3300025254 Bacteria 360463
187 Ga0209233_1000068 3300025261 Bacteria 377969
188 Ga0209233_1038271 3300025261 Bacteria 1059
189 Ga0209455_1000240 3300025272 Bacteria 68476
190 Ga0207697_10007205 3300025315 Bacteria 4970
191 Ga0207682_10116111 3300025893 Bacteria 1183
192 Ga0207688_10692798 3300025901 Bacteria 644
193 Ga0207680_10023691 3300025903 Bacteria 3356
194 Ga0207680_10449502 3300025903 Bacteria 914
195 Ga0207647_10547454 3300025904 Bacteria 642
196 Ga0207645_10306472 3300025907 Bacteria 1058
197 Ga0207654_10022478 3300025911 Unclassified 3365
198 Ga0207654_10519744 3300025911 Bacteria 843
199 Ga0207654_10531290 3300025911 Bacteria 834
200 Ga0207695_10433692 3300025913 Bacteria 1198
201 Ga0207695_10812519 3300025913 Unclassified 815
202 Ga0207695_10934874 3300025913 Bacteria 747
203 Ga0207671_10008635 3300025914 Bacteria 8609
204 Ga0207681_10034544 3300025923 Bacteria 3325
205 Ga0207694_10051034 3300025924 Bacteria 3206
206 Ga0207694_10241127 3300025924 Bacteria 1477
207 Ga0207650_10031741 3300025925 Bacteria 3816
208 Ga0207659_10008074 3300025926 Bacteria 6516
209 Ga0207659_10577609 3300025926 Bacteria 957
210 Ga0207690_10214845 3300025932 Bacteria 1468
211 Ga0207670_10033884 3300025936 Bacteria 3295
212 Ga0207704_10101761 3300025938 Bacteria 1917
213 Ga0207691_10000328 3300025940 Bacteria 47302
214 Ga0207711_10015761 3300025941 Bacteria 6269
215 Ga0207711_10165119 3300025941 Bacteria 2006
216 Ga0207711_10180317 3300025941 Bacteria 1920
217 Ga0207711_11734275 3300025941 Unclassified 568
218 Ga0207661_10181718 3300025944 Unclassified 1838
219 Ga0207651_10007297 3300025960 Bacteria 5876
220 Ga0207712_10326018 3300025961 Bacteria 1269
221 Ga0207712_11764235 3300025961 Unclassified 555
222 Ga0207668_10014932 3300025972 Bacteria 4816
223 Ga0207668_10087046 3300025972 Bacteria 2284
224 Ga0207668_10846406 3300025972 Bacteria 812
225 Ga0207658_10006246 3300025986 Bacteria 8141
226 Ga0207658_10284028 3300025986 Bacteria 1420
227 Ga0207703_10017883 3300026035 Bacteria 5536
228 Ga0207703_10139067 3300026035 Bacteria 2105
229 Ga0207703_10217405 3300026035 Unclassified 1707
230 Ga0207639_10120441 3300026041 Bacteria 2155
231 Ga0207639_10800148 3300026041 Bacteria 878
232 Ga0207678_10753388 3300026067 Bacteria 859
233 Ga0207641_10012496 3300026088 Bacteria 6959
234 Ga0207641_10420170 3300026088 Bacteria 1287
235 Ga0207648_10001220 3300026089 Bacteria 28819
236 Ga0207676_10079807 3300026095 Bacteria 2654
237 Ga0207676_10165166 3300026095 Unclassified 1922
238 Ga0207674_10000920 3300026116 Bacteria 38313
239 Ga0207674_10990507 3300026116 Bacteria 810
240 Ga0207674_11036550 3300026116 Unclassified 790
241 Ga0207683_10000807 3300026121 Bacteria 28669
242 Ga0209813_10125120 3300027866 Bacteria 899
243 Ga0209813_10237355 3300027866 Bacteria 688
244 Ga0268266_10055814 3300028379 Bacteria 3396
245 Ga0268266_10174164 3300028379 Bacteria 1955
246 Ga0268266_11555298 3300028379 Bacteria 637
247 Ga0268264_10011189 3300028381 Bacteria 7411
248 Ga0268264_10203306 3300028381 Bacteria 1813
249 Ga0268264_11249735 3300028381 Bacteria 752
250 Ga0307405_11388519 3300031731 Unclassified 614
251 Ga0307413_10318731 3300031824 Bacteria 1187
252 Ga0307413_10891821 3300031824 Bacteria 755
253 Ga0307416_100194572 3300032002 Unclassified 1917
254 Ga0307415_100843640 3300032126 Unclassified 840
255 Ga0307415_101221566 3300032126 Bacteria 709
256 Ga0373944_0019077 3300035089 Bacteria 1965
257 Ga0373936_0115008 3300035113 Bacteria 1145
258 Ga0373945_0019775 3300035116 Bacteria 2300
259 Ga0373943_0088303 3300035170 Bacteria 1601
260 Ga0373946_0027960 3300035171 Bacteria 2234
261 Ga0373942_0140422 3300035207 Unclassified 769
262 Ga0373962_0389870 3300035242 Bacteria 511
263 Ga0373931_0266587 3300035691 Unclassified 1047
264 Ga0373931_0696684 3300035691 Bacteria 671
265 Ga0373931_0930464 3300035691 Bacteria 585
266 Ga0373935_0109556 3300035692 Bacteria 1831
267 Ga0373927_0025832 3300035695 Bacteria 3839
268 Ga0373927_0143638 3300035695 Unclassified 1562
269 Ga0373947_0083528 3300035725 Bacteria 1980
270 Ga0373925_0125637 3300037068 Bacteria 1995
271 Ga0395900_0202444 3300037418 Bacteria 2008
272 Ga0395900_0236455 3300037418 Bacteria 1835
273 Ga0395905_0148537 3300037471 Bacteria 2205
274 Ga0395905_0520744 3300037471 Bacteria 1090
275 Ga0395901_0088383 3300038443 Bacteria 3241
276 Ga0395901_0493964 3300038443 Bacteria 1247
277 Ga0451795_0098730 3300041456 Bacteria 744
278 Ga0451833_1481792 3300041491 Bacteria 605
279 Ga0451841_0049401 3300041498 Bacteria 547
280 Ga0451847_0674360 3300041503 Bacteria 636
281 Ga0451843_1316481 3300041509 Bacteria 1345
282 Ga0451853_2932347 3300041512 Bacteria 574
283 Ga0466963_0452201 3300044694 Unclassified 906
284 Ga0466959_0309020 3300045049 Bacteria 1082
285 Ga0466959_0622942 3300045049 Unclassified 725
286 Ga0451576_0140380 3300045051 Bacteria 2520
287 Ga0495603_0032915 3300046455 Bacteria 3119
288 Ga0495590_0065011 3300046457 Bacteria 1277
289 Ga0495629_1100620 3300046459 Bacteria 514
290 Ga0495638_0168596 3300046460 Bacteria 1258
291 Ga0495638_0337643 3300046460 Bacteria 800
292 Ga0495580_0649628 3300046472 Bacteria 694
293 Ga0495582_0090773 3300046473 Bacteria 1703
294 Ga0495639_0137386 3300046475 Bacteria 1173
295 Ga0495585_0084571 3300046492 Bacteria 1716
296 Ga0495594_0020793 3300046499 Bacteria 3498
297 Ga0495616_0291601 3300046513 Bacteria 691
298 Ga0495620_0277538 3300046515 Bacteria 638
299 Ga0495631_0322466 3300046518 Bacteria 657
300 Ga0495632_0093077 3300046519 Bacteria 1427
301 Ga0495637_0138414 3300046520 Bacteria 925
302 Ga0495666_0140448 3300046526 Bacteria 1126
303 Ga0495598_0023831 3300046537 Bacteria 1652
304 Ga0495621_0109329 3300046539 Bacteria 1059
305 Ga0495656_0047113 3300046615 Bacteria 1827
306 Ga0495668_0321127 3300046616 Bacteria 849
307 Ga0495634_0206834 3300046642 Bacteria 1217
308 Ga0495625_0045532 3300046660 Bacteria 3171
