F464334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 384 | 446 | 115 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2970524798|2970529007 |
| Length | 134 |
| Sequence | IIIFGYAQWREEDMTVATSPQTASPSVPPIDGIFRALADPTRRRVVERLNRSPASVSELAQPFDMALPSFVEHLRVLEGCGLVHSEKAGRVRTYRLAPEPLKLAESWLAEQRALWERRLDQLDAYVMTLKEKDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 2 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 3 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 4 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 5 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 6 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 7 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 8 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 9 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 10 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 11 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 12 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 13 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 14 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 15 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 16 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 17 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 18 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 19 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 20 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 21 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 22 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 23 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 24 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 25 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 26 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 27 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 28 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 29 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 30 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 31 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 32 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 33 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 34 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 35 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 36 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 37 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 38 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 39 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 40 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 41 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 42 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 43 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 44 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 45 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 46 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 47 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 48 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 49 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 50 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 51 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 52 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 53 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 54 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 55 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 56 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 57 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 58 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 59 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 60 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 61 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 62 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 63 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 64 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 65 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 66 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 67 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 68 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 69 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 70 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 71 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 72 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 73 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 74 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 75 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 76 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 77 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 78 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 79 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 80 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 81 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 82 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 83 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 84 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 85 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 86 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 87 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 88 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 89 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 90 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 91 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 92 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 93 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 94 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 95 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 96 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 97 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 98 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 99 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 100 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 101 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 102 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 103 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 104 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 105 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 106 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 107 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 108 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 109 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 110 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 111 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 112 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 113 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 114 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 115 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 116 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 117 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 118 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 127 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 129 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 140 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 142 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 143 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 145 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 149 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 150 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 151 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 153 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 154 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 155 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 156 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 157 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 158 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 159 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 160 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 161 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 162 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 163 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 164 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 165 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 166 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 167 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 168 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 169 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 170 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 171 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 173 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 174 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 175 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 176 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 177 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 178 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 179 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 180 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 181 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 182 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 184 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 185 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 265 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 266 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 267 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 268 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 318 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 374 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 379 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 380 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 381 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 382 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 383 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 384 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.94 |
| Metatranscriptomes | 0 |
| Isolates | 21.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.99 |
| Nodule | 17.17 |
| Rhizoplane | 2.65 |
| Rhizosphere | 58.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10195603 | 3300001979 | Bacteria | 501 |
| 2 | JGI24739J22299_10192473 | 3300001989 | Bacteria | 599 |
| 3 | JGI25165J46597_1000016 | 3300003214 | Bacteria | 377866 |
| 4 | Ga0055542_1000172 | 3300003762 | Bacteria | 80034 |
| 5 | Ga0065704_10079924 | 3300005289 | Unclassified | 4047 |
| 6 | Ga0065715_10437595 | 3300005293 | Bacteria | 840 |
| 7 | Ga0070658_10521933 | 3300005327 | Bacteria | 1027 |
| 8 | Ga0070676_10004641 | 3300005328 | Bacteria | 7256 |
| 9 | Ga0070683_100236060 | 3300005329 | Unclassified | 1739 |
| 10 | Ga0070690_100043614 | 3300005330 | Bacteria | 2845 |
| 11 | Ga0070670_100254643 | 3300005331 | Bacteria | 1530 |
| 12 | Ga0070677_10593923 | 3300005333 | Bacteria | 612 |
| 13 | Ga0068869_100434289 | 3300005334 | Bacteria | 1086 |
| 14 | Ga0070666_10009622 | 3300005335 | Bacteria | 6032 |
| 15 | Ga0070666_10134421 | 3300005335 | Bacteria | 1720 |
| 16 | Ga0070689_100110142 | 3300005340 | Bacteria | 2189 |
| 17 | Ga0070689_101076382 | 3300005340 | Bacteria | 718 |
| 18 | Ga0070668_100350062 | 3300005347 | Bacteria | 1250 |
| 19 | Ga0070668_100566270 | 3300005347 | Unclassified | 990 |
| 20 | Ga0070668_101062029 | 3300005347 | Bacteria | 730 |
| 21 | Ga0070669_100920442 | 3300005353 | Bacteria | 747 |
| 22 | Ga0070675_100007265 | 3300005354 | Bacteria | 8546 |
| 23 | Ga0070675_100951267 | 3300005354 | Bacteria | 788 |
| 24 | Ga0070675_100958374 | 3300005354 | Bacteria | 785 |
| 25 | Ga0070671_100046594 | 3300005355 | Bacteria | 3606 |
| 26 | Ga0070671_100121661 | 3300005355 | Bacteria | 2197 |
| 27 | Ga0070674_100918380 | 3300005356 | Bacteria | 763 |
| 28 | Ga0070659_100089716 | 3300005366 | Bacteria | 2462 |
| 29 | Ga0070667_100007565 | 3300005367 | Bacteria | 9012 |
| 30 | Ga0070667_101016132 | 3300005367 | Bacteria | 774 |
| 31 | Ga0070667_102325545 | 3300005367 | Bacteria | 505 |
| 32 | Ga0070663_100315012 | 3300005455 | Bacteria | 1256 |
| 33 | Ga0070678_100009598 | 3300005456 | Bacteria | 5872 |
| 34 | Ga0070681_10477278 | 3300005458 | Bacteria | 1160 |
| 35 | Ga0070681_10567970 | 3300005458 | Bacteria | 1048 |
| 36 | Ga0068867_100004874 | 3300005459 | Bacteria | 9447 |
| 37 | Ga0070706_100050889 | 3300005467 | Bacteria | 3822 |
| 38 | Ga0070706_100959708 | 3300005467 | Bacteria | 789 |
| 39 | Ga0070684_101533354 | 3300005535 | Bacteria | 628 |
| 40 | Ga0068853_100009790 | 3300005539 | Bacteria | 7736 |
| 41 | Ga0068853_100152218 | 3300005539 | Bacteria | 2082 |
| 42 | Ga0068853_100747910 | 3300005539 | Bacteria | 934 |
| 43 | Ga0070672_100004907 | 3300005543 | Bacteria | 8800 |
| 44 | Ga0070695_100620698 | 3300005545 | Bacteria | 851 |
| 45 | Ga0070695_101396365 | 3300005545 | Unclassified | 581 |
| 46 | Ga0070696_100221454 | 3300005546 | Bacteria | 1420 |
| 47 | Ga0070665_100028490 | 3300005548 | Bacteria | 5624 |
| 48 | Ga0070704_100207832 | 3300005549 | Unclassified | 1584 |
| 49 | Ga0068855_100225116 | 3300005563 | Bacteria | 2102 |
| 50 | Ga0068855_101513486 | 3300005563 | Bacteria | 689 |
| 51 | Ga0068857_100007844 | 3300005577 | Bacteria | 9206 |
| 52 | Ga0068857_102228687 | 3300005577 | Bacteria | 538 |
| 53 | Ga0068856_101143853 | 3300005614 | Bacteria | 795 |
| 54 | Ga0070702_101133844 | 3300005615 | Unclassified | 627 |
| 55 | Ga0068852_100175522 | 3300005616 | Bacteria | 2012 |
| 56 | Ga0068859_100155575 | 3300005617 | Bacteria | 2363 |
| 57 | Ga0068859_100213471 | 3300005617 | Bacteria | 2016 |
| 58 | Ga0068864_100007408 | 3300005618 | Bacteria | 9034 |
| 59 | Ga0068864_100367631 | 3300005618 | Unclassified | 1360 |
| 60 | Ga0068866_10114917 | 3300005718 | Unclassified | 1508 |
| 61 | Ga0068861_101762318 | 3300005719 | Bacteria | 614 |
| 62 | Ga0068870_10009071 | 3300005840 | Bacteria | 4505 |
| 63 | Ga0068863_100064252 | 3300005841 | Bacteria | 3471 |
| 64 | Ga0068863_100258004 | 3300005841 | Unclassified | 1685 |
| 65 | Ga0068858_100025579 | 3300005842 | Bacteria | 5492 |
| 66 | Ga0068858_100199918 | 3300005842 | Bacteria | 1890 |
| 67 | Ga0068858_100291962 | 3300005842 | Unclassified | 1554 |
| 68 | Ga0068858_100938407 | 3300005842 | Bacteria | 847 |
| 69 | Ga0068860_100006112 | 3300005843 | Bacteria | 12110 |
| 70 | Ga0068860_100013607 | 3300005843 | Bacteria | 7975 |
| 71 | Ga0068860_100124056 | 3300005843 | Unclassified | 2475 |
| 72 | Ga0068860_100283735 | 3300005843 | Bacteria | 1619 |
| 73 | Ga0068862_100196144 | 3300005844 | Bacteria | 1819 |
| 74 | Ga0068862_100524830 | 3300005844 | Bacteria | 1127 |
| 75 | Ga0081455_10602368 | 3300005937 | Bacteria | 716 |
| 76 | Ga0075365_10010622 | 3300006038 | Bacteria | 5375 |
| 77 | Ga0075365_10011552 | 3300006038 | Bacteria | 5197 |
| 78 | Ga0075365_10083877 | 3300006038 | Bacteria | 2162 |
| 79 | Ga0075365_10155982 | 3300006038 | Bacteria | 1589 |
| 80 | Ga0075365_10192328 | 3300006038 | Bacteria | 1428 |
| 81 | Ga0075365_10229147 | 3300006038 | Bacteria | 1304 |
| 82 | Ga0075365_10394381 | 3300006038 | Bacteria | 977 |
| 83 | Ga0075365_10417795 | 3300006038 | Bacteria | 947 |
| 84 | Ga0075368_10123415 | 3300006042 | Bacteria | 1074 |
| 85 | Ga0075368_10304650 | 3300006042 | Bacteria | 688 |
| 86 | Ga0075368_10398936 | 3300006042 | Bacteria | 604 |
| 87 | Ga0075363_100114661 | 3300006048 | Bacteria | 1500 |
| 88 | Ga0075364_10115826 | 3300006051 | Bacteria | 1791 |
| 89 | Ga0075364_10354760 | 3300006051 | Bacteria | 1000 |
| 90 | Ga0075364_10646453 | 3300006051 | Bacteria | 722 |
| 91 | Ga0075362_10016284 | 3300006177 | Bacteria | 3041 |
| 92 | Ga0075362_10026139 | 3300006177 | Bacteria | 2491 |
| 93 | Ga0075362_10054880 | 3300006177 | Bacteria | 1792 |
| 94 | Ga0075362_10136168 | 3300006177 | Bacteria | 1171 |
| 95 | Ga0075362_10285990 | 3300006177 | Bacteria | 816 |
| 96 | Ga0075367_10055496 | 3300006178 | Bacteria | 2351 |
| 97 | Ga0075367_10103053 | 3300006178 | Bacteria | 1746 |
| 98 | Ga0075367_10228070 | 3300006178 | Bacteria | 1166 |
| 99 | Ga0075367_10477211 | 3300006178 | Bacteria | 791 |
| 100 | Ga0075369_10004094 | 3300006186 | Bacteria | 5365 |
| 101 | Ga0075369_10207651 | 3300006186 | Bacteria | 905 |
| 102 | Ga0075369_10326044 | 3300006186 | Bacteria | 719 |
| 103 | Ga0075366_10129952 | 3300006195 | Bacteria | 1520 |
| 104 | Ga0075366_10133416 | 3300006195 | Bacteria | 1499 |
| 105 | Ga0075366_10257512 | 3300006195 | Bacteria | 1065 |
| 106 | Ga0075366_10609354 | 3300006195 | Bacteria | 677 |
| 107 | Ga0097621_100011941 | 3300006237 | Bacteria | 6424 |
| 108 | Ga0097621_101528807 | 3300006237 | Bacteria | 634 |
| 109 | Ga0075370_10243353 | 3300006353 | Bacteria | 1065 |
| 110 | Ga0075370_10246098 | 3300006353 | Bacteria | 1059 |
| 111 | Ga0075370_10644535 | 3300006353 | Bacteria | 643 |
| 112 | Ga0068871_100010536 | 3300006358 | Bacteria | 6753 |
| 113 | Ga0068871_100076035 | 3300006358 | Bacteria | 2773 |
| 114 | Ga0075428_100045172 | 3300006844 | Bacteria | 4841 |
| 115 | Ga0075428_100118979 | 3300006844 | Bacteria | 2877 |
| 116 | Ga0075428_100840968 | 3300006844 | Bacteria | 975 |
| 117 | Ga0075430_100000987 | 3300006846 | Bacteria | 22451 |
| 118 | Ga0075430_100507389 | 3300006846 | Bacteria | 995 |
| 119 | Ga0075431_100007436 | 3300006847 | Bacteria | 10909 |
| 120 | Ga0075431_100093249 | 3300006847 | Bacteria | 3108 |
| 121 | Ga0075431_101925512 | 3300006847 | Bacteria | 547 |
| 122 | Ga0075433_10087097 | 3300006852 | Bacteria | 2758 |
| 123 | Ga0075434_100005931 | 3300006871 | Bacteria | 11178 |
| 124 | Ga0075429_100003695 | 3300006880 | Bacteria | 13035 |
| 125 | Ga0075429_100067171 | 3300006880 | Bacteria | 3120 |
| 126 | Ga0075429_100790391 | 3300006880 | Bacteria | 831 |
| 127 | Ga0075429_100871653 | 3300006880 | Unclassified | 788 |
| 128 | Ga0068865_100006382 | 3300006881 | Bacteria | 7187 |
| 129 | Ga0075436_100953843 | 3300006914 | Bacteria | 643 |
| 130 | Ga0097620_100155571 | 3300006931 | Bacteria | 2363 |
| 131 | Ga0097620_100213463 | 3300006931 | Bacteria | 2016 |
| 132 | Ga0075435_101189982 | 3300007076 | Bacteria | 667 |
| 133 | Ga0099795_10227851 | 3300007788 | Bacteria | 796 |
| 134 | Ga0105251_10450926 | 3300009011 | Unclassified | 596 |
| 135 | Ga0105240_10041488 | 3300009093 | Bacteria | 5873 |
| 136 | Ga0105247_11223055 | 3300009101 | Unclassified | 599 |
| 137 | Ga0114129_10013251 | 3300009147 | Bacteria | 11743 |
| 138 | Ga0114129_10173444 | 3300009147 | Bacteria | 2938 |
| 139 | Ga0114129_10450423 | 3300009147 | Bacteria | 1688 |
| 140 | Ga0114129_11826534 | 3300009147 | Bacteria | 738 |
| 141 | Ga0114129_12430833 | 3300009147 | Bacteria | 627 |
| 142 | Ga0105243_10423399 | 3300009148 | Bacteria | 1243 |
| 143 | Ga0105243_12393024 | 3300009148 | Unclassified | 566 |
| 144 | Ga0105241_10013134 | 3300009174 | Bacteria | 6077 |
| 145 | Ga0105241_10153764 | 3300009174 | Bacteria | 1884 |
| 146 | Ga0105241_10524994 | 3300009174 | Bacteria | 1059 |
| 147 | Ga0105248_10001222 | 3300009177 | Bacteria | 28675 |
| 148 | Ga0105248_10214679 | 3300009177 | Bacteria | 2167 |
| 149 | Ga0105248_10274189 | 3300009177 | Bacteria | 1899 |
| 150 | Ga0105237_10027026 | 3300009545 | Bacteria | 5861 |
| 151 | Ga0105237_10537599 | 3300009545 | Bacteria | 1175 |
| 152 | Ga0105237_10572824 | 3300009545 | Bacteria | 1136 |
| 153 | Ga0105237_11137840 | 3300009545 | Bacteria | 787 |
| 154 | Ga0105238_10002917 | 3300009551 | Bacteria | 17078 |
| 155 | Ga0105238_10652726 | 3300009551 | Bacteria | 1062 |