309 Ga0495588_0141669 3300046674 Bacteria 1270
310 Ga0495647_0321413 3300046681 Bacteria 700
311 Ga0495658_0387302 3300046683 Bacteria 890
312 Ga0495658_0696114 3300046683 Unclassified 651
313 Ga0495669_0077137 3300046684 Bacteria 1526
314 Ga0495613_0333293 3300046689 Bacteria 1045
315 Ga0495624_0132313 3300046690 Bacteria 1529
316 Ga0495670_0100235 3300046691 Bacteria 1491
317 Ga0495581_0327431 3300047315 Bacteria 895
318 Ga0495676_0052076 3300047321 Bacteria 3270
319 Ga0495684_0164393 3300047471 Bacteria 1654
320 Ga0495686_0341804 3300047472 Bacteria 816
321 Ga0495686_0401078 3300047472 Bacteria 736
322 Ga0495593_0187486 3300047673 Bacteria 1041
323 Ga0495615_0326514 3300048090 Bacteria 502
324 Ga0495626_0374504 3300048091 Bacteria 553
325 Ga0496101_0300666 3300048904 Bacteria 1257
326 Ga0496103_0700554 3300048906 Bacteria 642
327 Ga0496104_0137539 3300048907 Bacteria 2347
328 Ga0496104_0335579 3300048907 Bacteria 1425
329 Ga0496105_0106828 3300048908 Bacteria 2311
330 Ga0496106_0750865 3300048909 Bacteria 776
331 Ga0496107_0120890 3300048910 Bacteria 1929
332 Ga0496108_0377546 3300048911 Bacteria 1238
333 Ga0496110_1088314 3300048913 Unclassified 707
334 Ga0496114_1067136 3300048917 Unclassified 692
335 Ga0496115_0283856 3300048918 Bacteria 1359
336 Ga0496115_0328263 3300048918 Bacteria 1250
337 Ga0496115_1440761 3300048918 Bacteria 507
338 Ga0496119_0023858 3300048922 Bacteria 4323
339 Ga0496119_0105353 3300048922 Bacteria 1575
340 Ga0496120_0002038 3300048923 Bacteria 21901
341 Ga0496121_0400809 3300048924 Bacteria 899
342 Ga0496125_0059505 3300048928 Bacteria 3078
343 Ga0496126_0072915 3300048929 Plasmid 3053
344 Ga0496126_0515968 3300048929 Bacteria 953
345 Ga0501032_0170746 3300049569 Bacteria 1426
346 Ga0501033_0012011 3300049570 Bacteria 6615
347 Ga0501034_0378986 3300049571 Bacteria 1340
348 Ga0501034_0997027 3300049571 Bacteria 722
349 Ga0501034_1368940 3300049571 Unclassified 583
350 Ga0501036_0018128 3300049572 Bacteria 5894
351 Ga0501037_1001182 3300049573 Bacteria 544
352 Ga0501038_0033554 3300049574 Bacteria 4521
353 Ga0501040_0057575 3300049576 Bacteria 2668
354 Ga0501041_0074248 3300049577 Bacteria 2089
355 Ga0501042_0020709 3300049578 Bacteria 4578
356 Ga0501046_0010995 3300049580 Bacteria 7759
357 Ga0501048_0034745 3300049582 Bacteria 3634
358 Ga0501071_0095260 3300049587 Bacteria 2190
359 Ga0501072_0040309 3300049588 Bacteria 3667
360 Ga0501073_0014169 3300049589 Bacteria 5789
361 Ga0501074_0186084 3300049590 Bacteria 1481
362 Ga0501075_0020152 3300049591 Bacteria 4845
363 Ga0501076_0004321 3300049592 Bacteria 10078
364 Ga0501076_1715801 3300049592 Bacteria 515
365 Ga0501077_0126303 3300049593 Bacteria 1621
366 Ga0501079_0035305 3300049741 Bacteria 3848
367 Ga0501080_0366581 3300049742 Bacteria 1299
368 Ga0501081_0157548 3300049743 Bacteria 1634
369 Ga0501083_0077308 3300049744 Bacteria 2209
370 Ga0501083_0660106 3300049744 Bacteria 680
371 Ga0501035_0355064 3300049822 Bacteria 1226
372 Ga0501045_0020458 3300049824 Bacteria 4726
373 nmdc:mga03683_152792_c1 3300050489 Bacteria 1042
374 nmdc:mga03683_265784_c1 3300050489 Bacteria 799
375 nmdc:mga03683_364460_c1 3300050489 Bacteria 686
376 nmdc:mga03683_413365_c1 3300050489 Bacteria 645
377 nmdc:mga03683_42642_c1 3300050489 Bacteria 1868
378 nmdc:mga03683_43084_c1 3300050489 Bacteria 1860
379 nmdc:mga03n38_29837_c1 3300050490 Bacteria 2286
380 nmdc:mga03n38_316954_c1 3300050490 Bacteria 841
381 nmdc:mga03n38_43019_c1 3300050490 Bacteria 1978
382 nmdc:mga00v17_106451_c1 3300050491 Bacteria 1775
383 nmdc:mga00v17_505690_c1 3300050491 Bacteria 783
384 nmdc:mga00v17_741770_c1 3300050491 Bacteria 628
385 nmdc:mga0yw44_1230611_c1 3300050492 Bacteria 505
386 nmdc:mga0yw44_302171_c1 3300050492 Bacteria 1072
387 nmdc:mga0yw44_331948_c1 3300050492 Bacteria 1022
388 nmdc:mga0yw44_3617_c1 3300050492 Bacteria 6897
389 nmdc:mga0yw44_440275_c1 3300050492 Bacteria 883
390 nmdc:mga0yw44_48924_c1 3300050492 Bacteria 2550
391 nmdc:mga0yw44_52111_c1 3300050492 Bacteria 2480
392 nmdc:mga0yw44_528426_c1 3300050492 Bacteria 801
393 nmdc:mga0k408_125982_c1 3300050493 Bacteria 1519
394 nmdc:mga0k408_521151_c1 3300050493 Bacteria 704
395 nmdc:mga0k408_77766_c1 3300050493 Bacteria 1079
396 nmdc:mga0k408_783368_c1 3300050493 Bacteria 556
397 nmdc:mga06z11_166548_c1 3300050494 Bacteria 1263
398 nmdc:mga06z11_231058_c1 3300050494 Bacteria 1084
399 nmdc:mga06z11_608331_c1 3300050494 Bacteria 665
400 nmdc:mga06z11_666556_c1 3300050494 Bacteria 633
401 nmdc:mga06z11_693302_c1 3300050494 Bacteria 620
402 nmdc:mga06z11_946908_c1 3300050494 Bacteria 525
403 nmdc:mga04h51_138917_c1 3300050495 Bacteria 920
404 nmdc:mga07m45_186945_c1 3300050496 Bacteria 1204
405 nmdc:mga07m45_21663_c1 3300050496 Bacteria 3501
406 nmdc:mga07m45_488220_c1 3300050496 Bacteria 713
407 nmdc:mga07m45_71126_c1 3300050496 Bacteria 1077
408 nmdc:mga07m45_79785_c1 3300050496 Bacteria 1868
409 nmdc:mga05p37_1232224_c1 3300050507 Bacteria 770
410 nmdc:mga05p37_18584_c1 3300050507 Bacteria 8401
411 nmdc:mga09592_39424_c1 3300050508 Bacteria 3968
412 nmdc:mga09592_55343_c1 3300050508 Bacteria 3353
413 nmdc:mga09592_737205_c1 3300050508 Unclassified 837
414 nmdc:mga0qj67_3566_c1 3300050509 Bacteria 11233
415 nmdc:mga0qj67_478655_c1 3300050509 Bacteria 1002
416 nmdc:mga06r32_1044_c1 3300050510 Bacteria 24972
417 nmdc:mga06r32_304853_c1 3300050510 Bacteria 1578
418 nmdc:mga06r32_448872_c1 3300050510 Bacteria 1269
419 nmdc:mga0n895_2943_c1 3300050512 Bacteria 13510
420 nmdc:mga0rr50_1128461_c1 3300050513 Bacteria 667
421 nmdc:mga0a205_129809_c1 3300050515 Bacteria 2421
422 nmdc:mga0sz30_10879_c1 3300050516 Bacteria 3498
423 nmdc:mga0sz30_17471_c1 3300050516 Bacteria 2861
424 nmdc:mga0sz30_84234_c1 3300050516 Bacteria 1378
425 Ga0500610_0148667 3300053079 Bacteria 1176
426 Ga0495655_0016524 3300053083 Bacteria 1591
427 Ga0495655_0322059 3300053083 Bacteria 536