| 156 | Ga0105238_11019382 | 3300009551 | Bacteria | 849 |
| 157 | Ga0105249_10061692 | 3300009553 | Bacteria | 3441 |
| 158 | Ga0105249_10338327 | 3300009553 | Bacteria | 1521 |
| 159 | Ga0105249_11884673 | 3300009553 | Bacteria | 670 |
| 160 | Ga0105249_12911190 | 3300009553 | Bacteria | 549 |
| 161 | Ga0105239_10063343 | 3300010375 | Bacteria | 4060 |
| 162 | Ga0105239_10101350 | 3300010375 | Bacteria | 3185 |
| 163 | Ga0105239_11262766 | 3300010375 | Bacteria | 852 |
| 164 | Ga0105239_11732074 | 3300010375 | Bacteria | 724 |
| 165 | Ga0105239_12881395 | 3300010375 | Bacteria | 561 |
| 166 | Ga0157370_10153410 | 3300013104 | Bacteria | 2143 |
| 167 | Ga0157370_10638273 | 3300013104 | Bacteria | 974 |
| 168 | Ga0157369_10153056 | 3300013105 | Bacteria | 2437 |
| 169 | Ga0157369_10714163 | 3300013105 | Bacteria | 1032 |
| 170 | Ga0157374_10003730 | 3300013296 | Bacteria | 12803 |
| 171 | Ga0157374_11181262 | 3300013296 | Unclassified | 786 |
| 172 | Ga0157374_11220324 | 3300013296 | Bacteria | 773 |
| 173 | Ga0157378_10852950 | 3300013297 | Bacteria | 939 |
| 174 | Ga0163162_10024800 | 3300013306 | Bacteria | 5925 |
| 175 | Ga0163162_10193758 | 3300013306 | Bacteria | 2160 |
| 176 | Ga0157372_10265707 | 3300013307 | Bacteria | 1992 |
| 177 | Ga0157375_10131589 | 3300013308 | Bacteria | 2622 |
| 178 | Ga0163163_11347715 | 3300014325 | Bacteria | 775 |
| 179 | Ga0163163_11435874 | 3300014325 | Bacteria | 751 |
| 180 | Ga0163163_12608712 | 3300014325 | Bacteria | 563 |
| 181 | Ga0157377_11495523 | 3300014745 | Bacteria | 536 |
| 182 | Ga0157379_10003011 | 3300014968 | Bacteria | 14227 |
| 183 | Ga0157379_10381896 | 3300014968 | Bacteria | 1292 |
| 184 | Ga0157376_10175529 | 3300014969 | Bacteria | 1954 |
| 185 | Ga0157376_10732966 | 3300014969 | Bacteria | 996 |
| 186 | Ga0209148_1000057 | 3300025254 | Bacteria | 360463 |
| 187 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 188 | Ga0209233_1038271 | 3300025261 | Bacteria | 1059 |
| 189 | Ga0209455_1000240 | 3300025272 | Bacteria | 68476 |
| 190 | Ga0207697_10007205 | 3300025315 | Bacteria | 4970 |
| 191 | Ga0207682_10116111 | 3300025893 | Bacteria | 1183 |
| 192 | Ga0207688_10692798 | 3300025901 | Bacteria | 644 |
| 193 | Ga0207680_10023691 | 3300025903 | Bacteria | 3356 |
| 194 | Ga0207680_10449502 | 3300025903 | Bacteria | 914 |
| 195 | Ga0207647_10547454 | 3300025904 | Bacteria | 642 |
| 196 | Ga0207645_10306472 | 3300025907 | Bacteria | 1058 |
| 197 | Ga0207654_10022478 | 3300025911 | Unclassified | 3365 |
| 198 | Ga0207654_10519744 | 3300025911 | Bacteria | 843 |
| 199 | Ga0207654_10531290 | 3300025911 | Bacteria | 834 |
| 200 | Ga0207695_10433692 | 3300025913 | Bacteria | 1198 |
| 201 | Ga0207695_10812519 | 3300025913 | Unclassified | 815 |
| 202 | Ga0207695_10934874 | 3300025913 | Bacteria | 747 |
| 203 | Ga0207671_10008635 | 3300025914 | Bacteria | 8609 |
| 204 | Ga0207681_10034544 | 3300025923 | Bacteria | 3325 |
| 205 | Ga0207694_10051034 | 3300025924 | Bacteria | 3206 |
| 206 | Ga0207694_10241127 | 3300025924 | Bacteria | 1477 |
| 207 | Ga0207650_10031741 | 3300025925 | Bacteria | 3816 |
| 208 | Ga0207659_10008074 | 3300025926 | Bacteria | 6516 |
| 209 | Ga0207659_10577609 | 3300025926 | Bacteria | 957 |
| 210 | Ga0207690_10214845 | 3300025932 | Bacteria | 1468 |
| 211 | Ga0207670_10033884 | 3300025936 | Bacteria | 3295 |
| 212 | Ga0207704_10101761 | 3300025938 | Bacteria | 1917 |
| 213 | Ga0207691_10000328 | 3300025940 | Bacteria | 47302 |
| 214 | Ga0207711_10015761 | 3300025941 | Bacteria | 6269 |
| 215 | Ga0207711_10165119 | 3300025941 | Bacteria | 2006 |
| 216 | Ga0207711_10180317 | 3300025941 | Bacteria | 1920 |
| 217 | Ga0207711_11734275 | 3300025941 | Unclassified | 568 |
| 218 | Ga0207661_10181718 | 3300025944 | Unclassified | 1838 |
| 219 | Ga0207651_10007297 | 3300025960 | Bacteria | 5876 |
| 220 | Ga0207712_10326018 | 3300025961 | Bacteria | 1269 |
| 221 | Ga0207712_11764235 | 3300025961 | Unclassified | 555 |
| 222 | Ga0207668_10014932 | 3300025972 | Bacteria | 4816 |
| 223 | Ga0207668_10087046 | 3300025972 | Bacteria | 2284 |
| 224 | Ga0207668_10846406 | 3300025972 | Bacteria | 812 |
| 225 | Ga0207658_10006246 | 3300025986 | Bacteria | 8141 |
| 226 | Ga0207658_10284028 | 3300025986 | Bacteria | 1420 |
| 227 | Ga0207703_10017883 | 3300026035 | Bacteria | 5536 |
| 228 | Ga0207703_10139067 | 3300026035 | Bacteria | 2105 |
| 229 | Ga0207703_10217405 | 3300026035 | Unclassified | 1707 |
| 230 | Ga0207639_10120441 | 3300026041 | Bacteria | 2155 |
| 231 | Ga0207639_10800148 | 3300026041 | Bacteria | 878 |
| 232 | Ga0207678_10753388 | 3300026067 | Bacteria | 859 |
| 233 | Ga0207641_10012496 | 3300026088 | Bacteria | 6959 |
| 234 | Ga0207641_10420170 | 3300026088 | Bacteria | 1287 |
| 235 | Ga0207648_10001220 | 3300026089 | Bacteria | 28819 |
| 236 | Ga0207676_10079807 | 3300026095 | Bacteria | 2654 |
| 237 | Ga0207676_10165166 | 3300026095 | Unclassified | 1922 |
| 238 | Ga0207674_10000920 | 3300026116 | Bacteria | 38313 |
| 239 | Ga0207674_10990507 | 3300026116 | Bacteria | 810 |
| 240 | Ga0207674_11036550 | 3300026116 | Unclassified | 790 |
| 241 | Ga0207683_10000807 | 3300026121 | Bacteria | 28669 |
| 242 | Ga0209813_10125120 | 3300027866 | Bacteria | 899 |
| 243 | Ga0209813_10237355 | 3300027866 | Bacteria | 688 |
| 244 | Ga0268266_10055814 | 3300028379 | Bacteria | 3396 |
| 245 | Ga0268266_10174164 | 3300028379 | Bacteria | 1955 |
| 246 | Ga0268266_11555298 | 3300028379 | Bacteria | 637 |
| 247 | Ga0268264_10011189 | 3300028381 | Bacteria | 7411 |
| 248 | Ga0268264_10203306 | 3300028381 | Bacteria | 1813 |
| 249 | Ga0268264_11249735 | 3300028381 | Bacteria | 752 |
| 250 | Ga0307405_11388519 | 3300031731 | Unclassified | 614 |
| 251 | Ga0307413_10318731 | 3300031824 | Bacteria | 1187 |
| 252 | Ga0307413_10891821 | 3300031824 | Bacteria | 755 |
| 253 | Ga0307416_100194572 | 3300032002 | Unclassified | 1917 |
| 254 | Ga0307415_100843640 | 3300032126 | Unclassified | 840 |
| 255 | Ga0307415_101221566 | 3300032126 | Bacteria | 709 |
| 256 | Ga0373944_0019077 | 3300035089 | Bacteria | 1965 |
| 257 | Ga0373936_0115008 | 3300035113 | Bacteria | 1145 |
| 258 | Ga0373945_0019775 | 3300035116 | Bacteria | 2300 |
| 259 | Ga0373943_0088303 | 3300035170 | Bacteria | 1601 |
| 260 | Ga0373946_0027960 | 3300035171 | Bacteria | 2234 |
| 261 | Ga0373942_0140422 | 3300035207 | Unclassified | 769 |
| 262 | Ga0373962_0389870 | 3300035242 | Bacteria | 511 |
| 263 | Ga0373931_0266587 | 3300035691 | Unclassified | 1047 |
| 264 | Ga0373931_0696684 | 3300035691 | Bacteria | 671 |
| 265 | Ga0373931_0930464 | 3300035691 | Bacteria | 585 |
| 266 | Ga0373935_0109556 | 3300035692 | Bacteria | 1831 |
| 267 | Ga0373927_0025832 | 3300035695 | Bacteria | 3839 |
| 268 | Ga0373927_0143638 | 3300035695 | Unclassified | 1562 |
| 269 | Ga0373947_0083528 | 3300035725 | Bacteria | 1980 |
| 270 | Ga0373925_0125637 | 3300037068 | Bacteria | 1995 |
| 271 | Ga0395900_0202444 | 3300037418 | Bacteria | 2008 |
| 272 | Ga0395900_0236455 | 3300037418 | Bacteria | 1835 |
| 273 | Ga0395905_0148537 | 3300037471 | Bacteria | 2205 |
| 274 | Ga0395905_0520744 | 3300037471 | Bacteria | 1090 |
| 275 | Ga0395901_0088383 | 3300038443 | Bacteria | 3241 |
| 276 | Ga0395901_0493964 | 3300038443 | Bacteria | 1247 |
| 277 | Ga0451795_0098730 | 3300041456 | Bacteria | 744 |
| 278 | Ga0451833_1481792 | 3300041491 | Bacteria | 605 |
| 279 | Ga0451841_0049401 | 3300041498 | Bacteria | 547 |
| 280 | Ga0451847_0674360 | 3300041503 | Bacteria | 636 |
| 281 | Ga0451843_1316481 | 3300041509 | Bacteria | 1345 |
| 282 | Ga0451853_2932347 | 3300041512 | Bacteria | 574 |
| 283 | Ga0466963_0452201 | 3300044694 | Unclassified | 906 |
| 284 | Ga0466959_0309020 | 3300045049 | Bacteria | 1082 |
| 285 | Ga0466959_0622942 | 3300045049 | Unclassified | 725 |
| 286 | Ga0451576_0140380 | 3300045051 | Bacteria | 2520 |
| 287 | Ga0495603_0032915 | 3300046455 | Bacteria | 3119 |
| 288 | Ga0495590_0065011 | 3300046457 | Bacteria | 1277 |
| 289 | Ga0495629_1100620 | 3300046459 | Bacteria | 514 |
| 290 | Ga0495638_0168596 | 3300046460 | Bacteria | 1258 |
| 291 | Ga0495638_0337643 | 3300046460 | Bacteria | 800 |
| 292 | Ga0495580_0649628 | 3300046472 | Bacteria | 694 |
| 293 | Ga0495582_0090773 | 3300046473 | Bacteria | 1703 |
| 294 | Ga0495639_0137386 | 3300046475 | Bacteria | 1173 |
| 295 | Ga0495585_0084571 | 3300046492 | Bacteria | 1716 |
| 296 | Ga0495594_0020793 | 3300046499 | Bacteria | 3498 |
| 297 | Ga0495616_0291601 | 3300046513 | Bacteria | 691 |
| 298 | Ga0495620_0277538 | 3300046515 | Bacteria | 638 |
| 299 | Ga0495631_0322466 | 3300046518 | Bacteria | 657 |
| 300 | Ga0495632_0093077 | 3300046519 | Bacteria | 1427 |
| 301 | Ga0495637_0138414 | 3300046520 | Bacteria | 925 |
| 302 | Ga0495666_0140448 | 3300046526 | Bacteria | 1126 |
| 303 | Ga0495598_0023831 | 3300046537 | Bacteria | 1652 |
| 304 | Ga0495621_0109329 | 3300046539 | Bacteria | 1059 |
| 305 | Ga0495656_0047113 | 3300046615 | Bacteria | 1827 |
| 306 | Ga0495668_0321127 | 3300046616 | Bacteria | 849 |
| 307 | Ga0495634_0206834 | 3300046642 | Bacteria | 1217 |
| 308 | Ga0495625_0045532 | 3300046660 | Bacteria | 3171 |
| 309 | Ga0495588_0141669 | 3300046674 | Bacteria | 1270 |
| 310 | Ga0495647_0321413 | 3300046681 | Bacteria | 700 |
| 311 | Ga0495658_0387302 | 3300046683 | Bacteria | 890 |
| 312 | Ga0495658_0696114 | 3300046683 | Unclassified | 651 |
| 313 | Ga0495669_0077137 | 3300046684 | Bacteria | 1526 |
| 314 | Ga0495613_0333293 | 3300046689 | Bacteria | 1045 |
| 315 | Ga0495624_0132313 | 3300046690 | Bacteria | 1529 |
| 316 | Ga0495670_0100235 | 3300046691 | Bacteria | 1491 |
| 317 | Ga0495581_0327431 | 3300047315 | Bacteria | 895 |
| 318 | Ga0495676_0052076 | 3300047321 | Bacteria | 3270 |
| 319 | Ga0495684_0164393 | 3300047471 | Bacteria | 1654 |
| 320 | Ga0495686_0341804 | 3300047472 | Bacteria | 816 |
| 321 | Ga0495686_0401078 | 3300047472 | Bacteria | 736 |
| 322 | Ga0495593_0187486 | 3300047673 | Bacteria | 1041 |
| 323 | Ga0495615_0326514 | 3300048090 | Bacteria | 502 |
| 324 | Ga0495626_0374504 | 3300048091 | Bacteria | 553 |
| 325 | Ga0496101_0300666 | 3300048904 | Bacteria | 1257 |
| 326 | Ga0496103_0700554 | 3300048906 | Bacteria | 642 |
| 327 | Ga0496104_0137539 | 3300048907 | Bacteria | 2347 |
| 328 | Ga0496104_0335579 | 3300048907 | Bacteria | 1425 |
| 329 | Ga0496105_0106828 | 3300048908 | Bacteria | 2311 |
| 330 | Ga0496106_0750865 | 3300048909 | Bacteria | 776 |
| 331 | Ga0496107_0120890 | 3300048910 | Bacteria | 1929 |
| 332 | Ga0496108_0377546 | 3300048911 | Bacteria | 1238 |
| 333 | Ga0496110_1088314 | 3300048913 | Unclassified | 707 |
| 334 | Ga0496114_1067136 | 3300048917 | Unclassified | 692 |
| 335 | Ga0496115_0283856 | 3300048918 | Bacteria | 1359 |
| 336 | Ga0496115_0328263 | 3300048918 | Bacteria | 1250 |
| 337 | Ga0496115_1440761 | 3300048918 | Bacteria | 507 |
| 338 | Ga0496119_0023858 | 3300048922 | Bacteria | 4323 |
| 339 | Ga0496119_0105353 | 3300048922 | Bacteria | 1575 |
| 340 | Ga0496120_0002038 | 3300048923 | Bacteria | 21901 |
| 341 | Ga0496121_0400809 | 3300048924 | Bacteria | 899 |
| 342 | Ga0496125_0059505 | 3300048928 | Bacteria | 3078 |
| 343 | Ga0496126_0072915 | 3300048929 | Plasmid | 3053 |
| 344 | Ga0496126_0515968 | 3300048929 | Bacteria | 953 |
| 345 | Ga0501032_0170746 | 3300049569 | Bacteria | 1426 |
| 346 | Ga0501033_0012011 | 3300049570 | Bacteria | 6615 |
| 347 | Ga0501034_0378986 | 3300049571 | Bacteria | 1340 |
| 348 | Ga0501034_0997027 | 3300049571 | Bacteria | 722 |
| 349 | Ga0501034_1368940 | 3300049571 | Unclassified | 583 |
| 350 | Ga0501036_0018128 | 3300049572 | Bacteria | 5894 |
| 351 | Ga0501037_1001182 | 3300049573 | Bacteria | 544 |
| 352 | Ga0501038_0033554 | 3300049574 | Bacteria | 4521 |
| 353 | Ga0501040_0057575 | 3300049576 | Bacteria | 2668 |
| 354 | Ga0501041_0074248 | 3300049577 | Bacteria | 2089 |
| 355 | Ga0501042_0020709 | 3300049578 | Bacteria | 4578 |
| 356 | Ga0501046_0010995 | 3300049580 | Bacteria | 7759 |
| 357 | Ga0501048_0034745 | 3300049582 | Bacteria | 3634 |
| 358 | Ga0501071_0095260 | 3300049587 | Bacteria | 2190 |
| 359 | Ga0501072_0040309 | 3300049588 | Bacteria | 3667 |
| 360 | Ga0501073_0014169 | 3300049589 | Bacteria | 5789 |
| 361 | Ga0501074_0186084 | 3300049590 | Bacteria | 1481 |
| 362 | Ga0501075_0020152 | 3300049591 | Bacteria | 4845 |
| 363 | Ga0501076_0004321 | 3300049592 | Bacteria | 10078 |
| 364 | Ga0501076_1715801 | 3300049592 | Bacteria | 515 |
| 365 | Ga0501077_0126303 | 3300049593 | Bacteria | 1621 |
| 366 | Ga0501079_0035305 | 3300049741 | Bacteria | 3848 |
| 367 | Ga0501080_0366581 | 3300049742 | Bacteria | 1299 |
| 368 | Ga0501081_0157548 | 3300049743 | Bacteria | 1634 |
| 369 | Ga0501083_0077308 | 3300049744 | Bacteria | 2209 |
| 370 | Ga0501083_0660106 | 3300049744 | Bacteria | 680 |
| 371 | Ga0501035_0355064 | 3300049822 | Bacteria | 1226 |
| 372 | Ga0501045_0020458 | 3300049824 | Bacteria | 4726 |
| 373 | nmdc:mga03683_152792_c1 | 3300050489 | Bacteria | 1042 |
| 374 | nmdc:mga03683_265784_c1 | 3300050489 | Bacteria | 799 |
| 375 | nmdc:mga03683_364460_c1 | 3300050489 | Bacteria | 686 |
| 376 | nmdc:mga03683_413365_c1 | 3300050489 | Bacteria | 645 |
| 377 | nmdc:mga03683_42642_c1 | 3300050489 | Bacteria | 1868 |
| 378 | nmdc:mga03683_43084_c1 | 3300050489 | Bacteria | 1860 |
| 379 | nmdc:mga03n38_29837_c1 | 3300050490 | Bacteria | 2286 |
| 380 | nmdc:mga03n38_316954_c1 | 3300050490 | Bacteria | 841 |
| 381 | nmdc:mga03n38_43019_c1 | 3300050490 | Bacteria | 1978 |
| 382 | nmdc:mga00v17_106451_c1 | 3300050491 | Bacteria | 1775 |
| 383 | nmdc:mga00v17_505690_c1 | 3300050491 | Bacteria | 783 |
| 384 | nmdc:mga00v17_741770_c1 | 3300050491 | Bacteria | 628 |
| 385 | nmdc:mga0yw44_1230611_c1 | 3300050492 | Bacteria | 505 |
| 386 | nmdc:mga0yw44_302171_c1 | 3300050492 | Bacteria | 1072 |
| 387 | nmdc:mga0yw44_331948_c1 | 3300050492 | Bacteria | 1022 |
| 388 | nmdc:mga0yw44_3617_c1 | 3300050492 | Bacteria | 6897 |
| 389 | nmdc:mga0yw44_440275_c1 | 3300050492 | Bacteria | 883 |
| 390 | nmdc:mga0yw44_48924_c1 | 3300050492 | Bacteria | 2550 |
| 391 | nmdc:mga0yw44_52111_c1 | 3300050492 | Bacteria | 2480 |
| 392 | nmdc:mga0yw44_528426_c1 | 3300050492 | Bacteria | 801 |
| 393 | nmdc:mga0k408_125982_c1 | 3300050493 | Bacteria | 1519 |
| 394 | nmdc:mga0k408_521151_c1 | 3300050493 | Bacteria | 704 |
| 395 | nmdc:mga0k408_77766_c1 | 3300050493 | Bacteria | 1079 |
| 396 | nmdc:mga0k408_783368_c1 | 3300050493 | Bacteria | 556 |
| 397 | nmdc:mga06z11_166548_c1 | 3300050494 | Bacteria | 1263 |
| 398 | nmdc:mga06z11_231058_c1 | 3300050494 | Bacteria | 1084 |
| 399 | nmdc:mga06z11_608331_c1 | 3300050494 | Bacteria | 665 |
| 400 | nmdc:mga06z11_666556_c1 | 3300050494 | Bacteria | 633 |
| 401 | nmdc:mga06z11_693302_c1 | 3300050494 | Bacteria | 620 |
| 402 | nmdc:mga06z11_946908_c1 | 3300050494 | Bacteria | 525 |
| 403 | nmdc:mga04h51_138917_c1 | 3300050495 | Bacteria | 920 |
| 404 | nmdc:mga07m45_186945_c1 | 3300050496 | Bacteria | 1204 |
| 405 | nmdc:mga07m45_21663_c1 | 3300050496 | Bacteria | 3501 |
| 406 | nmdc:mga07m45_488220_c1 | 3300050496 | Bacteria | 713 |
| 407 | nmdc:mga07m45_71126_c1 | 3300050496 | Bacteria | 1077 |
| 408 | nmdc:mga07m45_79785_c1 | 3300050496 | Bacteria | 1868 |
| 409 | nmdc:mga05p37_1232224_c1 | 3300050507 | Bacteria | 770 |
| 410 | nmdc:mga05p37_18584_c1 | 3300050507 | Bacteria | 8401 |
| 411 | nmdc:mga09592_39424_c1 | 3300050508 | Bacteria | 3968 |
| 412 | nmdc:mga09592_55343_c1 | 3300050508 | Bacteria | 3353 |
| 413 | nmdc:mga09592_737205_c1 | 3300050508 | Unclassified | 837 |
| 414 | nmdc:mga0qj67_3566_c1 | 3300050509 | Bacteria | 11233 |
| 415 | nmdc:mga0qj67_478655_c1 | 3300050509 | Bacteria | 1002 |
| 416 | nmdc:mga06r32_1044_c1 | 3300050510 | Bacteria | 24972 |
| 417 | nmdc:mga06r32_304853_c1 | 3300050510 | Bacteria | 1578 |
| 418 | nmdc:mga06r32_448872_c1 | 3300050510 | Bacteria | 1269 |
| 419 | nmdc:mga0n895_2943_c1 | 3300050512 | Bacteria | 13510 |
| 420 | nmdc:mga0rr50_1128461_c1 | 3300050513 | Bacteria | 667 |
| 421 | nmdc:mga0a205_129809_c1 | 3300050515 | Bacteria | 2421 |
| 422 | nmdc:mga0sz30_10879_c1 | 3300050516 | Bacteria | 3498 |
| 423 | nmdc:mga0sz30_17471_c1 | 3300050516 | Bacteria | 2861 |
| 424 | nmdc:mga0sz30_84234_c1 | 3300050516 | Bacteria | 1378 |
| 425 | Ga0500610_0148667 | 3300053079 | Bacteria | 1176 |
| 426 | Ga0495655_0016524 | 3300053083 | Bacteria | 1591 |
| 427 | Ga0495655_0322059 | 3300053083 | Bacteria | 536 |
| 428 | Ga0495619_0101780 | 3300053085 | Bacteria | 1956 |
| 429 | Ga0500643_057043 | 3300053087 | Bacteria | 1103 |
| 430 | Ga0500651_0675196 | 3300053093 | Bacteria | 554 |
| 431 | Ga0500555_004132 | 3300053103 | Bacteria | 4130 |
| 432 | Ga0500592_031971 | 3300053116 | Bacteria | 849 |
| 433 | Ga0500595_053821 | 3300053119 | Bacteria | 1238 |
| 434 | Ga0500658_0261418 | 3300053134 | Bacteria | 796 |
| 435 | Ga0500604_0019073 | 3300053151 | Bacteria | 1917 |
| 436 | Ga0500604_0082255 | 3300053151 | Bacteria | 1042 |
| 437 | Ga0500616_0112006 | 3300053153 | Bacteria | 1317 |
| 438 | Ga0500620_000301 | 3300053155 | Bacteria | 9422 |
| 439 | Ga0500627_0038343 | 3300053158 | Bacteria | 2048 |
| 440 | Ga0500627_0052658 | 3300053158 | Bacteria | 1777 |
| 441 | Ga0500627_0135299 | 3300053158 | Bacteria | 1113 |
| 442 | Ga0500611_008828 | 3300053727 | Bacteria | 1575 |
| 443 | Ga0501084_0013582 | 3300054114 | Bacteria | 6739 |
| 444 | Ga0501082_0036442 | 3300060353 | Bacteria | 4238 |
| 445 | Ga0501082_0068914 | 3300060353 | Bacteria | 3046 |
| 446 | Ga0530510_0017143 | 3300061734 | Bacteria | 5130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041509 | Ga0451843_1316481 | Ga0451843_1316481_588_935 | 102 |
| 2 | 3300007788 | Ga0099795_10227851 | Ga0099795_102278512 | 104 |
| 3 | iso_pu_bacteria | 2929199973 | 2929202226 | 104 |
| 4 | iso_pu_bacteria | 8055909800 | 8055916643 | 104 |
| 5 | 3300005617 | Ga0068859_100155575 | Ga0068859_1001555754 | 105 |
| 6 | 3300005618 | Ga0068864_100367631 | Ga0068864_1003676313 | 105 |
| 7 | 3300005841 | Ga0068863_100258004 | Ga0068863_1002580042 | 105 |
| 8 | 3300005842 | Ga0068858_100938407 | Ga0068858_1009384072 | 105 |
| 9 | 3300005843 | Ga0068860_100124056 | Ga0068860_1001240562 | 105 |
| 10 | 3300005844 | Ga0068862_100196144 | Ga0068862_1001961442 | 105 |
| 11 | 3300006931 | Ga0097620_100155571 | Ga0097620_1001555714 | 105 |
| 12 | 3300009011 | Ga0105251_10450926 | Ga0105251_104509261 | 105 |
| 13 | 3300009147 | Ga0114129_10450423 | Ga0114129_104504232 | 105 |
| 14 | 3300009553 | Ga0105249_10061692 | Ga0105249_100616922 | 105 |
| 15 | 3300013308 | Ga0157375_10131589 | Ga0157375_101315894 | 105 |
| 16 | 3300025941 | Ga0207711_11734275 | Ga0207711_117342752 | 105 |
| 17 | 3300025961 | Ga0207712_10326018 | Ga0207712_103260182 | 105 |
| 18 | 3300026095 | Ga0207676_10165166 | Ga0207676_101651662 | 105 |
| 19 | 3300035695 | Ga0373927_0143638 | Ga0373927_0143638_364_690 | 105 |
| 20 | 3300053087 | Ga0500643_057043 | Ga0500643_057043_206_580 | 105 |
| 21 | iso_pu_bacteria | 2671180531 | 2673164467 | 105 |
| 22 | 3300005328 | Ga0070676_10004641 | Ga0070676_1000464110 | 106 |
| 23 | 3300005330 | Ga0070690_100043614 | Ga0070690_1000436144 | 106 |
| 24 | 3300005331 | Ga0070670_100254643 | Ga0070670_1002546434 | 106 |
| 25 | 3300005333 | Ga0070677_10593923 | Ga0070677_105939231 | 106 |
| 26 | 3300005334 | Ga0068869_100434289 | Ga0068869_1004342891 | 106 |
| 27 | 3300005335 | Ga0070666_10009622 | Ga0070666_100096222 | 106 |
| 28 | 3300005335 | Ga0070666_10134421 | Ga0070666_101344213 | 106 |
| 29 | 3300005340 | Ga0070689_100110142 | Ga0070689_1001101421 | 106 |