428 Ga0495619_0101780 3300053085 Bacteria 1956
429 Ga0500643_057043 3300053087 Bacteria 1103
430 Ga0500651_0675196 3300053093 Bacteria 554
431 Ga0500555_004132 3300053103 Bacteria 4130
432 Ga0500592_031971 3300053116 Bacteria 849
433 Ga0500595_053821 3300053119 Bacteria 1238
434 Ga0500658_0261418 3300053134 Bacteria 796
435 Ga0500604_0019073 3300053151 Bacteria 1917
436 Ga0500604_0082255 3300053151 Bacteria 1042
437 Ga0500616_0112006 3300053153 Bacteria 1317
438 Ga0500620_000301 3300053155 Bacteria 9422
439 Ga0500627_0038343 3300053158 Bacteria 2048
440 Ga0500627_0052658 3300053158 Bacteria 1777
441 Ga0500627_0135299 3300053158 Bacteria 1113
442 Ga0500611_008828 3300053727 Bacteria 1575
443 Ga0501084_0013582 3300054114 Bacteria 6739
444 Ga0501082_0036442 3300060353 Bacteria 4238
445 Ga0501082_0068914 3300060353 Bacteria 3046
446 Ga0530510_0017143 3300061734 Bacteria 5130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_1316481 Ga0451843_1316481_588_935 102
2 3300007788 Ga0099795_10227851 Ga0099795_102278512 104
3 iso_pu_bacteria 2929199973 2929202226 104
4 iso_pu_bacteria 8055909800 8055916643 104
5 3300005617 Ga0068859_100155575 Ga0068859_1001555754 105
6 3300005618 Ga0068864_100367631 Ga0068864_1003676313 105
7 3300005841 Ga0068863_100258004 Ga0068863_1002580042 105
8 3300005842 Ga0068858_100938407 Ga0068858_1009384072 105
9 3300005843 Ga0068860_100124056 Ga0068860_1001240562 105
10 3300005844 Ga0068862_100196144 Ga0068862_1001961442 105
11 3300006931 Ga0097620_100155571 Ga0097620_1001555714 105
12 3300009011 Ga0105251_10450926 Ga0105251_104509261 105
13 3300009147 Ga0114129_10450423 Ga0114129_104504232 105
14 3300009553 Ga0105249_10061692 Ga0105249_100616922 105
15 3300013308 Ga0157375_10131589 Ga0157375_101315894 105
16 3300025941 Ga0207711_11734275 Ga0207711_117342752 105
17 3300025961 Ga0207712_10326018 Ga0207712_103260182 105
18 3300026095 Ga0207676_10165166 Ga0207676_101651662 105
19 3300035695 Ga0373927_0143638 Ga0373927_0143638_364_690 105
20 3300053087 Ga0500643_057043 Ga0500643_057043_206_580 105
21 iso_pu_bacteria 2671180531 2673164467 105
22 3300005328 Ga0070676_10004641 Ga0070676_1000464110 106
23 3300005330 Ga0070690_100043614 Ga0070690_1000436144 106
24 3300005331 Ga0070670_100254643 Ga0070670_1002546434 106
25 3300005333 Ga0070677_10593923 Ga0070677_105939231 106
26 3300005334 Ga0068869_100434289 Ga0068869_1004342891 106
27 3300005335 Ga0070666_10009622 Ga0070666_100096222 106
28 3300005335 Ga0070666_10134421 Ga0070666_101344213 106
29 3300005340 Ga0070689_100110142 Ga0070689_1001101421 106
30 3300005347 Ga0070668_100566270 Ga0070668_1005662701 106
31 3300005354 Ga0070675_100007265 Ga0070675_1000072655 106
32 3300005355 Ga0070671_100046594 Ga0070671_1000465942 106
33 3300005367 Ga0070667_100007565 Ga0070667_1000075656 106
34 3300005456 Ga0070678_100009598 Ga0070678_1000095984 106
35 3300005459 Ga0068867_100004874 Ga0068867_10000487410 106
36 3300005467 Ga0070706_100959708 Ga0070706_1009597082 106
37 3300005543 Ga0070672_100004907 Ga0070672_1000049076 106
38 3300005548 Ga0070665_100028490 Ga0070665_1000284903 106
39 3300005618 Ga0068864_100007408 Ga0068864_1000074082 106
40 3300005718 Ga0068866_10114917 Ga0068866_101149173 106
41 3300005840 Ga0068870_10009071 Ga0068870_100090712 106
42 3300005841 Ga0068863_100064252 Ga0068863_1000642523 106
43 3300005842 Ga0068858_100025579 Ga0068858_1000255792 106
44 3300005843 Ga0068860_100006112 Ga0068860_10000611211 106
45 3300006237 Ga0097621_100011941 Ga0097621_1000119415 106
46 3300006358 Ga0068871_100010536 Ga0068871_1000105366 106
47 3300006844 Ga0075428_100045172 Ga0075428_1000451723 106
48 3300006844 Ga0075428_100840968 Ga0075428_1008409682 106
49 3300006847 Ga0075431_101925512 Ga0075431_1019255121 106
50 3300006881 Ga0068865_100006382 Ga0068865_1000063823 106
51 3300009147 Ga0114129_12430833 Ga0114129_124308332 106
52 3300009148 Ga0105243_12393024 Ga0105243_123930241 106
53 3300009177 Ga0105248_10001222 Ga0105248_1000122210 106
54 3300009553 Ga0105249_10338327 Ga0105249_103383274 106
55 3300013296 Ga0157374_10003730 Ga0157374_100037303 106
56 3300013306 Ga0163162_10024800 Ga0163162_100248002 106
57 3300014325 Ga0163163_11435874 Ga0163163_114358741 106
58 3300014968 Ga0157379_10003011 Ga0157379_100030114 106
59 3300014969 Ga0157376_10175529 Ga0157376_101755294 106
60 3300025315 Ga0207697_10007205 Ga0207697_100072056 106
61 3300025893 Ga0207682_10116111 Ga0207682_101161111 106
62 3300025903 Ga0207680_10023691 Ga0207680_100236913 106
63 3300025903 Ga0207680_10449502 Ga0207680_104495021 106
64 3300025923 Ga0207681_10034544 Ga0207681_100345446 106
65 3300025925 Ga0207650_10031741 Ga0207650_100317413 106
66 3300025926 Ga0207659_10008074 Ga0207659_100080745 106
67 3300025936 Ga0207670_10033884 Ga0207670_100338843 106
68 3300025938 Ga0207704_10101761 Ga0207704_101017612 106
69 3300025940 Ga0207691_10000328 Ga0207691_1000032837 106
70 3300025941 Ga0207711_10015761 Ga0207711_100157614 106
71 3300025960 Ga0207651_10007297 Ga0207651_100072974 106
72 3300025961 Ga0207712_11764235 Ga0207712_117642351 106
73 3300025972 Ga0207668_10014932 Ga0207668_100149323 106
74 3300025986 Ga0207658_10006246 Ga0207658_100062466 106
75 3300026035 Ga0207703_10017883 Ga0207703_100178833 106
76 3300026088 Ga0207641_10012496 Ga0207641_100124962 106
77 3300026089 Ga0207648_10001220 Ga0207648_1000122012 106
78 3300026095 Ga0207676_10079807 Ga0207676_100798072 106
79 3300026121 Ga0207683_10000807 Ga0207683_100008079 106
80 3300028379 Ga0268266_10055814 Ga0268266_100558143 106
81 3300028381 Ga0268264_10011189 Ga0268264_100111894 106
82 3300044694 Ga0466963_0452201 Ga0466963_0452201_326_664 106
83 3300045049 Ga0466959_0309020 Ga0466959_0309020_126_464 106
84 3300045049 Ga0466959_0622942 Ga0466959_0622942_102_440 106
85 3300048911 Ga0496108_0377546 Ga0496108_0377546_519_881 106
86 3300048913 Ga0496110_1088314 Ga0496110_1088314_232_594 106