| 30 | 3300005347 | Ga0070668_100566270 | Ga0070668_1005662701 | 106 |
| 31 | 3300005354 | Ga0070675_100007265 | Ga0070675_1000072655 | 106 |
| 32 | 3300005355 | Ga0070671_100046594 | Ga0070671_1000465942 | 106 |
| 33 | 3300005367 | Ga0070667_100007565 | Ga0070667_1000075656 | 106 |
| 34 | 3300005456 | Ga0070678_100009598 | Ga0070678_1000095984 | 106 |
| 35 | 3300005459 | Ga0068867_100004874 | Ga0068867_10000487410 | 106 |
| 36 | 3300005467 | Ga0070706_100959708 | Ga0070706_1009597082 | 106 |
| 37 | 3300005543 | Ga0070672_100004907 | Ga0070672_1000049076 | 106 |
| 38 | 3300005548 | Ga0070665_100028490 | Ga0070665_1000284903 | 106 |
| 39 | 3300005618 | Ga0068864_100007408 | Ga0068864_1000074082 | 106 |
| 40 | 3300005718 | Ga0068866_10114917 | Ga0068866_101149173 | 106 |
| 41 | 3300005840 | Ga0068870_10009071 | Ga0068870_100090712 | 106 |
| 42 | 3300005841 | Ga0068863_100064252 | Ga0068863_1000642523 | 106 |
| 43 | 3300005842 | Ga0068858_100025579 | Ga0068858_1000255792 | 106 |
| 44 | 3300005843 | Ga0068860_100006112 | Ga0068860_10000611211 | 106 |
| 45 | 3300006237 | Ga0097621_100011941 | Ga0097621_1000119415 | 106 |
| 46 | 3300006358 | Ga0068871_100010536 | Ga0068871_1000105366 | 106 |
| 47 | 3300006844 | Ga0075428_100045172 | Ga0075428_1000451723 | 106 |
| 48 | 3300006844 | Ga0075428_100840968 | Ga0075428_1008409682 | 106 |
| 49 | 3300006847 | Ga0075431_101925512 | Ga0075431_1019255121 | 106 |
| 50 | 3300006881 | Ga0068865_100006382 | Ga0068865_1000063823 | 106 |
| 51 | 3300009147 | Ga0114129_12430833 | Ga0114129_124308332 | 106 |
| 52 | 3300009148 | Ga0105243_12393024 | Ga0105243_123930241 | 106 |
| 53 | 3300009177 | Ga0105248_10001222 | Ga0105248_1000122210 | 106 |
| 54 | 3300009553 | Ga0105249_10338327 | Ga0105249_103383274 | 106 |
| 55 | 3300013296 | Ga0157374_10003730 | Ga0157374_100037303 | 106 |
| 56 | 3300013306 | Ga0163162_10024800 | Ga0163162_100248002 | 106 |
| 57 | 3300014325 | Ga0163163_11435874 | Ga0163163_114358741 | 106 |
| 58 | 3300014968 | Ga0157379_10003011 | Ga0157379_100030114 | 106 |
| 59 | 3300014969 | Ga0157376_10175529 | Ga0157376_101755294 | 106 |
| 60 | 3300025315 | Ga0207697_10007205 | Ga0207697_100072056 | 106 |
| 61 | 3300025893 | Ga0207682_10116111 | Ga0207682_101161111 | 106 |
| 62 | 3300025903 | Ga0207680_10023691 | Ga0207680_100236913 | 106 |
| 63 | 3300025903 | Ga0207680_10449502 | Ga0207680_104495021 | 106 |
| 64 | 3300025923 | Ga0207681_10034544 | Ga0207681_100345446 | 106 |
| 65 | 3300025925 | Ga0207650_10031741 | Ga0207650_100317413 | 106 |
| 66 | 3300025926 | Ga0207659_10008074 | Ga0207659_100080745 | 106 |
| 67 | 3300025936 | Ga0207670_10033884 | Ga0207670_100338843 | 106 |
| 68 | 3300025938 | Ga0207704_10101761 | Ga0207704_101017612 | 106 |
| 69 | 3300025940 | Ga0207691_10000328 | Ga0207691_1000032837 | 106 |
| 70 | 3300025941 | Ga0207711_10015761 | Ga0207711_100157614 | 106 |
| 71 | 3300025960 | Ga0207651_10007297 | Ga0207651_100072974 | 106 |
| 72 | 3300025961 | Ga0207712_11764235 | Ga0207712_117642351 | 106 |
| 73 | 3300025972 | Ga0207668_10014932 | Ga0207668_100149323 | 106 |
| 74 | 3300025986 | Ga0207658_10006246 | Ga0207658_100062466 | 106 |
| 75 | 3300026035 | Ga0207703_10017883 | Ga0207703_100178833 | 106 |
| 76 | 3300026088 | Ga0207641_10012496 | Ga0207641_100124962 | 106 |
| 77 | 3300026089 | Ga0207648_10001220 | Ga0207648_1000122012 | 106 |
| 78 | 3300026095 | Ga0207676_10079807 | Ga0207676_100798072 | 106 |
| 79 | 3300026121 | Ga0207683_10000807 | Ga0207683_100008079 | 106 |
| 80 | 3300028379 | Ga0268266_10055814 | Ga0268266_100558143 | 106 |
| 81 | 3300028381 | Ga0268264_10011189 | Ga0268264_100111894 | 106 |
| 82 | 3300044694 | Ga0466963_0452201 | Ga0466963_0452201_326_664 | 106 |
| 83 | 3300045049 | Ga0466959_0309020 | Ga0466959_0309020_126_464 | 106 |
| 84 | 3300045049 | Ga0466959_0622942 | Ga0466959_0622942_102_440 | 106 |
| 85 | 3300048911 | Ga0496108_0377546 | Ga0496108_0377546_519_881 | 106 |
| 86 | 3300048913 | Ga0496110_1088314 | Ga0496110_1088314_232_594 | 106 |
| 87 | 3300005340 | Ga0070689_101076382 | Ga0070689_1010763821 | 107 |
| 88 | 3300005347 | Ga0070668_101062029 | Ga0070668_1010620292 | 107 |
| 89 | 3300005353 | Ga0070669_100920442 | Ga0070669_1009204422 | 107 |
| 90 | 3300005354 | Ga0070675_100958374 | Ga0070675_1009583742 | 107 |
| 91 | 3300005355 | Ga0070671_100121661 | Ga0070671_1001216612 | 107 |
| 92 | 3300005366 | Ga0070659_100089716 | Ga0070659_1000897162 | 107 |
| 93 | 3300005455 | Ga0070663_100315012 | Ga0070663_1003150122 | 107 |
| 94 | 3300005467 | Ga0070706_100050889 | Ga0070706_1000508891 | 107 |
| 95 | 3300005539 | Ga0068853_100747910 | Ga0068853_1007479102 | 107 |
| 96 | 3300005545 | Ga0070695_100620698 | Ga0070695_1006206982 | 107 |
| 97 | 3300005545 | Ga0070695_101396365 | Ga0070695_1013963651 | 107 |
| 98 | 3300005546 | Ga0070696_100221454 | Ga0070696_1002214542 | 107 |
| 99 | 3300005549 | Ga0070704_100207832 | Ga0070704_1002078323 | 107 |
| 100 | 3300005614 | Ga0068856_101143853 | Ga0068856_1011438532 | 107 |
| 101 | 3300005615 | Ga0070702_101133844 | Ga0070702_1011338441 | 107 |
| 102 | 3300005617 | Ga0068859_100213471 | Ga0068859_1002134712 | 107 |
| 103 | 3300005719 | Ga0068861_101762318 | Ga0068861_1017623182 | 107 |
| 104 | 3300005842 | Ga0068858_100199918 | Ga0068858_1001999183 | 107 |
| 105 | 3300005842 | Ga0068858_100291962 | Ga0068858_1002919623 | 107 |
| 106 | 3300005843 | Ga0068860_100013607 | Ga0068860_10001360710 | 107 |
| 107 | 3300005843 | Ga0068860_100283735 | Ga0068860_1002837352 | 107 |
| 108 | 3300005844 | Ga0068862_100524830 | Ga0068862_1005248301 | 107 |
| 109 | 3300006178 | Ga0075367_10103053 | Ga0075367_101030532 | 107 |
| 110 | 3300006237 | Ga0097621_101528807 | Ga0097621_1015288072 | 107 |
| 111 | 3300006358 | Ga0068871_100076035 | Ga0068871_1000760353 | 107 |
| 112 | 3300006844 | Ga0075428_100118979 | Ga0075428_1001189793 | 107 |
| 113 | 3300006846 | Ga0075430_100000987 | Ga0075430_10000098713 | 107 |
| 114 | 3300006846 | Ga0075430_100507389 | Ga0075430_1005073892 | 107 |
| 115 | 3300006847 | Ga0075431_100007436 | Ga0075431_1000074365 | 107 |
| 116 | 3300006847 | Ga0075431_100093249 | Ga0075431_1000932493 | 107 |
| 117 | 3300006852 | Ga0075433_10087097 | Ga0075433_100870973 | 107 |
| 118 | 3300006871 | Ga0075434_100005931 | Ga0075434_1000059313 | 107 |
| 119 | 3300006880 | Ga0075429_100003695 | Ga0075429_1000036955 | 107 |
| 120 | 3300006880 | Ga0075429_100067171 | Ga0075429_1000671714 | 107 |
| 121 | 3300006880 | Ga0075429_100790391 | Ga0075429_1007903913 | 107 |
| 122 | 3300006880 | Ga0075429_100871653 | Ga0075429_1008716532 | 107 |
| 123 | 3300006914 | Ga0075436_100953843 | Ga0075436_1009538432 | 107 |
| 124 | 3300006931 | Ga0097620_100213463 | Ga0097620_1002134634 | 107 |
| 125 | 3300007076 | Ga0075435_101189982 | Ga0075435_1011899822 | 107 |
| 126 | 3300009101 | Ga0105247_11223055 | Ga0105247_112230552 | 107 |
| 127 | 3300009147 | Ga0114129_10013251 | Ga0114129_100132517 | 107 |
| 128 | 3300009147 | Ga0114129_10173444 | Ga0114129_101734444 | 107 |
| 129 | 3300009147 | Ga0114129_11826534 | Ga0114129_118265342 | 107 |
| 130 | 3300009177 | Ga0105248_10214679 | Ga0105248_102146792 | 107 |
| 131 | 3300009177 | Ga0105248_10274189 | Ga0105248_102741893 | 107 |
| 132 | 3300009553 | Ga0105249_11884673 | Ga0105249_118846732 | 107 |
| 133 | 3300009553 | Ga0105249_12911190 | Ga0105249_129111901 | 107 |
| 134 | 3300010375 | Ga0105239_11732074 | Ga0105239_117320742 | 107 |
| 135 | 3300013296 | Ga0157374_11181262 | Ga0157374_111812622 | 107 |
| 136 | 3300013297 | Ga0157378_10852950 | Ga0157378_108529502 | 107 |
| 137 | 3300013306 | Ga0163162_10193758 | Ga0163162_101937582 | 107 |
| 138 | 3300014325 | Ga0163163_11347715 | Ga0163163_113477151 | 107 |
| 139 | 3300014325 | Ga0163163_12608712 | Ga0163163_126087122 | 107 |
| 140 | 3300014745 | Ga0157377_11495523 | Ga0157377_114955232 | 107 |
| 141 | 3300014968 | Ga0157379_10381896 | Ga0157379_103818962 | 107 |
| 142 | 3300025926 | Ga0207659_10577609 | Ga0207659_105776092 | 107 |
| 143 | 3300025932 | Ga0207690_10214845 | Ga0207690_102148452 | 107 |
| 144 | 3300025941 | Ga0207711_10165119 | Ga0207711_101651194 | 107 |
| 145 | 3300025941 | Ga0207711_10180317 | Ga0207711_101803171 | 107 |
| 146 | 3300025972 | Ga0207668_10087046 | Ga0207668_100870464 | 107 |
| 147 | 3300025986 | Ga0207658_10284028 | Ga0207658_102840282 | 107 |
| 148 | 3300026035 | Ga0207703_10139067 | Ga0207703_101390673 | 107 |
| 149 | 3300026035 | Ga0207703_10217405 | Ga0207703_102174052 | 107 |
| 150 | 3300026041 | Ga0207639_10800148 | Ga0207639_108001482 | 107 |
| 151 | 3300026067 | Ga0207678_10753388 | Ga0207678_107533882 | 107 |
| 152 | 3300026088 | Ga0207641_10420170 | Ga0207641_104201701 | 107 |
| 153 | 3300028379 | Ga0268266_11555298 | Ga0268266_115552981 | 107 |
| 154 | 3300028381 | Ga0268264_10203306 | Ga0268264_102033062 | 107 |
| 155 | 3300028381 | Ga0268264_11249735 | Ga0268264_112497352 | 107 |
| 156 | 3300031824 | Ga0307413_10318731 | Ga0307413_103187311 | 107 |
| 157 | 3300032126 | Ga0307415_101221566 | Ga0307415_1012215661 | 107 |
| 158 | 3300035207 | Ga0373942_0140422 | Ga0373942_0140422_399_737 | 107 |
| 159 | 3300035691 | Ga0373931_0266587 | Ga0373931_0266587_417_755 | 107 |
| 160 | 3300035691 | Ga0373931_0930464 | Ga0373931_0930464_115_462 | 107 |
| 161 | 3300041491 | Ga0451833_1481792 | Ga0451833_1481792_136_474 | 107 |
| 162 | 3300041503 | Ga0451847_0674360 | Ga0451847_0674360_274_612 | 107 |
| 163 | 3300045051 | Ga0451576_0140380 | Ga0451576_0140380_492_830 | 107 |
| 164 | 3300046457 | Ga0495590_0065011 | Ga0495590_0065011_624_962 | 107 |
| 165 | 3300046683 | Ga0495658_0696114 | Ga0495658_0696114_12_362 | 107 |
| 166 | 3300048907 | Ga0496104_0137539 | Ga0496104_0137539_343_681 | 107 |
| 167 | 3300048907 | Ga0496104_0335579 | Ga0496104_0335579_1015_1353 | 107 |
| 168 | 3300048908 | Ga0496105_0106828 | Ga0496105_0106828_177_515 | 107 |
| 169 | 3300048917 | Ga0496114_1067136 | Ga0496114_1067136_236_574 | 107 |
| 170 | 3300049569 | Ga0501032_0170746 | Ga0501032_0170746_529_867 | 107 |
| 171 | 3300049570 | Ga0501033_0012011 | Ga0501033_0012011_1911_2249 | 107 |
| 172 | 3300049571 | Ga0501034_0997027 | Ga0501034_0997027_83_421 | 107 |
| 173 | 3300049571 | Ga0501034_1368940 | Ga0501034_1368940_188_526 | 107 |
| 174 | 3300049572 | Ga0501036_0018128 | Ga0501036_0018128_516_854 | 107 |
| 175 | 3300049573 | Ga0501037_1001182 | Ga0501037_1001182_34_372 | 107 |
| 176 | 3300049574 | Ga0501038_0033554 | Ga0501038_0033554_463_801 | 107 |
| 177 | 3300049576 | Ga0501040_0057575 | Ga0501040_0057575_481_819 | 107 |
| 178 | 3300049577 | Ga0501041_0074248 | Ga0501041_0074248_432_770 | 107 |
| 179 | 3300049578 | Ga0501042_0020709 | Ga0501042_0020709_2266_2604 | 107 |
| 180 | 3300049580 | Ga0501046_0010995 | Ga0501046_0010995_5308_5646 | 107 |
| 181 | 3300049582 | Ga0501048_0034745 | Ga0501048_0034745_2745_3083 | 107 |
| 182 | 3300049587 | Ga0501071_0095260 | Ga0501071_0095260_208_546 | 107 |
| 183 | 3300049588 | Ga0501072_0040309 | Ga0501072_0040309_3044_3382 | 107 |
| 184 | 3300049590 | Ga0501074_0186084 | Ga0501074_0186084_639_977 | 107 |
| 185 | 3300049591 | Ga0501075_0020152 | Ga0501075_0020152_3976_4314 | 107 |
| 186 | 3300049592 | Ga0501076_0004321 | Ga0501076_0004321_4840_5178 | 107 |
| 187 | 3300049593 | Ga0501077_0126303 | Ga0501077_0126303_285_623 | 107 |
| 188 | 3300049741 | Ga0501079_0035305 | Ga0501079_0035305_1270_1608 | 107 |
| 189 | 3300049743 | Ga0501081_0157548 | Ga0501081_0157548_992_1330 | 107 |
| 190 | 3300049744 | Ga0501083_0077308 | Ga0501083_0077308_1413_1751 | 107 |
| 191 | 3300049822 | Ga0501035_0355064 | Ga0501035_0355064_313_651 | 107 |
| 192 | 3300049824 | Ga0501045_0020458 | Ga0501045_0020458_2241_2579 | 107 |
| 193 | 3300050494 | nmdc:mga06z11_608331_c1 | nmdc:mga06z11_608331_c1_252_590 | 107 |
| 194 | 3300050507 | nmdc:mga05p37_1232224_c1 | nmdc:mga05p37_1232224_c1_60_398 | 107 |
| 195 | 3300050507 | nmdc:mga05p37_18584_c1 | nmdc:mga05p37_18584_c1_5224_5580 | 107 |
| 196 | 3300050508 | nmdc:mga09592_39424_c1 | nmdc:mga09592_39424_c1_2204_2542 | 107 |
| 197 | 3300050508 | nmdc:mga09592_55343_c1 | nmdc:mga09592_55343_c1_2567_2905 | 107 |
| 198 | 3300050508 | nmdc:mga09592_737205_c1 | nmdc:mga09592_737205_c1_347_688 | 107 |
| 199 | 3300050509 | nmdc:mga0qj67_3566_c1 | nmdc:mga0qj67_3566_c1_334_672 | 107 |
| 200 | 3300050509 | nmdc:mga0qj67_478655_c1 | nmdc:mga0qj67_478655_c1_205_543 | 107 |
| 201 | 3300050510 | nmdc:mga06r32_1044_c1 | nmdc:mga06r32_1044_c1_18587_18925 | 107 |
| 202 | 3300050510 | nmdc:mga06r32_304853_c1 | nmdc:mga06r32_304853_c1_1164_1502 | 107 |
| 203 | 3300050510 | nmdc:mga06r32_448872_c1 | nmdc:mga06r32_448872_c1_75_413 | 107 |
| 204 | 3300050512 | nmdc:mga0n895_2943_c1 | nmdc:mga0n895_2943_c1_10983_11321 | 107 |
| 205 | 3300050513 | nmdc:mga0rr50_1128461_c1 | nmdc:mga0rr50_1128461_c1_23_361 | 107 |
| 206 | 3300050515 | nmdc:mga0a205_129809_c1 | nmdc:mga0a205_129809_c1_519_857 | 107 |
| 207 | 3300054114 | Ga0501084_0013582 | Ga0501084_0013582_2275_2613 | 107 |
| 208 | 3300060353 | Ga0501082_0036442 | Ga0501082_0036442_892_1230 | 107 |
| 209 | 3300060353 | Ga0501082_0068914 | Ga0501082_0068914_2536_2874 | 107 |
| 210 | 3300061734 | Ga0530510_0017143 | Ga0530510_0017143_532_870 | 107 |
| 211 | iso_pu_bacteria | 2684623219 | 2687235960 | 108 |
| 212 | iso_pu_bacteria | 2883291878 | 2883293421 | 108 |
| 213 | 3300006177 | Ga0075362_10054880 | Ga0075362_100548803 | 109 |
| 214 | 3300031824 | Ga0307413_10891821 | Ga0307413_108918211 | 109 |
| 215 | 3300050489 | nmdc:mga03683_42642_c1 | nmdc:mga03683_42642_c1_1243_1584 | 109 |
| 216 | 3300050492 | nmdc:mga0yw44_302171_c1 | nmdc:mga0yw44_302171_c1_581_922 | 109 |
| 217 | 3300005289 | Ga0065704_10079924 | Ga0065704_100799243 | 110 |
| 218 | 3300005329 | Ga0070683_100236060 | Ga0070683_1002360602 | 110 |
| 219 | 3300005563 | Ga0068855_100225116 | Ga0068855_1002251163 | 110 |
| 220 | 3300005577 | Ga0068857_100007844 | Ga0068857_1000078445 | 110 |
| 221 | 3300009174 | Ga0105241_10013134 | Ga0105241_100131343 | 110 |
| 222 | 3300009545 | Ga0105237_10572824 | Ga0105237_105728242 | 110 |
| 223 | 3300009551 | Ga0105238_10652726 | Ga0105238_106527261 | 110 |
| 224 | 3300010375 | Ga0105239_10063343 | Ga0105239_100633432 | 110 |
| 225 | 3300013105 | Ga0157369_10714163 | Ga0157369_107141632 | 110 |
| 226 | 3300013307 | Ga0157372_10265707 | Ga0157372_102657072 | 110 |
| 227 | 3300025911 | Ga0207654_10022478 | Ga0207654_100224784 | 110 |
| 228 | 3300025913 | Ga0207695_10812519 | Ga0207695_108125192 | 110 |
| 229 | 3300025944 | Ga0207661_10181718 | Ga0207661_101817182 | 110 |
| 230 | 3300026116 | Ga0207674_10000920 | Ga0207674_1000092018 | 110 |
| 231 | iso_pu_bacteria | 2874612657 | 2874619534 | 111 |
| 232 | 3300005458 | Ga0070681_10477278 | Ga0070681_104772783 | 112 |
| 233 | 3300005458 | Ga0070681_10567970 | Ga0070681_105679702 | 112 |
| 234 | 3300006038 | Ga0075365_10011552 | Ga0075365_100115527 | 112 |
| 235 | 3300006042 | Ga0075368_10304650 | Ga0075368_103046502 | 112 |
| 236 | 3300006051 | Ga0075364_10646453 | Ga0075364_106464532 | 112 |
| 237 | 3300006177 | Ga0075362_10285990 | Ga0075362_102859901 | 112 |
| 238 | 3300006178 | Ga0075367_10477211 | Ga0075367_104772112 | 112 |
| 239 | 3300006186 | Ga0075369_10004094 | Ga0075369_100040947 | 112 |
| 240 | 3300006195 | Ga0075366_10129952 | Ga0075366_101299522 | 112 |
| 241 | 3300006195 | Ga0075366_10257512 | Ga0075366_102575122 | 112 |
| 242 | 3300006353 | Ga0075370_10246098 | Ga0075370_102460982 | 112 |
| 243 | 3300013104 | Ga0157370_10153410 | Ga0157370_101534104 | 112 |
| 244 | 3300026116 | Ga0207674_11036550 | Ga0207674_110365502 | 112 |
| 245 | 3300027866 | Ga0209813_10237355 | Ga0209813_102373552 | 112 |
| 246 | 3300050489 | nmdc:mga03683_364460_c1 | nmdc:mga03683_364460_c1_76_414 | 112 |
| 247 | 3300050489 | nmdc:mga03683_413365_c1 | nmdc:mga03683_413365_c1_92_430 | 112 |
| 248 | 3300050491 | nmdc:mga00v17_505690_c1 | nmdc:mga00v17_505690_c1_216_554 | 112 |
| 249 | 3300050492 | nmdc:mga0yw44_1230611_c1 | nmdc:mga0yw44_1230611_c1_81_419 | 112 |
| 250 | 3300050492 | nmdc:mga0yw44_48924_c1 | nmdc:mga0yw44_48924_c1_505_843 | 112 |
| 251 | 3300050493 | nmdc:mga0k408_125982_c1 | nmdc:mga0k408_125982_c1_704_1057 | 112 |
| 252 | 3300050493 | nmdc:mga0k408_77766_c1 | nmdc:mga0k408_77766_c1_251_589 | 112 |
| 253 | 3300050494 | nmdc:mga06z11_946908_c1 | nmdc:mga06z11_946908_c1_67_405 | 112 |
| 254 | 3300050496 | nmdc:mga07m45_21663_c1 | nmdc:mga07m45_21663_c1_191_544 | 112 |
| 255 | 3300050496 | nmdc:mga07m45_79785_c1 | nmdc:mga07m45_79785_c1_1380_1718 | 112 |
| 256 | 3300050516 | nmdc:mga0sz30_17471_c1 | nmdc:mga0sz30_17471_c1_812_1150 | 112 |
| 257 | 3300050516 | nmdc:mga0sz30_84234_c1 | nmdc:mga0sz30_84234_c1_142_480 | 112 |
| 258 | 3300006038 | Ga0075365_10417795 | Ga0075365_104177952 | 113 |
| 259 | 3300031731 | Ga0307405_11388519 | Ga0307405_113885191 | 113 |
| 260 | 3300032002 | Ga0307416_100194572 | Ga0307416_1001945723 | 113 |
| 261 | 3300032126 | Ga0307415_100843640 | Ga0307415_1008436402 | 113 |
| 262 | 3300047472 | Ga0495686_0401078 | Ga0495686_0401078_318_677 | 113 |
| 263 | 3300053103 | Ga0500555_004132 | Ga0500555_004132_3068_3412 | 113 |
| 264 | iso_pu_bacteria | 2513237090 | 2513608030 | 113 |
| 265 | iso_pu_bacteria | 2513237305 | 2514423199 | 113 |
| 266 | iso_pu_bacteria | 2599185301 | 2599938572 | 113 |
| 267 | iso_pu_bacteria | 2693429783 | 2694632694 | 113 |
| 268 | iso_pu_bacteria | 2693429784 | 2694639577 | 113 |
| 269 | iso_pu_bacteria | 2721755686 | 2723577789 | 113 |
| 270 | iso_pu_bacteria | 2856349417 | 2856354703 | 113 |
| 271 | iso_pu_bacteria | 2876377896 | 2876384515 | 113 |
| 272 | iso_pu_bacteria | 2881155292 | 2881157865 | 113 |
| 273 | iso_pu_bacteria | 2881853255 | 2881858653 | 113 |
| 274 | iso_pu_bacteria | 2882632389 | 2882639943 | 113 |
| 275 | iso_pu_bacteria | 2885342637 | 2885344127 | 113 |
| 276 | iso_pu_bacteria | 2885350715 | 2885351789 | 113 |
| 277 | iso_pu_bacteria | 2938014810 | 2938019998 | 113 |
| 278 | iso_pu_bacteria | 2961127735 | 2961133733 | 113 |
| 279 | 3300049571 | Ga0501034_0378986 | Ga0501034_0378986_30_383 | 114 |
| 280 | 3300049592 | Ga0501076_1715801 | Ga0501076_1715801_126_479 | 114 |
| 281 | iso_pu_bacteria | 2509276022 | 2509398114 | 114 |
| 282 | iso_pu_bacteria | 2510065059 | 2510316691 | 114 |
| 283 | iso_pu_bacteria | 2512875024 | 2512964230 | 114 |
| 284 | iso_pu_bacteria | 2643221595 | 2643986181 | 114 |
| 285 | iso_pu_bacteria | 2643221627 | 2644152412 | 114 |
| 286 | iso_pu_bacteria | 2791355123 | 2792753041 | 114 |
| 287 | iso_pu_bacteria | 2844002411 | 2844005387 | 114 |
| 288 | iso_pu_bacteria | 2844009547 | 2844015839 | 114 |
| 289 | iso_pu_bacteria | 2856320880 | 2856326542 | 114 |
| 290 | iso_pu_bacteria | 2869169390 | 2869175614 | 114 |
| 291 | iso_pu_bacteria | 2869234852 | 2869236320 | 114 |
| 292 | iso_pu_bacteria | 2869242130 | 2869246090 | 114 |
| 293 | iso_pu_bacteria | 2869256925 | 2869261404 | 114 |
| 294 | iso_pu_bacteria | 2869278585 | 2869280344 | 114 |
| 295 | iso_pu_bacteria | 2871435913 | 2871437284 | 114 |
| 296 | iso_pu_bacteria | 2871451962 | 2871456185 | 114 |
| 297 | iso_pu_bacteria | 2871466892 | 2871467650 | 114 |
| 298 | iso_pu_bacteria | 2871481445 | 2871483350 | 114 |
| 299 | iso_pu_bacteria | 2874109183 | 2874110372 | 114 |
| 300 | iso_pu_bacteria | 2874116593 | 2874117326 | 114 |
| 301 | iso_pu_bacteria | 2874123672 | 2874126598 | 114 |
| 302 | iso_pu_bacteria | 2874139085 | 2874144453 | 114 |
| 303 | iso_pu_bacteria | 2874168670 | 2874173761 | 114 |
| 304 | iso_pu_bacteria | 2876386047 | 2876392247 | 114 |
| 305 | iso_pu_bacteria | 2878730984 | 2878736846 | 114 |