87 3300005340 Ga0070689_101076382 Ga0070689_1010763821 107
88 3300005347 Ga0070668_101062029 Ga0070668_1010620292 107
89 3300005353 Ga0070669_100920442 Ga0070669_1009204422 107
90 3300005354 Ga0070675_100958374 Ga0070675_1009583742 107
91 3300005355 Ga0070671_100121661 Ga0070671_1001216612 107
92 3300005366 Ga0070659_100089716 Ga0070659_1000897162 107
93 3300005455 Ga0070663_100315012 Ga0070663_1003150122 107
94 3300005467 Ga0070706_100050889 Ga0070706_1000508891 107
95 3300005539 Ga0068853_100747910 Ga0068853_1007479102 107
96 3300005545 Ga0070695_100620698 Ga0070695_1006206982 107
97 3300005545 Ga0070695_101396365 Ga0070695_1013963651 107
98 3300005546 Ga0070696_100221454 Ga0070696_1002214542 107
99 3300005549 Ga0070704_100207832 Ga0070704_1002078323 107
100 3300005614 Ga0068856_101143853 Ga0068856_1011438532 107
101 3300005615 Ga0070702_101133844 Ga0070702_1011338441 107
102 3300005617 Ga0068859_100213471 Ga0068859_1002134712 107
103 3300005719 Ga0068861_101762318 Ga0068861_1017623182 107
104 3300005842 Ga0068858_100199918 Ga0068858_1001999183 107
105 3300005842 Ga0068858_100291962 Ga0068858_1002919623 107
106 3300005843 Ga0068860_100013607 Ga0068860_10001360710 107
107 3300005843 Ga0068860_100283735 Ga0068860_1002837352 107
108 3300005844 Ga0068862_100524830 Ga0068862_1005248301 107
109 3300006178 Ga0075367_10103053 Ga0075367_101030532 107
110 3300006237 Ga0097621_101528807 Ga0097621_1015288072 107
111 3300006358 Ga0068871_100076035 Ga0068871_1000760353 107
112 3300006844 Ga0075428_100118979 Ga0075428_1001189793 107
113 3300006846 Ga0075430_100000987 Ga0075430_10000098713 107
114 3300006846 Ga0075430_100507389 Ga0075430_1005073892 107
115 3300006847 Ga0075431_100007436 Ga0075431_1000074365 107
116 3300006847 Ga0075431_100093249 Ga0075431_1000932493 107
117 3300006852 Ga0075433_10087097 Ga0075433_100870973 107
118 3300006871 Ga0075434_100005931 Ga0075434_1000059313 107
119 3300006880 Ga0075429_100003695 Ga0075429_1000036955 107
120 3300006880 Ga0075429_100067171 Ga0075429_1000671714 107
121 3300006880 Ga0075429_100790391 Ga0075429_1007903913 107
122 3300006880 Ga0075429_100871653 Ga0075429_1008716532 107
123 3300006914 Ga0075436_100953843 Ga0075436_1009538432 107
124 3300006931 Ga0097620_100213463 Ga0097620_1002134634 107
125 3300007076 Ga0075435_101189982 Ga0075435_1011899822 107
126 3300009101 Ga0105247_11223055 Ga0105247_112230552 107
127 3300009147 Ga0114129_10013251 Ga0114129_100132517 107
128 3300009147 Ga0114129_10173444 Ga0114129_101734444 107
129 3300009147 Ga0114129_11826534 Ga0114129_118265342 107
130 3300009177 Ga0105248_10214679 Ga0105248_102146792 107
131 3300009177 Ga0105248_10274189 Ga0105248_102741893 107
132 3300009553 Ga0105249_11884673 Ga0105249_118846732 107
133 3300009553 Ga0105249_12911190 Ga0105249_129111901 107
134 3300010375 Ga0105239_11732074 Ga0105239_117320742 107
135 3300013296 Ga0157374_11181262 Ga0157374_111812622 107
136 3300013297 Ga0157378_10852950 Ga0157378_108529502 107
137 3300013306 Ga0163162_10193758 Ga0163162_101937582 107
138 3300014325 Ga0163163_11347715 Ga0163163_113477151 107
139 3300014325 Ga0163163_12608712 Ga0163163_126087122 107
140 3300014745 Ga0157377_11495523 Ga0157377_114955232 107
141 3300014968 Ga0157379_10381896 Ga0157379_103818962 107
142 3300025926 Ga0207659_10577609 Ga0207659_105776092 107
143 3300025932 Ga0207690_10214845 Ga0207690_102148452 107
144 3300025941 Ga0207711_10165119 Ga0207711_101651194 107
145 3300025941 Ga0207711_10180317 Ga0207711_101803171 107
146 3300025972 Ga0207668_10087046 Ga0207668_100870464 107
147 3300025986 Ga0207658_10284028 Ga0207658_102840282 107
148 3300026035 Ga0207703_10139067 Ga0207703_101390673 107
149 3300026035 Ga0207703_10217405 Ga0207703_102174052 107
150 3300026041 Ga0207639_10800148 Ga0207639_108001482 107
151 3300026067 Ga0207678_10753388 Ga0207678_107533882 107
152 3300026088 Ga0207641_10420170 Ga0207641_104201701 107
153 3300028379 Ga0268266_11555298 Ga0268266_115552981 107
154 3300028381 Ga0268264_10203306 Ga0268264_102033062 107
155 3300028381 Ga0268264_11249735 Ga0268264_112497352 107
156 3300031824 Ga0307413_10318731 Ga0307413_103187311 107
157 3300032126 Ga0307415_101221566 Ga0307415_1012215661 107
158 3300035207 Ga0373942_0140422 Ga0373942_0140422_399_737 107
159 3300035691 Ga0373931_0266587 Ga0373931_0266587_417_755 107
160 3300035691 Ga0373931_0930464 Ga0373931_0930464_115_462 107
161 3300041491 Ga0451833_1481792 Ga0451833_1481792_136_474 107
162 3300041503 Ga0451847_0674360 Ga0451847_0674360_274_612 107
163 3300045051 Ga0451576_0140380 Ga0451576_0140380_492_830 107
164 3300046457 Ga0495590_0065011 Ga0495590_0065011_624_962 107
165 3300046683 Ga0495658_0696114 Ga0495658_0696114_12_362 107
166 3300048907 Ga0496104_0137539 Ga0496104_0137539_343_681 107
167 3300048907 Ga0496104_0335579 Ga0496104_0335579_1015_1353 107
168 3300048908 Ga0496105_0106828 Ga0496105_0106828_177_515 107
169 3300048917 Ga0496114_1067136 Ga0496114_1067136_236_574 107
170 3300049569 Ga0501032_0170746 Ga0501032_0170746_529_867 107
171 3300049570 Ga0501033_0012011 Ga0501033_0012011_1911_2249 107
172 3300049571 Ga0501034_0997027 Ga0501034_0997027_83_421 107
173 3300049571 Ga0501034_1368940 Ga0501034_1368940_188_526 107
174 3300049572 Ga0501036_0018128 Ga0501036_0018128_516_854 107
175 3300049573 Ga0501037_1001182 Ga0501037_1001182_34_372 107
176 3300049574 Ga0501038_0033554 Ga0501038_0033554_463_801 107
177 3300049576 Ga0501040_0057575 Ga0501040_0057575_481_819 107
178 3300049577 Ga0501041_0074248 Ga0501041_0074248_432_770 107
179 3300049578 Ga0501042_0020709 Ga0501042_0020709_2266_2604 107
180 3300049580 Ga0501046_0010995 Ga0501046_0010995_5308_5646 107
181 3300049582 Ga0501048_0034745 Ga0501048_0034745_2745_3083 107
182 3300049587 Ga0501071_0095260 Ga0501071_0095260_208_546 107
183 3300049588 Ga0501072_0040309 Ga0501072_0040309_3044_3382 107
184 3300049590 Ga0501074_0186084 Ga0501074_0186084_639_977 107
185 3300049591 Ga0501075_0020152 Ga0501075_0020152_3976_4314 107
186 3300049592 Ga0501076_0004321 Ga0501076_0004321_4840_5178 107
187 3300049593 Ga0501077_0126303 Ga0501077_0126303_285_623 107
188 3300049741 Ga0501079_0035305 Ga0501079_0035305_1270_1608 107
189 3300049743 Ga0501081_0157548 Ga0501081_0157548_992_1330 107
190 3300049744 Ga0501083_0077308 Ga0501083_0077308_1413_1751 107
191 3300049822 Ga0501035_0355064 Ga0501035_0355064_313_651 107
192 3300049824 Ga0501045_0020458 Ga0501045_0020458_2241_2579 107
193 3300050494 nmdc:mga06z11_608331_c1 nmdc:mga06z11_608331_c1_252_590 107
194 3300050507 nmdc:mga05p37_1232224_c1 nmdc:mga05p37_1232224_c1_60_398 107
195 3300050507 nmdc:mga05p37_18584_c1 nmdc:mga05p37_18584_c1_5224_5580 107
196 3300050508 nmdc:mga09592_39424_c1 nmdc:mga09592_39424_c1_2204_2542 107
197 3300050508 nmdc:mga09592_55343_c1 nmdc:mga09592_55343_c1_2567_2905 107
198 3300050508 nmdc:mga09592_737205_c1 nmdc:mga09592_737205_c1_347_688 107
199 3300050509 nmdc:mga0qj67_3566_c1 nmdc:mga0qj67_3566_c1_334_672 107
200 3300050509 nmdc:mga0qj67_478655_c1 nmdc:mga0qj67_478655_c1_205_543 107
201 3300050510 nmdc:mga06r32_1044_c1 nmdc:mga06r32_1044_c1_18587_18925 107
202 3300050510 nmdc:mga06r32_304853_c1 nmdc:mga06r32_304853_c1_1164_1502 107
203 3300050510 nmdc:mga06r32_448872_c1 nmdc:mga06r32_448872_c1_75_413 107
204 3300050512 nmdc:mga0n895_2943_c1 nmdc:mga0n895_2943_c1_10983_11321 107
205 3300050513 nmdc:mga0rr50_1128461_c1 nmdc:mga0rr50_1128461_c1_23_361 107
206 3300050515 nmdc:mga0a205_129809_c1 nmdc:mga0a205_129809_c1_519_857 107
207 3300054114 Ga0501084_0013582 Ga0501084_0013582_2275_2613 107
208 3300060353 Ga0501082_0036442 Ga0501082_0036442_892_1230 107
209 3300060353 Ga0501082_0068914 Ga0501082_0068914_2536_2874 107
210 3300061734 Ga0530510_0017143 Ga0530510_0017143_532_870 107
211 iso_pu_bacteria 2684623219 2687235960 108
212 iso_pu_bacteria 2883291878 2883293421 108
213 3300006177 Ga0075362_10054880 Ga0075362_100548803 109
214 3300031824 Ga0307413_10891821 Ga0307413_108918211 109
215 3300050489 nmdc:mga03683_42642_c1 nmdc:mga03683_42642_c1_1243_1584 109
216 3300050492 nmdc:mga0yw44_302171_c1 nmdc:mga0yw44_302171_c1_581_922 109
217 3300005289 Ga0065704_10079924 Ga0065704_100799243 110
218 3300005329 Ga0070683_100236060 Ga0070683_1002360602 110
219 3300005563 Ga0068855_100225116 Ga0068855_1002251163 110
220 3300005577 Ga0068857_100007844 Ga0068857_1000078445 110
221 3300009174 Ga0105241_10013134 Ga0105241_100131343 110
222 3300009545 Ga0105237_10572824 Ga0105237_105728242 110
223 3300009551 Ga0105238_10652726 Ga0105238_106527261 110
224 3300010375 Ga0105239_10063343 Ga0105239_100633432 110
225 3300013105 Ga0157369_10714163 Ga0157369_107141632 110
226 3300013307 Ga0157372_10265707 Ga0157372_102657072 110
227 3300025911 Ga0207654_10022478 Ga0207654_100224784 110
228 3300025913 Ga0207695_10812519 Ga0207695_108125192 110
229 3300025944 Ga0207661_10181718 Ga0207661_101817182 110
230 3300026116 Ga0207674_10000920 Ga0207674_1000092018 110
231 iso_pu_bacteria 2874612657 2874619534 111
232 3300005458 Ga0070681_10477278 Ga0070681_104772783 112
233 3300005458 Ga0070681_10567970 Ga0070681_105679702 112
234 3300006038 Ga0075365_10011552 Ga0075365_100115527 112
235 3300006042 Ga0075368_10304650 Ga0075368_103046502 112
236 3300006051 Ga0075364_10646453 Ga0075364_106464532 112
237 3300006177 Ga0075362_10285990 Ga0075362_102859901 112
238 3300006178 Ga0075367_10477211 Ga0075367_104772112 112
239 3300006186 Ga0075369_10004094 Ga0075369_100040947 112
240 3300006195 Ga0075366_10129952 Ga0075366_101299522 112
241 3300006195 Ga0075366_10257512 Ga0075366_102575122 112
242 3300006353 Ga0075370_10246098 Ga0075370_102460982 112
243 3300013104 Ga0157370_10153410 Ga0157370_101534104 112
244 3300026116 Ga0207674_11036550 Ga0207674_110365502 112
245 3300027866 Ga0209813_10237355 Ga0209813_102373552 112
246 3300050489 nmdc:mga03683_364460_c1 nmdc:mga03683_364460_c1_76_414 112
247 3300050489 nmdc:mga03683_413365_c1 nmdc:mga03683_413365_c1_92_430 112
248 3300050491 nmdc:mga00v17_505690_c1 nmdc:mga00v17_505690_c1_216_554 112
249 3300050492 nmdc:mga0yw44_1230611_c1 nmdc:mga0yw44_1230611_c1_81_419 112
250 3300050492 nmdc:mga0yw44_48924_c1 nmdc:mga0yw44_48924_c1_505_843 112
251 3300050493 nmdc:mga0k408_125982_c1 nmdc:mga0k408_125982_c1_704_1057 112
252 3300050493 nmdc:mga0k408_77766_c1 nmdc:mga0k408_77766_c1_251_589 112
253 3300050494 nmdc:mga06z11_946908_c1 nmdc:mga06z11_946908_c1_67_405 112
254 3300050496 nmdc:mga07m45_21663_c1 nmdc:mga07m45_21663_c1_191_544 112
255 3300050496 nmdc:mga07m45_79785_c1 nmdc:mga07m45_79785_c1_1380_1718 112
256 3300050516 nmdc:mga0sz30_17471_c1 nmdc:mga0sz30_17471_c1_812_1150 112
257 3300050516 nmdc:mga0sz30_84234_c1 nmdc:mga0sz30_84234_c1_142_480 112
258 3300006038 Ga0075365_10417795 Ga0075365_104177952 113
259 3300031731 Ga0307405_11388519 Ga0307405_113885191 113
260 3300032002 Ga0307416_100194572 Ga0307416_1001945723 113
261 3300032126 Ga0307415_100843640 Ga0307415_1008436402 113
262 3300047472 Ga0495686_0401078 Ga0495686_0401078_318_677 113
263 3300053103 Ga0500555_004132 Ga0500555_004132_3068_3412 113
264 iso_pu_bacteria 2513237090 2513608030 113
265 iso_pu_bacteria 2513237305 2514423199 113
266 iso_pu_bacteria 2599185301 2599938572 113
267 iso_pu_bacteria 2693429783 2694632694 113
268 iso_pu_bacteria 2693429784 2694639577 113
269 iso_pu_bacteria 2721755686 2723577789 113
270 iso_pu_bacteria 2856349417 2856354703 113
271 iso_pu_bacteria 2876377896 2876384515 113
272 iso_pu_bacteria 2881155292 2881157865 113
273 iso_pu_bacteria 2881853255 2881858653 113
274 iso_pu_bacteria 2882632389 2882639943 113
275 iso_pu_bacteria 2885342637 2885344127 113
276 iso_pu_bacteria 2885350715 2885351789 113
277 iso_pu_bacteria 2938014810 2938019998 113
278 iso_pu_bacteria 2961127735 2961133733 113
279 3300049571 Ga0501034_0378986 Ga0501034_0378986_30_383 114
280 3300049592 Ga0501076_1715801 Ga0501076_1715801_126_479 114
281 iso_pu_bacteria 2509276022 2509398114 114
282 iso_pu_bacteria 2510065059 2510316691 114
283 iso_pu_bacteria 2512875024 2512964230 114
284 iso_pu_bacteria 2643221595 2643986181 114
285 iso_pu_bacteria 2643221627 2644152412 114
286 iso_pu_bacteria 2791355123 2792753041 114
287 iso_pu_bacteria 2844002411 2844005387 114
288 iso_pu_bacteria 2844009547 2844015839 114
289 iso_pu_bacteria 2856320880 2856326542 114
290 iso_pu_bacteria 2869169390 2869175614 114
291 iso_pu_bacteria 2869234852 2869236320 114
292 iso_pu_bacteria 2869242130 2869246090 114
293 iso_pu_bacteria 2869256925 2869261404 114
294 iso_pu_bacteria 2869278585 2869280344 114
295 iso_pu_bacteria 2871435913 2871437284 114
296 iso_pu_bacteria 2871451962 2871456185 114
297 iso_pu_bacteria 2871466892 2871467650 114
298 iso_pu_bacteria 2871481445 2871483350 114
299 iso_pu_bacteria 2874109183 2874110372 114
300 iso_pu_bacteria 2874116593 2874117326 114
301 iso_pu_bacteria 2874123672 2874126598 114
302 iso_pu_bacteria 2874139085 2874144453 114
303 iso_pu_bacteria 2874168670 2874173761 114
304 iso_pu_bacteria 2876386047 2876392247 114
305 iso_pu_bacteria 2878730984 2878736846 114
306 iso_pu_bacteria 2878738818 2878744172 114
307 iso_pu_bacteria 2881147464 2881154129 114
308 iso_pu_bacteria 2885305155 2885312159 114
309 iso_pu_bacteria 2885312484 2885315763 114
310 iso_pu_bacteria 2885326080 2885326809 114
311 iso_pu_bacteria 2885334103 2885339072 114
312 iso_pu_bacteria 2888337043 2888341887 114
313 iso_pu_bacteria 2903513507 2903515843 114
314 iso_pu_bacteria 2906378014 2906381980 114
315 iso_pu_bacteria 2906401398 2906405518 114
316 iso_pu_bacteria 2924710171 2924710936 114
317 iso_pu_bacteria 2924718760 2924722664 114
318 iso_pu_bacteria 2924733363 2924738686 114
319 iso_pu_bacteria 2924741084 2924741858 114
320 iso_pu_bacteria 2924762789 2924766190 114
321 iso_pu_bacteria 2924776078 2924782089 114
322 iso_pu_bacteria 2937861824 2937863187 114
323 iso_pu_bacteria 2937877337 2937877783 114
324 iso_pu_bacteria 2937972304 2937977853 114
325 iso_pu_bacteria 2937980651 2937980998 114
326 iso_pu_bacteria 2958034702 2958036213 114
327 iso_pu_bacteria 2958041894 2958047637 114
328 iso_pu_bacteria 2958084443 2958084891 114
329 iso_pu_bacteria 2958092219 2958093144 114
330 iso_pu_bacteria 2958108152 2958112304 114
331 iso_pu_bacteria 2958144490 2958146114 114
332 iso_pu_bacteria 2961183825 2961184993 114
333 iso_pu_bacteria 2968016561 2968022149 114
334 iso_pu_bacteria 2968138860 2968144677 114
335 iso_pu_bacteria 2970469710 2970474739 114
336 iso_pu_bacteria 2970489779 2970494405 114
337 iso_pu_bacteria 2970510686 2970510769 114
338 iso_pu_bacteria 2970532167 2970537901 114
339 iso_pu_bacteria 2970593180 2970594942 114
340 iso_pu_bacteria 2970619444 2970626718 114
341 iso_pu_bacteria 2970627176 2970630210 114
342 iso_pu_bacteria 2977851361 2977857515 114
343 iso_pu_bacteria 2977898635 2977898677 114
344 iso_pu_bacteria 2977907340 2977909865 114
345 iso_pu_bacteria 2979764755 2979768462 114
346 iso_pu_bacteria 2979772303 2979775241 114
347 iso_pu_bacteria 2987666974 2987670730 114
348 iso_pu_bacteria 2996348954 2996354149 114
349 iso_pu_bacteria 2996386984 2996387430 114
350 iso_pu_bacteria 3004167301 3004171333 114
351 iso_pu_bacteria 3004232784 3004233375 114
352 iso_pu_bacteria 3004248173 3004249118 114
353 iso_pu_bacteria 3004268573 3004270400 114
354 iso_pu_bacteria 3004275668 3004280817 114
355 iso_pu_bacteria 3004289098 3004291637 114
356 iso_pu_bacteria 8004312739 8004319899 114
357 iso_pu_bacteria 8004727605 8004728046 114
358 iso_pu_bacteria 2775506902 2776272381 115
359 iso_pu_bacteria 2775506904 2776284321 115
360 iso_pu_bacteria 2839993093 2839994389 115
361 iso_pu_bacteria 2841734538 2841735173 115
362 iso_pu_bacteria 2869162929 2869163120 115
363 iso_pu_bacteria 2871474448 2871481377 115
364 iso_pu_bacteria 2878788777 2878792593 115
365 iso_pu_bacteria 2894652903 2894655246 115
366 iso_pu_bacteria 2937822353 2937828576 115
367 iso_pu_bacteria 2937836603 2937840389 115
368 iso_pu_bacteria 3002141150 3002142868 115
369 iso_pu_bacteria 8004633249 8004638885 115
370 iso_pu_bacteria 8055617313 8055623609 115
371 3300005354 Ga0070675_100951267 Ga0070675_1009512672 116
372 3300005356 Ga0070674_100918380 Ga0070674_1009183801 116
373 3300010375 Ga0105239_11262766 Ga0105239_112627661 116
374 3300025901 Ga0207688_10692798 Ga0207688_106927982 116
375 3300035089 Ga0373944_0019077 Ga0373944_0019077_1262_1615 116
376 3300035113 Ga0373936_0115008 Ga0373936_0115008_494_847 116
377 3300035116 Ga0373945_0019775 Ga0373945_0019775_1761_2114 116
378 3300035170 Ga0373943_0088303 Ga0373943_0088303_782_1135 116
379 3300035171 Ga0373946_0027960 Ga0373946_0027960_143_496 116
380 3300035692 Ga0373935_0109556 Ga0373935_0109556_1063_1416 116
381 3300035695 Ga0373927_0025832 Ga0373927_0025832_1526_1879 116
382 3300035725 Ga0373947_0083528 Ga0373947_0083528_931_1284 116
383 3300037068 Ga0373925_0125637 Ga0373925_0125637_70_423 116
384 3300046455 Ga0495603_0032915 Ga0495603_0032915_631_984 116
385 3300046460 Ga0495638_0337643 Ga0495638_0337643_56_406 116
386 3300046472 Ga0495580_0649628 Ga0495580_0649628_311_664 116
387 3300046473 Ga0495582_0090773 Ga0495582_0090773_1077_1430 116
388 3300046475 Ga0495639_0137386 Ga0495639_0137386_533_886 116
389 3300046492 Ga0495585_0084571 Ga0495585_0084571_1086_1439 116
390 3300046499 Ga0495594_0020793 Ga0495594_0020793_1124_1477 116
391 3300046513 Ga0495616_0291601 Ga0495616_0291601_13_366 116
392 3300046515 Ga0495620_0277538 Ga0495620_0277538_272_622 116
393 3300046518 Ga0495631_0322466 Ga0495631_0322466_248_601 116
394 3300046519 Ga0495632_0093077 Ga0495632_0093077_540_890 116
395 3300046520 Ga0495637_0138414 Ga0495637_0138414_42_395 116
396 3300046526 Ga0495666_0140448 Ga0495666_0140448_24_377 116
397 3300046537 Ga0495598_0023831 Ga0495598_0023831_253_606 116
398 3300046539 Ga0495621_0109329 Ga0495621_0109329_434_787 116
399 3300046615 Ga0495656_0047113 Ga0495656_0047113_329_682 116
400 3300046642 Ga0495634_0206834 Ga0495634_0206834_578_931 116
401 3300046660 Ga0495625_0045532 Ga0495625_0045532_1524_1877 116
402 3300046674 Ga0495588_0141669 Ga0495588_0141669_686_1039 116
403 3300046681 Ga0495647_0321413 Ga0495647_0321413_333_686 116
404 3300046683 Ga0495658_0387302 Ga0495658_0387302_514_867 116
405 3300046684 Ga0495669_0077137 Ga0495669_0077137_678_1031 116
406 3300046690 Ga0495624_0132313 Ga0495624_0132313_732_1085 116
407 3300046691 Ga0495670_0100235 Ga0495670_0100235_315_668 116
408 3300047315 Ga0495581_0327431 Ga0495581_0327431_292_645 116
409 3300047321 Ga0495676_0052076 Ga0495676_0052076_783_1136 116
410 3300047472 Ga0495686_0341804 Ga0495686_0341804_429_779 116
411 3300048090 Ga0495615_0326514 Ga0495615_0326514_123_476 116
412 3300048091 Ga0495626_0374504 Ga0495626_0374504_123_476 116
413 3300053079 Ga0500610_0148667 Ga0500610_0148667_757_1107 116
414 3300053083 Ga0495655_0016524 Ga0495655_0016524_881_1234 116
415 3300053093 Ga0500651_0675196 Ga0500651_0675196_106_456 116
416 3300053116 Ga0500592_031971 Ga0500592_031971_467_820 116
417 3300053134 Ga0500658_0261418 Ga0500658_0261418_424_777 116
418 3300053151 Ga0500604_0019073 Ga0500604_0019073_357_710 116
419 3300053158 Ga0500627_0038343 Ga0500627_0038343_111_461 116
420 3300053158 Ga0500627_0052658 Ga0500627_0052658_148_498 116
421 3300001989 JGI24739J22299_10192473 JGI24739J22299_101924731 117
422 3300005367 Ga0070667_102325545 Ga0070667_1023255451 117
423 3300005535 Ga0070684_101533354 Ga0070684_1015333542 117
424 3300005539 Ga0068853_100009790 Ga0068853_1000097903 117
425 3300005539 Ga0068853_100152218 Ga0068853_1001522182 117
426 3300005563 Ga0068855_101513486 Ga0068855_1015134861 117
427 3300005616 Ga0068852_100175522 Ga0068852_1001755224 117
428 3300006038 Ga0075365_10010622 Ga0075365_100106224 117
429 3300006038 Ga0075365_10155982 Ga0075365_101559823 117
430 3300006042 Ga0075368_10123415 Ga0075368_101234152 117
431 3300006042 Ga0075368_10398936 Ga0075368_103989362 117
432 3300006048 Ga0075363_100114661 Ga0075363_1001146612 117
433 3300006051 Ga0075364_10115826 Ga0075364_101158263 117
434 3300006051 Ga0075364_10354760 Ga0075364_103547602 117
435 3300006177 Ga0075362_10016284 Ga0075362_100162844 117
436 3300006177 Ga0075362_10026139 Ga0075362_100261391 117
437 3300006178 Ga0075367_10055496 Ga0075367_100554962 117
438 3300006178 Ga0075367_10228070 Ga0075367_102280703 117
439 3300006186 Ga0075369_10207651 Ga0075369_102076512 117
440 3300006186 Ga0075369_10326044 Ga0075369_103260442 117
441 3300006195 Ga0075366_10133416 Ga0075366_101334163 117
442 3300006195 Ga0075366_10609354 Ga0075366_106093542 117
443 3300006353 Ga0075370_10243353 Ga0075370_102433533 117
444 3300006353 Ga0075370_10644535 Ga0075370_106445351 117
445 3300009093 Ga0105240_10041488 Ga0105240_100414882 117
446 3300009174 Ga0105241_10153764 Ga0105241_101537643 117
447 3300009545 Ga0105237_10027026 Ga0105237_100270266 117
448 3300009545 Ga0105237_10537599 Ga0105237_105375993 117
449 3300009551 Ga0105238_10002917 Ga0105238_100029176 117
450 3300010375 Ga0105239_10101350 Ga0105239_101013501 117
451 3300010375 Ga0105239_12881395 Ga0105239_128813951 117
452 3300013105 Ga0157369_10153056 Ga0157369_101530563 117
453 3300025261 Ga0209233_1038271 Ga0209233_10382712 117
454 3300025904 Ga0207647_10547454 Ga0207647_105474542 117
455 3300025911 Ga0207654_10531290 Ga0207654_105312902 117
456 3300025913 Ga0207695_10433692 Ga0207695_104336923 117
457 3300025914 Ga0207671_10008635 Ga0207671_100086359 117
458 3300025924 Ga0207694_10051034 Ga0207694_100510344 117
459 3300026041 Ga0207639_10120441 Ga0207639_101204414 117
460 3300027866 Ga0209813_10125120 Ga0209813_101251202 117
461 3300037418 Ga0395900_0202444 Ga0395900_0202444_638_991 117
462 3300037471 Ga0395905_0148537 Ga0395905_0148537_1597_1953 117
463 3300037471 Ga0395905_0520744 Ga0395905_0520744_627_980 117
464 3300038443 Ga0395901_0088383 Ga0395901_0088383_1631_1987 117
465 3300038443 Ga0395901_0493964 Ga0395901_0493964_372_725 117
466 3300048906 Ga0496103_0700554 Ga0496103_0700554_243_596 117
467 3300048909 Ga0496106_0750865 Ga0496106_0750865_353_706 117
468 3300048918 Ga0496115_0283856 Ga0496115_0283856_530_883 117
469 3300048924 Ga0496121_0400809 Ga0496121_0400809_483_836 117
470 3300048928 Ga0496125_0059505 Ga0496125_0059505_216_569 117
471 3300048929 Ga0496126_0515968 Ga0496126_0515968_383_736 117
472 3300049742 Ga0501080_0366581 Ga0501080_0366581_467_820 117
473 3300049744 Ga0501083_0660106 Ga0501083_0660106_98_457 117
474 3300050489 nmdc:mga03683_152792_c1 nmdc:mga03683_152792_c1_271_624 117
475 3300050489 nmdc:mga03683_43084_c1 nmdc:mga03683_43084_c1_1364_1717 117
476 3300050490 nmdc:mga03n38_316954_c1 nmdc:mga03n38_316954_c1_457_810 117
477 3300050490 nmdc:mga03n38_43019_c1 nmdc:mga03n38_43019_c1_958_1311 117
478 3300050491 nmdc:mga00v17_741770_c1 nmdc:mga00v17_741770_c1_31_384 117
479 3300050492 nmdc:mga0yw44_528426_c1 nmdc:mga0yw44_528426_c1_111_464 117
480 3300050493 nmdc:mga0k408_783368_c1 nmdc:mga0k408_783368_c1_106_459 117
481 3300050494 nmdc:mga06z11_231058_c1 nmdc:mga06z11_231058_c1_458_811 117
482 3300050496 nmdc:mga07m45_186945_c1 nmdc:mga07m45_186945_c1_743_1096 117
483 3300050496 nmdc:mga07m45_488220_c1 nmdc:mga07m45_488220_c1_44_397 117
484 3300050496 nmdc:mga07m45_71126_c1 nmdc:mga07m45_71126_c1_568_921 117
485 iso_pu_bacteria 2597489875 2597815712 117
486 iso_pu_bacteria 2856342000 2856349378 117
487 iso_pu_bacteria 2888343758 2888349192 117
488 iso_pu_bacteria 2924754689 2924756318 117
489 iso_pu_bacteria 2958071322 2958075827 117
490 iso_pu_bacteria 2970540015 2970543789 117
491 iso_pu_bacteria 8004395343 8004396702 117
492 3300001979 JGI24740J21852_10195603 JGI24740J21852_101956032 118
493 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016290 118
494 3300003762 Ga0055542_1000172 Ga0055542_10001721 118
495 3300005293 Ga0065715_10437595 Ga0065715_104375952 118
496 3300005327 Ga0070658_10521933 Ga0070658_105219331 118
497 3300005347 Ga0070668_100350062 Ga0070668_1003500622 118
498 3300005367 Ga0070667_101016132 Ga0070667_1010161322 118
499 3300005577 Ga0068857_102228687 Ga0068857_1022286872 118
500 3300005937 Ga0081455_10602368 Ga0081455_106023682 118
501 3300006038 Ga0075365_10083877 Ga0075365_100838773 118
502 3300006038 Ga0075365_10192328 Ga0075365_101923282 118
503 3300006038 Ga0075365_10229147 Ga0075365_102291473 118
504 3300006038 Ga0075365_10394381 Ga0075365_103943812 118
505 3300006177 Ga0075362_10136168 Ga0075362_101361682 118
506 3300009148 Ga0105243_10423399 Ga0105243_104233992 118
507 3300009174 Ga0105241_10524994 Ga0105241_105249941 118
508 3300009545 Ga0105237_11137840 Ga0105237_111378402 118
509 3300009551 Ga0105238_11019382 Ga0105238_110193821 118
510 3300013104 Ga0157370_10638273 Ga0157370_106382732 118
511 3300013296 Ga0157374_11220324 Ga0157374_112203242 118
512 3300014969 Ga0157376_10732966 Ga0157376_107329662 118
513 3300025254 Ga0209148_1000057 Ga0209148_1000057221 118
514 3300025261 Ga0209233_1000068 Ga0209233_1000068292 118
515 3300025272 Ga0209455_1000240 Ga0209455_100024042 118
516 3300025907 Ga0207645_10306472 Ga0207645_103064721 118
517 3300025911 Ga0207654_10519744 Ga0207654_105197441 118
518 3300025913 Ga0207695_10934874 Ga0207695_109348742 118
519 3300025924 Ga0207694_10241127 Ga0207694_102411273 118
520 3300025972 Ga0207668_10846406 Ga0207668_108464062 118
521 3300026116 Ga0207674_10990507 Ga0207674_109905072 118
522 3300028379 Ga0268266_10174164 Ga0268266_101741643 118
523 3300035242 Ga0373962_0389870 Ga0373962_0389870_29_388 118
524 3300035691 Ga0373931_0696684 Ga0373931_0696684_211_570 118
525 3300037418 Ga0395900_0236455 Ga0395900_0236455_118_474 118
526 3300041456 Ga0451795_0098730 Ga0451795_0098730_351_728 118
527 3300041498 Ga0451841_0049401 Ga0451841_0049401_31_387 118
528 3300041512 Ga0451853_2932347 Ga0451853_2932347_87_443 118
529 3300046459 Ga0495629_1100620 Ga0495629_1100620_113_469 118
530 3300046460 Ga0495638_0168596 Ga0495638_0168596_63_419 118
531 3300046616 Ga0495668_0321127 Ga0495668_0321127_238_594 118
532 3300046689 Ga0495613_0333293 Ga0495613_0333293_32_391 118
533 3300047471 Ga0495684_0164393 Ga0495684_0164393_791_1150 118
534 3300047673 Ga0495593_0187486 Ga0495593_0187486_237_596 118
535 3300048904 Ga0496101_0300666 Ga0496101_0300666_304_660 118
536 3300048910 Ga0496107_0120890 Ga0496107_0120890_1207_1575 118
537 3300048918 Ga0496115_0328263 Ga0496115_0328263_684_1040 118
538 3300048918 Ga0496115_1440761 Ga0496115_1440761_73_432 118
539 3300048922 Ga0496119_0023858 Ga0496119_0023858_2308_2664 118
540 3300048922 Ga0496119_0105353 Ga0496119_0105353_803_1159 118
541 3300048923 Ga0496120_0002038 Ga0496120_0002038_1636_1992 118
542 3300048929 Ga0496126_0072915 Ga0496126_0072915_955_1323 118
543 3300049589 Ga0501073_0014169 Ga0501073_0014169_4371_4733 118
544 3300050489 nmdc:mga03683_265784_c1 nmdc:mga03683_265784_c1_363_722 118
545 3300050490 nmdc:mga03n38_29837_c1 nmdc:mga03n38_29837_c1_1174_1533 118
546 3300050491 nmdc:mga00v17_106451_c1 nmdc:mga00v17_106451_c1_351_710 118
547 3300050492 nmdc:mga0yw44_331948_c1 nmdc:mga0yw44_331948_c1_634_990 118
548 3300050492 nmdc:mga0yw44_3617_c1 nmdc:mga0yw44_3617_c1_1959_2318 118
549 3300050492 nmdc:mga0yw44_440275_c1 nmdc:mga0yw44_440275_c1_113_472 118
550 3300050492 nmdc:mga0yw44_52111_c1 nmdc:mga0yw44_52111_c1_1671_2030 118
551 3300050493 nmdc:mga0k408_521151_c1 nmdc:mga0k408_521151_c1_315_674 118
552 3300050494 nmdc:mga06z11_166548_c1 nmdc:mga06z11_166548_c1_482_841 118
553 3300050494 nmdc:mga06z11_666556_c1 nmdc:mga06z11_666556_c1_20_379 118
554 3300050494 nmdc:mga06z11_693302_c1 nmdc:mga06z11_693302_c1_146_505 118
555 3300050495 nmdc:mga04h51_138917_c1 nmdc:mga04h51_138917_c1_380_739 118
556 3300050516 nmdc:mga0sz30_10879_c1 nmdc:mga0sz30_10879_c1_1443_1802 118
557 3300053083 Ga0495655_0322059 Ga0495655_0322059_82_438 118
558 3300053085 Ga0495619_0101780 Ga0495619_0101780_1458_1817 118
559 3300053119 Ga0500595_053821 Ga0500595_053821_566_922 118
560 3300053151 Ga0500604_0082255 Ga0500604_0082255_285_644 118
561 3300053153 Ga0500616_0112006 Ga0500616_0112006_158_526 118
562 3300053155 Ga0500620_000301 Ga0500620_000301_4586_4942 118
563 3300053158 Ga0500627_0135299 Ga0500627_0135299_654_1013 118
564 3300053727 Ga0500611_008828 Ga0500611_008828_355_711 118
565 iso_pu_bacteria 2970524798 2970529007 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

39

85

0.98

PF12840

HTH_20

Helix-turn-helix domain

37

86

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9609 13 100
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9569 13 94
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9561 11 100
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9496 13 97
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9267 23 80
ID Description Score Start End Superfamily
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9609 13 100 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 13 93 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 13 92 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 23 80 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9203 13 100 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9954 13 93 GO:0003700
AF-A0A0F4RFV9-F1-model_v4 ArsR family transcriptional regulator 0.9924 13 100 GO:0003700
AF-A0A4R8VFF7-F1-model_v4 deleted 0.9885 13 95
AF-A0A238K834-F1-model_v4 Transcriptional repressor SdpR 0.9842 14 104 GO:0003700
AF-A0A0K0XZQ4-F1-model_v4 ArsR family transcriptional regulator 0.9796 16 97 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.65 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map