| 306 | iso_pu_bacteria | 2878738818 | 2878744172 | 114 |
| 307 | iso_pu_bacteria | 2881147464 | 2881154129 | 114 |
| 308 | iso_pu_bacteria | 2885305155 | 2885312159 | 114 |
| 309 | iso_pu_bacteria | 2885312484 | 2885315763 | 114 |
| 310 | iso_pu_bacteria | 2885326080 | 2885326809 | 114 |
| 311 | iso_pu_bacteria | 2885334103 | 2885339072 | 114 |
| 312 | iso_pu_bacteria | 2888337043 | 2888341887 | 114 |
| 313 | iso_pu_bacteria | 2903513507 | 2903515843 | 114 |
| 314 | iso_pu_bacteria | 2906378014 | 2906381980 | 114 |
| 315 | iso_pu_bacteria | 2906401398 | 2906405518 | 114 |
| 316 | iso_pu_bacteria | 2924710171 | 2924710936 | 114 |
| 317 | iso_pu_bacteria | 2924718760 | 2924722664 | 114 |
| 318 | iso_pu_bacteria | 2924733363 | 2924738686 | 114 |
| 319 | iso_pu_bacteria | 2924741084 | 2924741858 | 114 |
| 320 | iso_pu_bacteria | 2924762789 | 2924766190 | 114 |
| 321 | iso_pu_bacteria | 2924776078 | 2924782089 | 114 |
| 322 | iso_pu_bacteria | 2937861824 | 2937863187 | 114 |
| 323 | iso_pu_bacteria | 2937877337 | 2937877783 | 114 |
| 324 | iso_pu_bacteria | 2937972304 | 2937977853 | 114 |
| 325 | iso_pu_bacteria | 2937980651 | 2937980998 | 114 |
| 326 | iso_pu_bacteria | 2958034702 | 2958036213 | 114 |
| 327 | iso_pu_bacteria | 2958041894 | 2958047637 | 114 |
| 328 | iso_pu_bacteria | 2958084443 | 2958084891 | 114 |
| 329 | iso_pu_bacteria | 2958092219 | 2958093144 | 114 |
| 330 | iso_pu_bacteria | 2958108152 | 2958112304 | 114 |
| 331 | iso_pu_bacteria | 2958144490 | 2958146114 | 114 |
| 332 | iso_pu_bacteria | 2961183825 | 2961184993 | 114 |
| 333 | iso_pu_bacteria | 2968016561 | 2968022149 | 114 |
| 334 | iso_pu_bacteria | 2968138860 | 2968144677 | 114 |
| 335 | iso_pu_bacteria | 2970469710 | 2970474739 | 114 |
| 336 | iso_pu_bacteria | 2970489779 | 2970494405 | 114 |
| 337 | iso_pu_bacteria | 2970510686 | 2970510769 | 114 |
| 338 | iso_pu_bacteria | 2970532167 | 2970537901 | 114 |
| 339 | iso_pu_bacteria | 2970593180 | 2970594942 | 114 |
| 340 | iso_pu_bacteria | 2970619444 | 2970626718 | 114 |
| 341 | iso_pu_bacteria | 2970627176 | 2970630210 | 114 |
| 342 | iso_pu_bacteria | 2977851361 | 2977857515 | 114 |
| 343 | iso_pu_bacteria | 2977898635 | 2977898677 | 114 |
| 344 | iso_pu_bacteria | 2977907340 | 2977909865 | 114 |
| 345 | iso_pu_bacteria | 2979764755 | 2979768462 | 114 |
| 346 | iso_pu_bacteria | 2979772303 | 2979775241 | 114 |
| 347 | iso_pu_bacteria | 2987666974 | 2987670730 | 114 |
| 348 | iso_pu_bacteria | 2996348954 | 2996354149 | 114 |
| 349 | iso_pu_bacteria | 2996386984 | 2996387430 | 114 |
| 350 | iso_pu_bacteria | 3004167301 | 3004171333 | 114 |
| 351 | iso_pu_bacteria | 3004232784 | 3004233375 | 114 |
| 352 | iso_pu_bacteria | 3004248173 | 3004249118 | 114 |
| 353 | iso_pu_bacteria | 3004268573 | 3004270400 | 114 |
| 354 | iso_pu_bacteria | 3004275668 | 3004280817 | 114 |
| 355 | iso_pu_bacteria | 3004289098 | 3004291637 | 114 |
| 356 | iso_pu_bacteria | 8004312739 | 8004319899 | 114 |
| 357 | iso_pu_bacteria | 8004727605 | 8004728046 | 114 |
| 358 | iso_pu_bacteria | 2775506902 | 2776272381 | 115 |
| 359 | iso_pu_bacteria | 2775506904 | 2776284321 | 115 |
| 360 | iso_pu_bacteria | 2839993093 | 2839994389 | 115 |
| 361 | iso_pu_bacteria | 2841734538 | 2841735173 | 115 |
| 362 | iso_pu_bacteria | 2869162929 | 2869163120 | 115 |
| 363 | iso_pu_bacteria | 2871474448 | 2871481377 | 115 |
| 364 | iso_pu_bacteria | 2878788777 | 2878792593 | 115 |
| 365 | iso_pu_bacteria | 2894652903 | 2894655246 | 115 |
| 366 | iso_pu_bacteria | 2937822353 | 2937828576 | 115 |
| 367 | iso_pu_bacteria | 2937836603 | 2937840389 | 115 |
| 368 | iso_pu_bacteria | 3002141150 | 3002142868 | 115 |
| 369 | iso_pu_bacteria | 8004633249 | 8004638885 | 115 |
| 370 | iso_pu_bacteria | 8055617313 | 8055623609 | 115 |
| 371 | 3300005354 | Ga0070675_100951267 | Ga0070675_1009512672 | 116 |
| 372 | 3300005356 | Ga0070674_100918380 | Ga0070674_1009183801 | 116 |
| 373 | 3300010375 | Ga0105239_11262766 | Ga0105239_112627661 | 116 |
| 374 | 3300025901 | Ga0207688_10692798 | Ga0207688_106927982 | 116 |
| 375 | 3300035089 | Ga0373944_0019077 | Ga0373944_0019077_1262_1615 | 116 |
| 376 | 3300035113 | Ga0373936_0115008 | Ga0373936_0115008_494_847 | 116 |
| 377 | 3300035116 | Ga0373945_0019775 | Ga0373945_0019775_1761_2114 | 116 |
| 378 | 3300035170 | Ga0373943_0088303 | Ga0373943_0088303_782_1135 | 116 |
| 379 | 3300035171 | Ga0373946_0027960 | Ga0373946_0027960_143_496 | 116 |
| 380 | 3300035692 | Ga0373935_0109556 | Ga0373935_0109556_1063_1416 | 116 |
| 381 | 3300035695 | Ga0373927_0025832 | Ga0373927_0025832_1526_1879 | 116 |
| 382 | 3300035725 | Ga0373947_0083528 | Ga0373947_0083528_931_1284 | 116 |
| 383 | 3300037068 | Ga0373925_0125637 | Ga0373925_0125637_70_423 | 116 |
| 384 | 3300046455 | Ga0495603_0032915 | Ga0495603_0032915_631_984 | 116 |
| 385 | 3300046460 | Ga0495638_0337643 | Ga0495638_0337643_56_406 | 116 |
| 386 | 3300046472 | Ga0495580_0649628 | Ga0495580_0649628_311_664 | 116 |
| 387 | 3300046473 | Ga0495582_0090773 | Ga0495582_0090773_1077_1430 | 116 |
| 388 | 3300046475 | Ga0495639_0137386 | Ga0495639_0137386_533_886 | 116 |
| 389 | 3300046492 | Ga0495585_0084571 | Ga0495585_0084571_1086_1439 | 116 |
| 390 | 3300046499 | Ga0495594_0020793 | Ga0495594_0020793_1124_1477 | 116 |
| 391 | 3300046513 | Ga0495616_0291601 | Ga0495616_0291601_13_366 | 116 |
| 392 | 3300046515 | Ga0495620_0277538 | Ga0495620_0277538_272_622 | 116 |
| 393 | 3300046518 | Ga0495631_0322466 | Ga0495631_0322466_248_601 | 116 |
| 394 | 3300046519 | Ga0495632_0093077 | Ga0495632_0093077_540_890 | 116 |
| 395 | 3300046520 | Ga0495637_0138414 | Ga0495637_0138414_42_395 | 116 |
| 396 | 3300046526 | Ga0495666_0140448 | Ga0495666_0140448_24_377 | 116 |
| 397 | 3300046537 | Ga0495598_0023831 | Ga0495598_0023831_253_606 | 116 |
| 398 | 3300046539 | Ga0495621_0109329 | Ga0495621_0109329_434_787 | 116 |
| 399 | 3300046615 | Ga0495656_0047113 | Ga0495656_0047113_329_682 | 116 |
| 400 | 3300046642 | Ga0495634_0206834 | Ga0495634_0206834_578_931 | 116 |
| 401 | 3300046660 | Ga0495625_0045532 | Ga0495625_0045532_1524_1877 | 116 |
| 402 | 3300046674 | Ga0495588_0141669 | Ga0495588_0141669_686_1039 | 116 |
| 403 | 3300046681 | Ga0495647_0321413 | Ga0495647_0321413_333_686 | 116 |
| 404 | 3300046683 | Ga0495658_0387302 | Ga0495658_0387302_514_867 | 116 |
| 405 | 3300046684 | Ga0495669_0077137 | Ga0495669_0077137_678_1031 | 116 |
| 406 | 3300046690 | Ga0495624_0132313 | Ga0495624_0132313_732_1085 | 116 |
| 407 | 3300046691 | Ga0495670_0100235 | Ga0495670_0100235_315_668 | 116 |
| 408 | 3300047315 | Ga0495581_0327431 | Ga0495581_0327431_292_645 | 116 |
| 409 | 3300047321 | Ga0495676_0052076 | Ga0495676_0052076_783_1136 | 116 |
| 410 | 3300047472 | Ga0495686_0341804 | Ga0495686_0341804_429_779 | 116 |
| 411 | 3300048090 | Ga0495615_0326514 | Ga0495615_0326514_123_476 | 116 |
| 412 | 3300048091 | Ga0495626_0374504 | Ga0495626_0374504_123_476 | 116 |
| 413 | 3300053079 | Ga0500610_0148667 | Ga0500610_0148667_757_1107 | 116 |
| 414 | 3300053083 | Ga0495655_0016524 | Ga0495655_0016524_881_1234 | 116 |
| 415 | 3300053093 | Ga0500651_0675196 | Ga0500651_0675196_106_456 | 116 |
| 416 | 3300053116 | Ga0500592_031971 | Ga0500592_031971_467_820 | 116 |
| 417 | 3300053134 | Ga0500658_0261418 | Ga0500658_0261418_424_777 | 116 |
| 418 | 3300053151 | Ga0500604_0019073 | Ga0500604_0019073_357_710 | 116 |
| 419 | 3300053158 | Ga0500627_0038343 | Ga0500627_0038343_111_461 | 116 |
| 420 | 3300053158 | Ga0500627_0052658 | Ga0500627_0052658_148_498 | 116 |
| 421 | 3300001989 | JGI24739J22299_10192473 | JGI24739J22299_101924731 | 117 |
| 422 | 3300005367 | Ga0070667_102325545 | Ga0070667_1023255451 | 117 |
| 423 | 3300005535 | Ga0070684_101533354 | Ga0070684_1015333542 | 117 |
| 424 | 3300005539 | Ga0068853_100009790 | Ga0068853_1000097903 | 117 |
| 425 | 3300005539 | Ga0068853_100152218 | Ga0068853_1001522182 | 117 |
| 426 | 3300005563 | Ga0068855_101513486 | Ga0068855_1015134861 | 117 |
| 427 | 3300005616 | Ga0068852_100175522 | Ga0068852_1001755224 | 117 |
| 428 | 3300006038 | Ga0075365_10010622 | Ga0075365_100106224 | 117 |
| 429 | 3300006038 | Ga0075365_10155982 | Ga0075365_101559823 | 117 |
| 430 | 3300006042 | Ga0075368_10123415 | Ga0075368_101234152 | 117 |
| 431 | 3300006042 | Ga0075368_10398936 | Ga0075368_103989362 | 117 |
| 432 | 3300006048 | Ga0075363_100114661 | Ga0075363_1001146612 | 117 |
| 433 | 3300006051 | Ga0075364_10115826 | Ga0075364_101158263 | 117 |
| 434 | 3300006051 | Ga0075364_10354760 | Ga0075364_103547602 | 117 |
| 435 | 3300006177 | Ga0075362_10016284 | Ga0075362_100162844 | 117 |
| 436 | 3300006177 | Ga0075362_10026139 | Ga0075362_100261391 | 117 |
| 437 | 3300006178 | Ga0075367_10055496 | Ga0075367_100554962 | 117 |
| 438 | 3300006178 | Ga0075367_10228070 | Ga0075367_102280703 | 117 |
| 439 | 3300006186 | Ga0075369_10207651 | Ga0075369_102076512 | 117 |
| 440 | 3300006186 | Ga0075369_10326044 | Ga0075369_103260442 | 117 |
| 441 | 3300006195 | Ga0075366_10133416 | Ga0075366_101334163 | 117 |
| 442 | 3300006195 | Ga0075366_10609354 | Ga0075366_106093542 | 117 |
| 443 | 3300006353 | Ga0075370_10243353 | Ga0075370_102433533 | 117 |
| 444 | 3300006353 | Ga0075370_10644535 | Ga0075370_106445351 | 117 |
| 445 | 3300009093 | Ga0105240_10041488 | Ga0105240_100414882 | 117 |
| 446 | 3300009174 | Ga0105241_10153764 | Ga0105241_101537643 | 117 |
| 447 | 3300009545 | Ga0105237_10027026 | Ga0105237_100270266 | 117 |
| 448 | 3300009545 | Ga0105237_10537599 | Ga0105237_105375993 | 117 |
| 449 | 3300009551 | Ga0105238_10002917 | Ga0105238_100029176 | 117 |
| 450 | 3300010375 | Ga0105239_10101350 | Ga0105239_101013501 | 117 |
| 451 | 3300010375 | Ga0105239_12881395 | Ga0105239_128813951 | 117 |
| 452 | 3300013105 | Ga0157369_10153056 | Ga0157369_101530563 | 117 |
| 453 | 3300025261 | Ga0209233_1038271 | Ga0209233_10382712 | 117 |
| 454 | 3300025904 | Ga0207647_10547454 | Ga0207647_105474542 | 117 |
| 455 | 3300025911 | Ga0207654_10531290 | Ga0207654_105312902 | 117 |
| 456 | 3300025913 | Ga0207695_10433692 | Ga0207695_104336923 | 117 |
| 457 | 3300025914 | Ga0207671_10008635 | Ga0207671_100086359 | 117 |
| 458 | 3300025924 | Ga0207694_10051034 | Ga0207694_100510344 | 117 |
| 459 | 3300026041 | Ga0207639_10120441 | Ga0207639_101204414 | 117 |
| 460 | 3300027866 | Ga0209813_10125120 | Ga0209813_101251202 | 117 |
| 461 | 3300037418 | Ga0395900_0202444 | Ga0395900_0202444_638_991 | 117 |
| 462 | 3300037471 | Ga0395905_0148537 | Ga0395905_0148537_1597_1953 | 117 |
| 463 | 3300037471 | Ga0395905_0520744 | Ga0395905_0520744_627_980 | 117 |
| 464 | 3300038443 | Ga0395901_0088383 | Ga0395901_0088383_1631_1987 | 117 |
| 465 | 3300038443 | Ga0395901_0493964 | Ga0395901_0493964_372_725 | 117 |
| 466 | 3300048906 | Ga0496103_0700554 | Ga0496103_0700554_243_596 | 117 |
| 467 | 3300048909 | Ga0496106_0750865 | Ga0496106_0750865_353_706 | 117 |
| 468 | 3300048918 | Ga0496115_0283856 | Ga0496115_0283856_530_883 | 117 |
| 469 | 3300048924 | Ga0496121_0400809 | Ga0496121_0400809_483_836 | 117 |
| 470 | 3300048928 | Ga0496125_0059505 | Ga0496125_0059505_216_569 | 117 |
| 471 | 3300048929 | Ga0496126_0515968 | Ga0496126_0515968_383_736 | 117 |
| 472 | 3300049742 | Ga0501080_0366581 | Ga0501080_0366581_467_820 | 117 |
| 473 | 3300049744 | Ga0501083_0660106 | Ga0501083_0660106_98_457 | 117 |
| 474 | 3300050489 | nmdc:mga03683_152792_c1 | nmdc:mga03683_152792_c1_271_624 | 117 |
| 475 | 3300050489 | nmdc:mga03683_43084_c1 | nmdc:mga03683_43084_c1_1364_1717 | 117 |
| 476 | 3300050490 | nmdc:mga03n38_316954_c1 | nmdc:mga03n38_316954_c1_457_810 | 117 |
| 477 | 3300050490 | nmdc:mga03n38_43019_c1 | nmdc:mga03n38_43019_c1_958_1311 | 117 |
| 478 | 3300050491 | nmdc:mga00v17_741770_c1 | nmdc:mga00v17_741770_c1_31_384 | 117 |
| 479 | 3300050492 | nmdc:mga0yw44_528426_c1 | nmdc:mga0yw44_528426_c1_111_464 | 117 |
| 480 | 3300050493 | nmdc:mga0k408_783368_c1 | nmdc:mga0k408_783368_c1_106_459 | 117 |
| 481 | 3300050494 | nmdc:mga06z11_231058_c1 | nmdc:mga06z11_231058_c1_458_811 | 117 |
| 482 | 3300050496 | nmdc:mga07m45_186945_c1 | nmdc:mga07m45_186945_c1_743_1096 | 117 |
| 483 | 3300050496 | nmdc:mga07m45_488220_c1 | nmdc:mga07m45_488220_c1_44_397 | 117 |
| 484 | 3300050496 | nmdc:mga07m45_71126_c1 | nmdc:mga07m45_71126_c1_568_921 | 117 |
| 485 | iso_pu_bacteria | 2597489875 | 2597815712 | 117 |
| 486 | iso_pu_bacteria | 2856342000 | 2856349378 | 117 |
| 487 | iso_pu_bacteria | 2888343758 | 2888349192 | 117 |
| 488 | iso_pu_bacteria | 2924754689 | 2924756318 | 117 |
| 489 | iso_pu_bacteria | 2958071322 | 2958075827 | 117 |
| 490 | iso_pu_bacteria | 2970540015 | 2970543789 | 117 |
| 491 | iso_pu_bacteria | 8004395343 | 8004396702 | 117 |
| 492 | 3300001979 | JGI24740J21852_10195603 | JGI24740J21852_101956032 | 118 |
| 493 | 3300003214 | JGI25165J46597_1000016 | JGI25165J46597_1000016290 | 118 |
| 494 | 3300003762 | Ga0055542_1000172 | Ga0055542_10001721 | 118 |
| 495 | 3300005293 | Ga0065715_10437595 | Ga0065715_104375952 | 118 |
| 496 | 3300005327 | Ga0070658_10521933 | Ga0070658_105219331 | 118 |
| 497 | 3300005347 | Ga0070668_100350062 | Ga0070668_1003500622 | 118 |
| 498 | 3300005367 | Ga0070667_101016132 | Ga0070667_1010161322 | 118 |
| 499 | 3300005577 | Ga0068857_102228687 | Ga0068857_1022286872 | 118 |
| 500 | 3300005937 | Ga0081455_10602368 | Ga0081455_106023682 | 118 |
| 501 | 3300006038 | Ga0075365_10083877 | Ga0075365_100838773 | 118 |
| 502 | 3300006038 | Ga0075365_10192328 | Ga0075365_101923282 | 118 |
| 503 | 3300006038 | Ga0075365_10229147 | Ga0075365_102291473 | 118 |
| 504 | 3300006038 | Ga0075365_10394381 | Ga0075365_103943812 | 118 |
| 505 | 3300006177 | Ga0075362_10136168 | Ga0075362_101361682 | 118 |
| 506 | 3300009148 | Ga0105243_10423399 | Ga0105243_104233992 | 118 |
| 507 | 3300009174 | Ga0105241_10524994 | Ga0105241_105249941 | 118 |
| 508 | 3300009545 | Ga0105237_11137840 | Ga0105237_111378402 | 118 |
| 509 | 3300009551 | Ga0105238_11019382 | Ga0105238_110193821 | 118 |
| 510 | 3300013104 | Ga0157370_10638273 | Ga0157370_106382732 | 118 |
| 511 | 3300013296 | Ga0157374_11220324 | Ga0157374_112203242 | 118 |
| 512 | 3300014969 | Ga0157376_10732966 | Ga0157376_107329662 | 118 |
| 513 | 3300025254 | Ga0209148_1000057 | Ga0209148_1000057221 | 118 |
| 514 | 3300025261 | Ga0209233_1000068 | Ga0209233_1000068292 | 118 |
| 515 | 3300025272 | Ga0209455_1000240 | Ga0209455_100024042 | 118 |
| 516 | 3300025907 | Ga0207645_10306472 | Ga0207645_103064721 | 118 |
| 517 | 3300025911 | Ga0207654_10519744 | Ga0207654_105197441 | 118 |
| 518 | 3300025913 | Ga0207695_10934874 | Ga0207695_109348742 | 118 |
| 519 | 3300025924 | Ga0207694_10241127 | Ga0207694_102411273 | 118 |
| 520 | 3300025972 | Ga0207668_10846406 | Ga0207668_108464062 | 118 |
| 521 | 3300026116 | Ga0207674_10990507 | Ga0207674_109905072 | 118 |
| 522 | 3300028379 | Ga0268266_10174164 | Ga0268266_101741643 | 118 |
| 523 | 3300035242 | Ga0373962_0389870 | Ga0373962_0389870_29_388 | 118 |
| 524 | 3300035691 | Ga0373931_0696684 | Ga0373931_0696684_211_570 | 118 |
| 525 | 3300037418 | Ga0395900_0236455 | Ga0395900_0236455_118_474 | 118 |
| 526 | 3300041456 | Ga0451795_0098730 | Ga0451795_0098730_351_728 | 118 |
| 527 | 3300041498 | Ga0451841_0049401 | Ga0451841_0049401_31_387 | 118 |
| 528 | 3300041512 | Ga0451853_2932347 | Ga0451853_2932347_87_443 | 118 |
| 529 | 3300046459 | Ga0495629_1100620 | Ga0495629_1100620_113_469 | 118 |
| 530 | 3300046460 | Ga0495638_0168596 | Ga0495638_0168596_63_419 | 118 |
| 531 | 3300046616 | Ga0495668_0321127 | Ga0495668_0321127_238_594 | 118 |
| 532 | 3300046689 | Ga0495613_0333293 | Ga0495613_0333293_32_391 | 118 |
| 533 | 3300047471 | Ga0495684_0164393 | Ga0495684_0164393_791_1150 | 118 |
| 534 | 3300047673 | Ga0495593_0187486 | Ga0495593_0187486_237_596 | 118 |
| 535 | 3300048904 | Ga0496101_0300666 | Ga0496101_0300666_304_660 | 118 |
| 536 | 3300048910 | Ga0496107_0120890 | Ga0496107_0120890_1207_1575 | 118 |
| 537 | 3300048918 | Ga0496115_0328263 | Ga0496115_0328263_684_1040 | 118 |
| 538 | 3300048918 | Ga0496115_1440761 | Ga0496115_1440761_73_432 | 118 |
| 539 | 3300048922 | Ga0496119_0023858 | Ga0496119_0023858_2308_2664 | 118 |
| 540 | 3300048922 | Ga0496119_0105353 | Ga0496119_0105353_803_1159 | 118 |
| 541 | 3300048923 | Ga0496120_0002038 | Ga0496120_0002038_1636_1992 | 118 |
| 542 | 3300048929 | Ga0496126_0072915 | Ga0496126_0072915_955_1323 | 118 |
| 543 | 3300049589 | Ga0501073_0014169 | Ga0501073_0014169_4371_4733 | 118 |
| 544 | 3300050489 | nmdc:mga03683_265784_c1 | nmdc:mga03683_265784_c1_363_722 | 118 |
| 545 | 3300050490 | nmdc:mga03n38_29837_c1 | nmdc:mga03n38_29837_c1_1174_1533 | 118 |
| 546 | 3300050491 | nmdc:mga00v17_106451_c1 | nmdc:mga00v17_106451_c1_351_710 | 118 |
| 547 | 3300050492 | nmdc:mga0yw44_331948_c1 | nmdc:mga0yw44_331948_c1_634_990 | 118 |
| 548 | 3300050492 | nmdc:mga0yw44_3617_c1 | nmdc:mga0yw44_3617_c1_1959_2318 | 118 |
| 549 | 3300050492 | nmdc:mga0yw44_440275_c1 | nmdc:mga0yw44_440275_c1_113_472 | 118 |
| 550 | 3300050492 | nmdc:mga0yw44_52111_c1 | nmdc:mga0yw44_52111_c1_1671_2030 | 118 |
| 551 | 3300050493 | nmdc:mga0k408_521151_c1 | nmdc:mga0k408_521151_c1_315_674 | 118 |
| 552 | 3300050494 | nmdc:mga06z11_166548_c1 | nmdc:mga06z11_166548_c1_482_841 | 118 |
| 553 | 3300050494 | nmdc:mga06z11_666556_c1 | nmdc:mga06z11_666556_c1_20_379 | 118 |
| 554 | 3300050494 | nmdc:mga06z11_693302_c1 | nmdc:mga06z11_693302_c1_146_505 | 118 |
| 555 | 3300050495 | nmdc:mga04h51_138917_c1 | nmdc:mga04h51_138917_c1_380_739 | 118 |
| 556 | 3300050516 | nmdc:mga0sz30_10879_c1 | nmdc:mga0sz30_10879_c1_1443_1802 | 118 |
| 557 | 3300053083 | Ga0495655_0322059 | Ga0495655_0322059_82_438 | 118 |
| 558 | 3300053085 | Ga0495619_0101780 | Ga0495619_0101780_1458_1817 | 118 |
| 559 | 3300053119 | Ga0500595_053821 | Ga0500595_053821_566_922 | 118 |
| 560 | 3300053151 | Ga0500604_0082255 | Ga0500604_0082255_285_644 | 118 |
| 561 | 3300053153 | Ga0500616_0112006 | Ga0500616_0112006_158_526 | 118 |
| 562 | 3300053155 | Ga0500620_000301 | Ga0500620_000301_4586_4942 | 118 |
| 563 | 3300053158 | Ga0500627_0135299 | Ga0500627_0135299_654_1013 | 118 |
| 564 | 3300053727 | Ga0500611_008828 | Ga0500611_008828_355_711 | 118 |
| 565 | iso_pu_bacteria | 2970524798 | 2970529007 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9609 | 13 | 100 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9569 | 13 | 94 |
| 3f6o-assembly1.cif.gz_A | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9561 | 11 | 100 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9496 | 13 | 97 |
| 1wq2-assembly1.cif.gz_A | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.9267 | 23 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9609 | 13 | 100 | 1.10.10.10 |
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9562 | 13 | 93 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9286 | 13 | 92 | 1.10.10.10 |
| 1wq2A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9267 | 23 | 80 | 1.10.10.10 |
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9203 | 13 | 100 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5VFY7-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9954 | 13 | 93 |
GO:0003700
|
| AF-A0A0F4RFV9-F1-model_v4 | ArsR family transcriptional regulator | 0.9924 | 13 | 100 |
GO:0003700
|
| AF-A0A4R8VFF7-F1-model_v4 | deleted | 0.9885 | 13 | 95 |
|
| AF-A0A238K834-F1-model_v4 | Transcriptional repressor SdpR | 0.9842 | 14 | 104 |
GO:0003700
|
| AF-A0A0K0XZQ4-F1-model_v4 | ArsR family transcriptional regulator | 0.9796 | 16 | 97 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar