F464323

General Info

Members Datasets Scaffolds Average Seq Length
565 365 503 381

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_95314_c1|nmdc:mga06r32_95314_c1_1121_2413
Length 418
Sequence LTFVLISQSAHAQRFKGEGKTEFAARADSIPPERALRTNSERPNVPTLNLPVAGGKQAPYTMQQPREFPAAKPPFNRIAYAAAHVVADPLADADPWLDVAIDWERTVAFRRHLWSLGLGVAEAMDTAQRGMGLDWPTSLELIGRTLDAARDCPGALIGCGAGTDQLAANGASLDDVIRAYEEQCAAIEKLNGRIVLMASRALVKAARSPDDYAKVYGRILAQVKAPVIIHWLGEMFDPALDGYWGHKDHYAAMEVAVEVIAAHPEKVDGVKVSLLDKDKEIAMRRRLPQGVRMYTGDDFNYAELIGIFDAIAPAAGAALGALTRGEPETFHDILAPTVPLSRHIFMAPTRFYKTGVVFMAYLNGLQDHFTMVGGQESARSTLHLAELFRLADAAGLLADPDRAAARMRCVLATRGIAA

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
3 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
4 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
5 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
6 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
7 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
10 2643221580 Devosia sp. Root635 Isolate Unclassified
11 2643221582 Rhizobium sp. Root651 Isolate Unclassified
12 2643221591 Devosia sp. Root685 Isolate Unclassified
13 2643221629 Devosia sp. Root105 Isolate Unclassified
14 2643221662 Devosia sp. Root413D1 Isolate Unclassified
15 2643221674 Devosia sp. Root436 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2643221693 Rhizobium sp. Root491 Isolate Unclassified
18 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
19 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
20 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
21 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
22 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
23 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
24 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
25 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
26 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
27 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
28 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
29 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
30 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
31 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
32 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
33 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
34 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
35 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
36 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
37 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
38 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
39 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
40 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
41 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
42 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
43 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
44 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
45 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
46 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
47 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
48 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
49 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
50 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
51 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
52 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
53 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
54 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
55 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
56 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
57 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
60 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
61 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
62 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
350 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
351 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
352 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
353 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
356 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
362 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
363 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
364 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
365 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.2
Metatranscriptomes 0
Isolates 10.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 9.91
Nodule 4.25
Rhizoplane 10.97
Rhizosphere 63.89
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002028 3300001989 Bacteria 7752
2 JGI24735J21928_10005357 3300002067 Bacteria 4257
3 JGI24750J21931_1001065 3300002070 Bacteria 3586
4 JGI24738J21930_10003831 3300002075 Bacteria 3756
5 JGI25151J46595_10004033 3300003187 Bacteria 7876
6 rootH2_10036286 3300003320 Bacteria 1454
7 rootH2_10140249 3300003320 Bacteria 2826
8 JGI25160J50197_1000152 3300003354 Bacteria 60894
9 JGI25404J52841_10019199 3300003659 Bacteria 1481
10 Ga0058692_1001660 3300003856 Bacteria 7987
11 Ga0065165_1001079 3300005262 Bacteria 32537
12 Ga0065165_1001764 3300005262 Bacteria 21478
13 Ga0070683_100008490 3300005329 Bacteria 8725
14 Ga0070670_100059446 3300005331 Bacteria 3281
15 Ga0070670_100067059 3300005331 Bacteria 3080
16 Ga0068869_100039791 3300005334 Bacteria 3359
17 Ga0070666_10010009 3300005335 Bacteria 5917
18 Ga0070680_100007691 3300005336 Bacteria 8222
19 Ga0070680_100178870 3300005336 Bacteria 1786
20 Ga0070689_100059283 3300005340 Bacteria 2975
21 Ga0070661_100033885 3300005344 Bacteria 3702
22 Ga0070692_10130020 3300005345 Bacteria 1414
23 Ga0070671_100002293 3300005355 Bacteria 14772
24 Ga0070671_100062872 3300005355 Bacteria 3091
25 Ga0070674_100019337 3300005356 Bacteria 4325
26 Ga0070688_100027663 3300005365 Bacteria 3378
27 Ga0070667_100101861 3300005367 Bacteria 2481
28 Ga0070667_100272863 3300005367 Bacteria 1517
29 Ga0070709_10006670 3300005434 Bacteria 6303
30 Ga0070714_100005639 3300005435 Bacteria 9577
31 Ga0070713_100005618 3300005436 Bacteria 8599
32 Ga0070710_10001592 3300005437 Bacteria 10720
33 Ga0070694_100067615 3300005444 Bacteria 2453
34 Ga0070694_100170719 3300005444 Bacteria 1602
35 Ga0070678_100047778 3300005456 Bacteria 3078
36 Ga0070681_10000393 3300005458 Bacteria 35383
37 Ga0070681_10051649 3300005458 Bacteria 4100
38 Ga0068867_100146230 3300005459 Bacteria 1852
39 Ga0070679_100061160 3300005530 Bacteria 3754
40 Ga0070686_100165348 3300005544 Bacteria 1561
41 Ga0070665_100002585 3300005548 Bacteria 19803
42 Ga0070665_100037829 3300005548 Bacteria 4851
43 Ga0070704_100098358 3300005549 Bacteria 2198
44 Ga0068859_100189874 3300005617 Bacteria 2139
45 Ga0068859_100206879 3300005617 Bacteria 2048
46 Ga0068864_100052619 3300005618 Bacteria 3510
47 Ga0068864_100150912 3300005618 Bacteria 2105
48 Ga0068863_100005132 3300005841 Bacteria 12916
49 Ga0068862_100065762 3300005844 Bacteria 3123
50 Ga0081540_1000259 3300005983 Bacteria 55849
51 Ga0081540_1007648 3300005983 Bacteria 7667
52 Ga0070717_10002414 3300006028 Bacteria 13178
53 Ga0075365_10186601 3300006038 Bacteria 1450
54 Ga0075368_10002169 3300006042 Bacteria 6348
55 Ga0075368_10012500 3300006042 Bacteria 3105
56 Ga0075364_10024786 3300006051 Bacteria 3812
57 Ga0075364_10054580 3300006051 Bacteria 2613
58 Ga0075364_10112777 3300006051 Bacteria 1815
59 Ga0070715_10002800 3300006163 Bacteria 5429
60 Ga0075362_10006668 3300006177 Bacteria 4312
61 Ga0075367_10000357 3300006178 Bacteria 16390
62 Ga0075367_10040805 3300006178 Bacteria 2711
63 Ga0075366_10116562 3300006195 Bacteria 1608
64 Ga0097621_100001440 3300006237 Bacteria 16328
65 Ga0097621_100145266 3300006237 Bacteria 2030
66 Ga0075428_100000280 3300006844 Bacteria 50009
67 Ga0075428_100002145 3300006844 Bacteria 21309
68 Ga0075428_100029694 3300006844 Bacteria 6049
69 Ga0075430_100000319 3300006846 Bacteria 34222
70 Ga0075430_100004595 3300006846 Bacteria 11616
71 Ga0075430_100006309 3300006846 Bacteria 10002
72 Ga0075430_100011470 3300006846 Bacteria 7527
73 Ga0075430_100038383 3300006846 Bacteria 4056
74 Ga0075430_100079581 3300006846 Bacteria 2746
75 Ga0075431_100009654 3300006847 Bacteria 9689
76 Ga0075431_100198435 3300006847 Bacteria 2054
77 Ga0075431_100211303 3300006847 Bacteria 1982
78 Ga0075431_100230906 3300006847 Bacteria 1885
79 Ga0075434_100000003 3300006871 Bacteria 134839
80 Ga0075434_100284099 3300006871 Bacteria 1674
81 Ga0075429_100003718 3300006880 Bacteria 13008
82 Ga0075429_100008539 3300006880 Bacteria 8912
83 Ga0075429_100210108 3300006880 Bacteria 1705
84 Ga0075436_100012392 3300006914 Bacteria 5845
85 Ga0075436_100100594 3300006914 Bacteria 2013
86 Ga0097620_100189868 3300006931 Bacteria 2139
87 Ga0097620_100206906 3300006931 Bacteria 2048
88 Ga0099826_10000040 3300006948 Bacteria 98176
89 Ga0099826_10013124 3300006948 Bacteria 6255
90 Ga0075435_100010435 3300007076 Bacteria 6796
91 Ga0099794_10050607 3300007265 Bacteria 1999
92 Ga0111539_10000415 3300009094 Bacteria 53467
93 Ga0105247_10231192 3300009101 Bacteria 1256
94 Ga0114129_10003796 3300009147 Bacteria 21298
95 Ga0105243_10004732 3300009148 Bacteria 10707
96 Ga0105248_10042700 3300009177 Bacteria 5085
97 Ga0105248_10073325 3300009177 Bacteria 3847
98 Ga0105248_10282049 3300009177 Bacteria 1870
99 Ga0105248_10288341 3300009177 Bacteria 1848
100 Ga0157373_10003308 3300013100 Bacteria 12181
101 Ga0157371_10000042 3300013102 Bacteria 198938
102 Ga0157370_10000035 3300013104 Bacteria 137103
103 Ga0157369_10034340 3300013105 Bacteria 5567
104 Ga0157374_10000817 3300013296 Bacteria 27316
105 Ga0163162_10000119 3300013306 Bacteria 69465
106 Ga0163162_10100143 3300013306 Bacteria 2989
107 Ga0163162_10128562 3300013306 Bacteria 2641
108 Ga0157372_10208248 3300013307 Bacteria 2266
109 Ga0157375_10078104 3300013308 Bacteria 3342
110 Ga0163163_10002693 3300014325 Bacteria 15021
111 Ga0163163_10003896 3300014325 Bacteria 12723
112 Ga0157380_10081415 3300014326 Bacteria 2648
113 Ga0182008_10050620 3300014497 Bacteria 2062
114 Ga0157377_10052185 3300014745 Bacteria 2308
115 Ga0157376_10034320 3300014969 Bacteria 4096
116 Ga0157376_10111777 3300014969 Bacteria 2406
117 Ga0209435_100806 3300025206 Bacteria 5009
118 Ga0209759_1000097 3300025256 Bacteria 157627
119 Ga0209130_1005205 3300025284 Bacteria 4600
120 Ga0209675_1000882 3300025291 Bacteria 19297
121 Ga0209025_1000374 3300025294 Bacteria 93607
122 Ga0209564_1006003 3300025295 Bacteria 6710
123 Ga0209758_1000400 3300025297 Bacteria 74944
124 Ga0207426_1000103 3300025302 Bacteria 250320
125 Ga0207426_1002112 3300025302 Bacteria 13653
126 Ga0209051_1001712 3300025303 Bacteria 17510
127 Ga0207692_10002932 3300025898 Bacteria 6607
128 Ga0207642_10046573 3300025899 Bacteria 1933
129 Ga0207688_10081166 3300025901 Bacteria 1852
130 Ga0207680_10020835 3300025903 Bacteria 3539
131 Ga0207685_10001604 3300025905 Bacteria 4835
132 Ga0207699_10002399 3300025906 Bacteria 8849
133 Ga0207705_10146884 3300025909 Bacteria 1765
134 Ga0207707_10001889 3300025912 Bacteria 19120
135 Ga0207707_10030695 3300025912 Bacteria 4701
136 Ga0207693_10026790 3300025915 Bacteria 4560
137 Ga0207663_10001670 3300025916 Bacteria 10451
138 Ga0207660_10204867 3300025917 Bacteria 1542
139 Ga0207662_10012814 3300025918 Bacteria 4677
140 Ga0207662_10028204 3300025918 Bacteria 3244
141 Ga0207662_10212048 3300025918 Bacteria 1257
142 Ga0207657_10013968 3300025919 Bacteria 7857
143 Ga0207681_10087729 3300025923 Bacteria 2214
144 Ga0207650_10022119 3300025925 Bacteria 4500
145 Ga0207659_10081178 3300025926 Bacteria 2397
146 Ga0207659_10133111 3300025926 Bacteria 1922
147 Ga0207687_10259783 3300025927 Bacteria 1384
148 Ga0207700_10006118 3300025928 Bacteria 7249
149 Ga0207664_10023236 3300025929 Bacteria 4642
150 Ga0207644_10008769 3300025931 Bacteria 6621
151 Ga0207644_10041643 3300025931 Bacteria 3250
152 Ga0207690_10045508 3300025932 Bacteria 2900
153 Ga0207670_10074915 3300025936 Bacteria 2351
154 Ga0207670_10115989 3300025936 Bacteria 1938
155 Ga0207665_10086977 3300025939 Bacteria 2160
156 Ga0207691_10378131 3300025940 Bacteria 1209
157 Ga0207711_10020195 3300025941 Bacteria 5551
158 Ga0207711_10101463 3300025941 Bacteria 2546
159 Ga0207689_10003164 3300025942 Bacteria 15085
160 Ga0207689_10028873 3300025942 Bacteria 4638
161 Ga0207679_10237611 3300025945 Bacteria 1542
162 Ga0207658_10070887 3300025986 Bacteria 2638
163 Ga0207658_10081553 3300025986 Bacteria 2481
164 Ga0207708_10058060 3300026075 Bacteria 2953
165 Ga0207641_10018313 3300026088 Bacteria 5741
166 Ga0207641_10052319 3300026088 Bacteria 3458
167 Ga0207641_10128760 3300026088 Bacteria 2270
168 Ga0207648_10200478 3300026089 Bacteria 1770
169 Ga0207675_100019861 3300026118 Bacteria 6270
170 Ga0207683_10037248 3300026121 Bacteria 4235
171 Ga0207683_10075957 3300026121 Bacteria 2974
172 Ga0209371_1000003 3300027312 Bacteria 1122971
173 Ga0209371_1000998 3300027312 Bacteria 21742
174 Ga0209371_1010382 3300027312 Bacteria 2868
175 Ga0209969_1000360 3300027360 Bacteria 6116
176 Ga0209967_1000598 3300027364 Bacteria 4695
177 Ga0209981_1002027 3300027378 Bacteria 2590
178 Ga0210000_1000268 3300027462 Bacteria 7410
179 Ga0210000_1001534 3300027462 Bacteria 3257
180 Ga0209995_1001640 3300027471 Bacteria 3478
181 Ga0209999_1002061 3300027543 Bacteria 3513
182 Ga0209282_1000167 3300027666 Bacteria 37134
183 Ga0209282_1050107 3300027666 Bacteria 2403
184 Ga0209813_10013727 3300027866 Bacteria 2168
185 Ga0209813_10042412 3300027866 Bacteria 1390
186 Ga0207428_10004843 3300027907 Bacteria 12697
187 Ga0268266_10001510 3300028379 Bacteria 27433
188 Ga0268266_10002425 3300028379 Bacteria 20076
189 Ga0268266_10124537 3300028379 Bacteria 2298
190 Ga0268265_10023406 3300028380 Bacteria 4353
191 Ga0268264_10142385 3300028381 Bacteria 2140
192 Ga0268256_1000004 3300030500 Bacteria 1122967
193 Ga0268256_1002297 3300030500 Bacteria 9909
194 Ga0268256_1011138 3300030500 Bacteria 2868
195 Ga0268256_1012972 3300030500 Bacteria 2550
196 Ga0265325_10000291 3300031241 Bacteria 35029
197 Ga0265340_10047749 3300031247 Bacteria 2083
198 Ga0265316_10126203 3300031344 Bacteria 1929
199 Ga0307405_10062571 3300031731 Bacteria 2358
200 Ga0307412_10000003 3300031911 Bacteria 659081
201 Ga0307416_100198387 3300032002 Bacteria 1901
202 Ga0307507_10100209 3300033179 Bacteria 2428
203 Ga0307510_10016468 3300033180 Bacteria 8725
204 Ga0307510_10042938 3300033180 Bacteria 4920
205 Ga0373953_0041940 3300035117 Bacteria 1822
206 Ga0373954_0000003 3300035118 Bacteria 137757
207 Ga0373961_0012161 3300035241 Bacteria 2150
208 Ga0373961_0025522 3300035241 Bacteria 1607
209 Ga0373931_0002472 3300035691 Bacteria 8191
210 Ga0373931_0019088 3300035691 Bacteria 3417
211 Ga0373933_0011065 3300035724 Bacteria 4959
212 Ga0373937_0000131 3300036401 Bacteria 72767
213 Ga0373925_0035982 3300037068 Bacteria 3655
214 Ga0395899_0001796 3300037312 Bacteria 17781
215 Ga0395900_0058638 3300037418 Bacteria 3963
216 Ga0395898_0237623 3300037466 Bacteria 1738
217 Ga0395905_0026083 3300037471 Bacteria 5511
218 Ga0395901_0001705 3300038443 Bacteria 22698
219 Ga0395901_0338626 3300038443 Bacteria 1554
220 Ga0436365_0841579 3300039437 Bacteria 1833
221 Ga0436365_0961376 3300039437 Bacteria 13290
222 Ga0436365_1860307 3300039437 Bacteria 1317
223 Ga0451807_0028406 3300041486 Bacteria 4524
224 Ga0439441_000359 3300042001 Bacteria 4691
225 Ga0439460_0010474 3300042461 Bacteria 2374
226 Ga0466969_0002021 3300044656 Bacteria 10838
227 Ga0466965_0008955 3300044683 Bacteria 4639
228 Ga0466966_0002405 3300044684 Bacteria 12217
229 Ga0466966_0003694 3300044684 Bacteria 10092
230 Ga0466961_0001327 3300044693 Bacteria 15256
231 Ga0466961_0001482 3300044693 Bacteria 14592
232 Ga0466961_0003884 3300044693 Bacteria 9339
233 Ga0466964_0005963 3300044706 Bacteria 4539
234 Ga0466970_0001757 3300044765 Bacteria 10458
235 Ga0466970_0048420 3300044765 Bacteria 2266
236 Ga0466957_0006857 3300044842 Bacteria 6438
237 Ga0466959_0001528 3300045049 Bacteria 14221
238 Ga0466959_0003967 3300045049 Bacteria 9835
239 Ga0451576_0105022 3300045051 Bacteria 2938
240 Ga0451576_0336534 3300045051 Bacteria 1580
241 Ga0466958_0001223 3300045836 Bacteria 12013
242 Ga0466958_0006856 3300045836 Bacteria 6227
243 Ga0495592_0140163 3300046454 Bacteria 1683
244 Ga0495603_0000913 3300046455 Bacteria 16979
245 Ga0495603_0060178 3300046455 Bacteria 2244
246 Ga0495629_0000084 3300046459 Bacteria 83614
247 Ga0495629_0009472 3300046459 Bacteria 7124
248 Ga0495629_0013480 3300046459 Bacteria 5895
249 Ga0495653_0086428 3300046463 Bacteria 2305
250 Ga0495650_0000041 3300046471 Bacteria 363945
251 Ga0495650_0000543 3300046471 Bacteria 53935
252 Ga0495650_0040317 3300046471 Bacteria 2005
253 Ga0495580_0012872 3300046472 Bacteria 6409
254 Ga0495580_0044850 3300046472 Bacteria 3143
255 Ga0495580_0051643 3300046472 Bacteria 2906
256 Ga0495580_0224025 3300046472 Bacteria 1292
257 Ga0495582_0001739 3300046473 Bacteria 12287
258 Ga0495582_0026781 3300046473 Bacteria 3161
259 Ga0495639_0010035 3300046475 Bacteria 4070
260 Ga0495664_0002957 3300046477 Bacteria 9175
261 Ga0495594_0000064 3300046499 Bacteria 45387
262 Ga0495594_0000278 3300046499 Bacteria 25080
263 Ga0495594_0007198 3300046499 Bacteria 5722
264 Ga0495596_0007132 3300046500 Bacteria 5060
265 Ga0495596_0039340 3300046500 Bacteria 1868
266 Ga0495583_0010080 3300046506 Bacteria 5559
267 Ga0495583_0014486 3300046506 Bacteria 4349
268 Ga0495606_0059600 3300046507 Bacteria 2448
269 Ga0495608_0090008 3300046511 Bacteria 1986
270 Ga0495610_0000404 3300046512 Bacteria 44370
271 Ga0495618_0080264 3300046514 Bacteria 2082
272 Ga0495628_0016740 3300046516 Bacteria 6112
273 Ga0495631_0121345 3300046518 Bacteria 1124
274 Ga0495644_0000605 3300046523 Bacteria 15088
275 Ga0495648_0006282 3300046524 Bacteria 9718
276 Ga0495666_0001156 3300046526 Bacteria 12656
277 Ga0495642_0005457 3300046528 Bacteria 4886
278 Ga0495652_0013149 3300046529 Bacteria 7451
279 Ga0495665_0019374 3300046531 Bacteria 3659
280 Ga0495640_0018052 3300046533 Bacteria 5243
281 Ga0495586_0014069 3300046535 Bacteria 4250
282 Ga0495609_0019522 3300046538 Bacteria 3135
283 Ga0495621_0015002 3300046539 Bacteria 2463
284 Ga0495645_0000231 3300046543 Bacteria 40403
285 Ga0495645_0001708 3300046543 Bacteria 14933
286 Ga0495622_0014677 3300046557 Bacteria 3639
287 Ga0495667_0007018 3300046559 Bacteria 7643
288 Ga0495625_0057655 3300046660 Bacteria 2761
289 Ga0495625_0163256 3300046660 Bacteria 1491
290 Ga0495635_0006962 3300046663 Bacteria 7898
291 Ga0495588_0004233 3300046674 Bacteria 6331
292 Ga0495599_0014138 3300046678 Bacteria 4940
293 Ga0495599_0195915 3300046678 Bacteria 1242
294 Ga0495646_0002346 3300046680 Bacteria 11584
295 Ga0495669_0005308 3300046684 Bacteria 5370
296 Ga0495669_0010490 3300046684 Bacteria 3917
297 Ga0495669_0032230 3300046684 Bacteria 2303
298 Ga0495669_0051540 3300046684 Bacteria 1847
299 Ga0495613_0000700 3300046689 Bacteria 26428
300 Ga0495613_0012199 3300046689 Bacteria 6386
301 Ga0495624_0002596 3300046690 Bacteria 13633
302 Ga0495671_0022251 3300046692 Bacteria 3323
303 Ga0495649_0029406 3300046694 Bacteria 3039
304 Ga0495589_0002263 3300046794 Bacteria 10825
305 Ga0495581_0013142 3300047315 Bacteria 4800
306 Ga0495581_0148372 3300047315 Bacteria 1369
307 Ga0495636_0086486 3300047318 Bacteria 1356
308 Ga0495674_0014184 3300047319 Bacteria 7463
309 Ga0495672_0037443 3300047320 Bacteria 2968
310 Ga0495676_0029608 3300047321 Bacteria 4661
311 Ga0495676_0041762 3300047321 Bacteria 3771
312 Ga0495680_0006693 3300047322 Bacteria 10669
313 Ga0495683_0010589 3300047323 Bacteria 4865
314 Ga0495683_0043143 3300047323 Bacteria 2272
315 Ga0495687_007101 3300047443 Bacteria 6681
316 Ga0495687_041294 3300047443 Bacteria 2025
317 Ga0495675_0002174 3300047444 Bacteria 11689
318 Ga0495673_0011500 3300047469 Bacteria 4756
319 Ga0495673_0058188 3300047469 Bacteria 1667
320 Ga0495681_0012386 3300047470 Bacteria 5015
321 Ga0495684_0033211 3300047471 Bacteria 3960
322 Ga0495686_0121016 3300047472 Bacteria 1560
323 Ga0495593_0021592 3300047673 Bacteria 3593
324 Ga0495593_0028164 3300047673 Bacteria 3087
325 Ga0495593_0075067 3300047673 Bacteria 1753
326 Ga0495614_0000963 3300048089 Bacteria 12244
327 Ga0495614_0105876 3300048089 Bacteria 1232
328 Ga0496100_0017708 3300048903 Bacteria 4212
329 Ga0496101_0274616 3300048904 Bacteria 1316
330 Ga0496102_0074532 3300048905 Bacteria 3119
331 Ga0496102_0096896 3300048905 Bacteria 2735
332 Ga0496102_0102965 3300048905 Bacteria 2655
333 Ga0496102_0200903 3300048905 Bacteria 1879
334 Ga0496102_0205089 3300048905 Bacteria 1859
335 Ga0496103_0100724 3300048906 Bacteria 1828
336 Ga0496104_0000406 3300048907 Bacteria 37705
337 Ga0496104_0003010 3300048907 Bacteria 14511
338 Ga0496104_0009357 3300048907 Bacteria 8713
339 Ga0496104_0015099 3300048907 Bacteria 6990
340 Ga0496104_0017063 3300048907 Bacteria 6607
341 Ga0496104_0254307 3300048907 Bacteria 1670
342 Ga0496104_0325136 3300048907 Bacteria 1451
343 Ga0496105_0001047 3300048908 Bacteria 19154
344 Ga0496105_0004690 3300048908 Bacteria 10303
345 Ga0496105_0008980 3300048908 Bacteria 7797
346 Ga0496105_0027766 3300048908 Bacteria 4626
347 Ga0496105_0098643 3300048908 Bacteria 2412
348 Ga0496105_0200666 3300048908 Bacteria 1628
349 Ga0496106_0034458 3300048909 Bacteria 3781
350 Ga0496107_0042533 3300048910 Bacteria 3263
351 Ga0496108_0002003 3300048911 Bacteria 16322
352 Ga0496108_0028128 3300048911 Bacteria 4650
353 Ga0496109_0001337 3300048912 Bacteria 20357
354 Ga0496109_0012331 3300048912 Bacteria 7379
355 Ga0496109_0034899 3300048912 Bacteria 4534
356 Ga0496109_0134775 3300048912 Bacteria 2307
357 Ga0496110_0004175 3300048913 Bacteria 11155
358 Ga0496110_0043984 3300048913 Bacteria 3899
359 Ga0496110_0107547 3300048913 Bacteria 2504
360 Ga0496111_0007887 3300048914 Bacteria 7018
361 Ga0496111_0021665 3300048914 Bacteria 4491
362 Ga0496111_0029356 3300048914 Bacteria 3906
363 Ga0496111_0136853 3300048914 Bacteria 1814
364 Ga0496112_0001344 3300048915 Bacteria 18703
365 Ga0496112_0012523 3300048915 Bacteria 7791
366 Ga0496112_0060128 3300048915 Bacteria 3743
367 Ga0496112_0074063 3300048915 Bacteria 3367
368 Ga0496112_0140335 3300048915 Bacteria 2386
369 Ga0496112_0284856 3300048915 Bacteria 1599
370 Ga0496113_0003718 3300048916 Bacteria 9200
371 Ga0496113_0007339 3300048916 Bacteria 7080
372 Ga0496113_0025506 3300048916 Bacteria 4214
373 Ga0496113_0054287 3300048916 Bacteria 2999
374 Ga0496113_0078649 3300048916 Bacteria 2523
375 Ga0496113_0118789 3300048916 Bacteria 2065
376 Ga0496114_0004297 3300048917 Bacteria 11030
377 Ga0496114_0074200 3300048917 Bacteria 2863
378 Ga0496114_0165182 3300048917 Bacteria 1927
379 Ga0496114_0346521 3300048917 Bacteria 1314
380 Ga0496114_0400639 3300048917 Bacteria 1215
381 Ga0496115_0002089 3300048918 Bacteria 14308
382 Ga0496115_0010283 3300048918 Bacteria 6985
383 Ga0496115_0036572 3300048918 Bacteria 3888
384 Ga0496115_0066246 3300048918 Bacteria 2919
385 Ga0496116_0137214 3300048919 Bacteria 1382
386 Ga0496117_0000036 3300048920 Bacteria 325635
387 Ga0496117_0002472 3300048920 Bacteria 23206
388 Ga0496117_0017949 3300048920 Bacteria 5890
389 Ga0496117_0130898 3300048920 Bacteria 1521
390 Ga0496118_0000990 3300048921 Bacteria 44241
391 Ga0496118_0155092 3300048921 Bacteria 1426
392 Ga0496119_0012723 3300048922 Bacteria 6800
393 Ga0496120_0000036 3300048923 Bacteria 206505
394 Ga0496121_0000005 3300048924 Bacteria 1034486
395 Ga0496121_0070553 3300048924 Bacteria 2814
396 Ga0496121_0073066 3300048924 Bacteria 2750
397 Ga0496121_0105273 3300048924 Bacteria 2166
398 Ga0496122_0000002 3300048925 Bacteria 905834
399 Ga0496122_0016734 3300048925 Bacteria 6911
400 Ga0496122_0051655 3300048925 Bacteria 3120
401 Ga0496123_0000002 3300048926 Bacteria 1811682
402 Ga0496124_0000080 3300048927 Bacteria 210439
403 Ga0496124_0005551 3300048927 Bacteria 14128
404 Ga0496124_0070316 3300048927 Bacteria 2903
405 Ga0496124_0097604 3300048927 Bacteria 2385
406 Ga0496125_0000159 3300048928 Bacteria 151205
407 Ga0496126_0000734 3300048929 Bacteria 59483
408 Ga0496126_0176268 3300048929 Bacteria 1818
409 Ga0495682_0003424 3300049460 Bacteria 7056
410 Ga0495682_0004180 3300049460 Bacteria 6251
411 Ga0495682_0023138 3300049460 Bacteria 2321
412 Ga0501036_0045274 3300049572 Bacteria 3728
413 Ga0501036_0129926 3300049572 Bacteria 2127
414 Ga0501037_0021597 3300049573 Bacteria 4759
415 Ga0501038_0203995 3300049574 Bacteria 1585
416 Ga0501039_0001422 3300049575 Bacteria 17622
417 Ga0501039_0066483 3300049575 Bacteria 2798
418 Ga0501039_0233210 3300049575 Bacteria 1447
419 Ga0501040_0049808 3300049576 Bacteria 2865
420 Ga0501041_0002140 3300049577 Bacteria 11138
421 Ga0501042_0036746 3300049578 Bacteria 3475
422 Ga0501043_0011893 3300049579 Bacteria 6815
423 Ga0501046_0023901 3300049580 Bacteria 5019
424 Ga0501046_0095202 3300049580 Bacteria 2288
425 Ga0501048_0026841 3300049582 Bacteria 4191
426 Ga0501072_0014159 3300049588 Bacteria 6112
427 Ga0501072_0091602 3300049588 Bacteria 2414
428 Ga0501074_0126979 3300049590 Bacteria 1825
429 Ga0501075_0003293 3300049591 Bacteria 10814
430 Ga0501075_0053071 3300049591 Bacteria 3048
431 Ga0501076_0003274 3300049592 Bacteria 11341
432 Ga0501079_0085933 3300049741 Bacteria 2435
433 Ga0501080_0005820 3300049742 Bacteria 11037
434 Ga0501081_0000516 3300049743 Bacteria 21719
435 Ga0501081_0001649 3300049743 Bacteria 13814
436 Ga0501035_0306681 3300049822 Bacteria 1336
437 nmdc:mga03683_21713_c1 3300050489 Bacteria 2480
438 nmdc:mga03n38_43705_c1 3300050490 Bacteria 1965
439 nmdc:mga03n38_60770_c1 3300050490 Bacteria 1719
440 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
441 nmdc:mga00v17_37632_c1 3300050491 Bacteria 2470
442 nmdc:mga0yw44_110897_c1 3300050492 Bacteria 1758
443 nmdc:mga0yw44_63705_c1 3300050492 Bacteria 2268
444 nmdc:mga0k408_30771_c1 3300050493 Bacteria 3062
445 nmdc:mga06z11_14215_c1 3300050494 Bacteria 3520
446 nmdc:mga06z11_7960_c1 3300050494 Bacteria 4391
447 nmdc:mga06z11_91576_c1 3300050494 Bacteria 1651
448 nmdc:mga04h51_39259_c1 3300050495 Bacteria 1537
449 nmdc:mga04h51_56716_c1 3300050495 Bacteria 1331
450 nmdc:mga04h51_65123_c1 3300050495 Bacteria 1259
451 nmdc:mga07m45_92448_c1 3300050496 Bacteria 1734
452 nmdc:mga05p37_10912_c1 3300050507 Bacteria 10786
453 nmdc:mga05p37_139979_c1 3300050507 Bacteria 2965
454 nmdc:mga05p37_21649_c1 3300050507 Bacteria 7788
455 nmdc:mga05p37_21875_c1 3300050507 Bacteria 7749
456 nmdc:mga09592_1594_c1 3300050508 Bacteria 18277
457 nmdc:mga09592_179399_c1 3300050508 Bacteria 1832
458 nmdc:mga09592_18776_c1 3300050508 Bacteria 5672
459 nmdc:mga09592_63037_c1 3300050508 Bacteria 3137
460 nmdc:mga0qj67_134068_c1 3300050509 Bacteria 2007
461 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
462 nmdc:mga0qj67_252_c1 3300050509 Bacteria 36647
463 nmdc:mga0qj67_63182_c1 3300050509 Bacteria 2944
464 nmdc:mga0qj67_6610_c1 3300050509 Bacteria 8518
465 nmdc:mga06r32_16956_c1 3300050510 Bacteria 6645
466 nmdc:mga06r32_200359_c1 3300050510 Bacteria 1984
467 nmdc:mga06r32_95314_c1 3300050510 Bacteria 2912
468 nmdc:mga08y16_165920_c1 3300050511 Bacteria 2294
469 nmdc:mga08y16_28787_c1 3300050511 Bacteria 5855
470 nmdc:mga08y16_3283_c1 3300050511 Bacteria 16759
471 nmdc:mga0n895_6765_c1 3300050512 Bacteria 9780
472 nmdc:mga0rr50_2920_c1 3300050513 Bacteria 9758
473 nmdc:mga08x19_4603_c3 3300050514 Bacteria 3250
474 nmdc:mga08x19_68006_c1 3300050514 Bacteria 2318
475 nmdc:mga0a205_75160_c1 3300050515 Bacteria 3264
476 nmdc:mga0sz30_1633_c1 3300050516 Bacteria 7984
477 nmdc:mga0sz30_42148_c1 3300050516 Bacteria 1920
478 nmdc:mga0sz30_70001_c1 3300050516 Bacteria 1509
479 Ga0495601_0037111 3300053077 Bacteria 3046
480 Ga0495612_0019557 3300053078 Bacteria 2712
481 Ga0495619_0085500 3300053085 Bacteria 2130
482 Ga0495619_0136818 3300053085 Bacteria 1685
483 Ga0500651_0000002 3300053093 Bacteria 476609
484 Ga0500560_000204 3300053107 Bacteria 7053
485 Ga0500595_000012 3300053119 Bacteria 255472
486 Ga0500595_020004 3300053119 Bacteria 2417
487 Ga0500618_001007 3300053125 Bacteria 14209
488 Ga0500561_0000036 3300053137 Bacteria 27979
489 Ga0500604_0000777 3300053151 Bacteria 8778
490 Ga0500616_0057974 3300053153 Bacteria 2016
491 Ga0500624_000553 3300053157 Bacteria 10491
492 Ga0500634_0000373 3300053161 Bacteria 14283
493 Ga0500634_0003279 3300053161 Bacteria 7149
494 Ga0500636_0000011 3300053177 Bacteria 140769
495 Ga0500636_0000283 3300053177 Bacteria 28087
496 Ga0501084_0023633 3300054114 Bacteria 5126
497 Ga0501084_0046438 3300054114 Bacteria 3638
498 Ga0500661_000530 3300055283 Bacteria 7088
499 Ga0501082_0085318 3300060353 Bacteria 2723
500 Ga0501082_0088701 3300060353 Bacteria 2669
501 Ga0501082_0096941 3300060353 Bacteria 2549
502 Ga0530510_0042441 3300061734 Bacteria 3286
503 Ga0530510_0176938 3300061734 Bacteria 1581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0014069 Ga0495586_0014069_3318_4232 293
2 3300037466 Ga0395898_0237623 Ga0395898_0237623_30_977 304
3 3300046472 Ga0495580_0224025 Ga0495580_0224025_294_1259 310
4 3300046663 Ga0495635_0006962 Ga0495635_0006962_6916_7881 310
5 3300047673 Ga0495593_0075067 Ga0495593_0075067_78_1043 310
6 3300048089 Ga0495614_0105876 Ga0495614_0105876_242_1207 310
7 3300046660 Ga0495625_0163256 Ga0495625_0163256_202_1179 314
8 3300048917 Ga0496114_0165182 Ga0496114_0165182_94_1071 314
9 3300046538 Ga0495609_0019522 Ga0495609_0019522_1669_2691 329
10 3300048905 Ga0496102_0102965 Ga0496102_0102965_314_1426 332
11 3300055283 Ga0500661_000530 Ga0500661_000530_4003_5037 333
12 3300046459 Ga0495629_0009472 Ga0495629_0009472_368_1411 335
13 3300046472 Ga0495580_0051643 Ga0495580_0051643_281_1324 335
14 3300046473 Ga0495582_0026781 Ga0495582_0026781_52_1095 335
15 3300046499 Ga0495594_0000064 Ga0495594_0000064_15683_16726 335
16 3300046557 Ga0495622_0014677 Ga0495622_0014677_1399_2442 335
17 3300046689 Ga0495613_0000700 Ga0495613_0000700_24753_25796 335
18 3300047315 Ga0495581_0148372 Ga0495581_0148372_96_1139 335
19 3300046518 Ga0495631_0121345 Ga0495631_0121345_15_1073 339
20 3300005335 Ga0070666_10010009 Ga0070666_100100093 341
21 3300005355 Ga0070671_100002293 Ga0070671_10000229310 341
22 3300005841 Ga0068863_100005132 Ga0068863_1000051324 341
23 3300006237 Ga0097621_100145266 Ga0097621_1001452662 341
24 3300013296 Ga0157374_10000817 Ga0157374_1000081719 341
25 3300013306 Ga0163162_10100143 Ga0163162_101001433 341
26 3300014325 Ga0163163_10002693 Ga0163163_100026935 341
27 3300025903 Ga0207680_10020835 Ga0207680_100208352 341
28 3300025931 Ga0207644_10008769 Ga0207644_100087695 341
29 3300025986 Ga0207658_10081553 Ga0207658_100815531 341
30 3300026088 Ga0207641_10052319 Ga0207641_100523193 341
31 3300046463 Ga0495653_0086428 Ga0495653_0086428_576_1745 341
32 3300046684 Ga0495669_0032230 Ga0495669_0032230_64_1233 341
33 3300033179 Ga0307507_10100209 Ga0307507_101002092 343
34 3300025297 Ga0209758_1000400 Ga0209758_100040020 345
35 3300045836 Ga0466958_0006856 Ga0466958_0006856_868_2034 346
36 3300046678 Ga0495599_0195915 Ga0495599_0195915_40_1209 347
37 3300005434 Ga0070709_10006670 Ga0070709_100066706 348
38 3300005435 Ga0070714_100005639 Ga0070714_1000056394 348
39 3300005436 Ga0070713_100005618 Ga0070713_1000056184 348
40 3300005437 Ga0070710_10001592 Ga0070710_100015926 348
41 3300006028 Ga0070717_10002414 Ga0070717_100024144 348
42 3300006163 Ga0070715_10002800 Ga0070715_100028003 348
43 3300006871 Ga0075434_100284099 Ga0075434_1002840992 348
44 3300025898 Ga0207692_10002932 Ga0207692_100029324 348
45 3300025905 Ga0207685_10001604 Ga0207685_100016043 348
46 3300025906 Ga0207699_10002399 Ga0207699_100023996 348
47 3300025915 Ga0207693_10026790 Ga0207693_100267903 348
48 3300025916 Ga0207663_10001670 Ga0207663_100016704 348
49 3300025928 Ga0207700_10006118 Ga0207700_100061185 348
50 3300025929 Ga0207664_10023236 Ga0207664_100232362 348
51 3300025939 Ga0207665_10086977 Ga0207665_100869772 348
52 3300006042 Ga0075368_10012500 Ga0075368_100125002 350
53 3300006178 Ga0075367_10040805 Ga0075367_100408052 350
54 3300027866 Ga0209813_10042412 Ga0209813_100424122 350
55 3300050495 nmdc:mga04h51_56716_c1 nmdc:mga04h51_56716_c1_36_1202 350
56 3300049575 Ga0501039_0066483 Ga0501039_0066483_1606_2778 351
57 3300003320 rootH2_10140249 rootH2_101402492 355
58 3300005336 Ga0070680_100007691 Ga0070680_1000076915 359
59 3300005458 Ga0070681_10051649 Ga0070681_100516493 359
60 3300025912 Ga0207707_10030695 Ga0207707_100306952 359
61 3300025919 Ga0207657_10013968 Ga0207657_100139685 359
62 3300032002 Ga0307416_100198387 Ga0307416_1001983872 360
63 3300006846 Ga0075430_100004595 Ga0075430_1000045954 361
64 3300006847 Ga0075431_100198435 Ga0075431_1001984352 361
65 3300027462 Ga0210000_1001534 Ga0210000_10015344 361
66 3300050493 nmdc:mga0k408_30771_c1 nmdc:mga0k408_30771_c1_910_2076 361
67 3300050509 nmdc:mga0qj67_6610_c1 nmdc:mga0qj67_6610_c1_952_2127 361
68 3300050510 nmdc:mga06r32_200359_c1 nmdc:mga06r32_200359_c1_620_1795 361
69 3300046471 Ga0495650_0000041 Ga0495650_0000041_321680_322813 362
70 3300003320 rootH2_10036286 rootH2_100362862 364
71 3300005331 Ga0070670_100067059 Ga0070670_1000670592 364
72 3300005344 Ga0070661_100033885 Ga0070661_1000338852 364
73 3300005367 Ga0070667_100101861 Ga0070667_1001018611 364
74 3300005548 Ga0070665_100037829 Ga0070665_1000378293 364
75 3300006844 Ga0075428_100029694 Ga0075428_1000296945 364
76 3300006847 Ga0075431_100230906 Ga0075431_1002309061 364
77 3300009177 Ga0105248_10073325 Ga0105248_100733252 364
78 3300009177 Ga0105248_10288341 Ga0105248_102883412 364
79 3300013306 Ga0163162_10000119 Ga0163162_100001194 364
80 3300013308 Ga0157375_10078104 Ga0157375_100781043 364
81 3300014969 Ga0157376_10034320 Ga0157376_100343203 364
82 3300025941 Ga0207711_10101463 Ga0207711_101014632 364
83 3300028379 Ga0268266_10001510 Ga0268266_1000151020 364
84 3300033180 Ga0307510_10016468 Ga0307510_100164683 364
85 3300033180 Ga0307510_10042938 Ga0307510_100429385 364
86 3300046455 Ga0495603_0060178 Ga0495603_0060178_455_1591 364
87 3300046459 Ga0495629_0013480 Ga0495629_0013480_2666_3802 364
88 3300046473 Ga0495582_0001739 Ga0495582_0001739_8021_9157 364
89 3300046477 Ga0495664_0002957 Ga0495664_0002957_2608_3744 364
90 3300046499 Ga0495594_0000278 Ga0495594_0000278_15642_16778 364
91 3300046499 Ga0495594_0007198 Ga0495594_0007198_2505_3641 364
92 3300046500 Ga0495596_0039340 Ga0495596_0039340_400_1536 364
93 3300046506 Ga0495583_0010080 Ga0495583_0010080_3935_5068 364
94 3300046516 Ga0495628_0016740 Ga0495628_0016740_2540_3676 364
95 3300046523 Ga0495644_0000605 Ga0495644_0000605_8558_9694 364
96 3300046526 Ga0495666_0001156 Ga0495666_0001156_4076_5212 364
97 3300046529 Ga0495652_0013149 Ga0495652_0013149_5221_6357 364
98 3300046533 Ga0495640_0018052 Ga0495640_0018052_1095_2231 364
99 3300046559 Ga0495667_0007018 Ga0495667_0007018_4320_5456 364
100 3300046660 Ga0495625_0057655 Ga0495625_0057655_477_1610 364
101 3300046678 Ga0495599_0014138 Ga0495599_0014138_1752_2888 364
102 3300046680 Ga0495646_0002346 Ga0495646_0002346_2082_3218 364
103 3300046684 Ga0495669_0051540 Ga0495669_0051540_352_1488 364
104 3300046689 Ga0495613_0012199 Ga0495613_0012199_4818_5954 364
105 3300046690 Ga0495624_0002596 Ga0495624_0002596_2281_3417 364
106 3300046694 Ga0495649_0029406 Ga0495649_0029406_1722_2861 364
107 3300047319 Ga0495674_0014184 Ga0495674_0014184_2087_3220 364
108 3300047321 Ga0495676_0041762 Ga0495676_0041762_197_1333 364
109 3300047322 Ga0495680_0006693 Ga0495680_0006693_1563_2699 364
110 3300047444 Ga0495675_0002174 Ga0495675_0002174_6409_7545 364
111 3300047469 Ga0495673_0058188 Ga0495673_0058188_247_1383 364
112 3300047471 Ga0495684_0033211 Ga0495684_0033211_2392_3528 364
113 3300047472 Ga0495686_0121016 Ga0495686_0121016_113_1246 364
114 3300048089 Ga0495614_0000963 Ga0495614_0000963_7850_8986 364
115 3300048907 Ga0496104_0254307 Ga0496104_0254307_370_1503 364
116 3300048908 Ga0496105_0200666 Ga0496105_0200666_82_1215 364
117 3300048917 Ga0496114_0400639 Ga0496114_0400639_46_1179 364
118 3300048929 Ga0496126_0000734 Ga0496126_0000734_20937_22070 364
119 3300049460 Ga0495682_0023138 Ga0495682_0023138_461_1594 364
120 3300049580 Ga0501046_0095202 Ga0501046_0095202_894_2039 364
121 3300050508 nmdc:mga09592_63037_c1 nmdc:mga09592_63037_c1_824_1969 364
122 3300050509 nmdc:mga0qj67_134068_c1 nmdc:mga0qj67_134068_c1_12_1184 364
123 3300053093 Ga0500651_0000002 Ga0500651_0000002_162338_163471 364
124 3300053119 Ga0500595_000012 Ga0500595_000012_47141_48274 364
125 3300025899 Ga0207642_10046573 Ga0207642_100465731 365
126 3300025927 Ga0207687_10259783 Ga0207687_102597831 365
127 3300025942 Ga0207689_10003164 Ga0207689_100031648 365
128 3300026088 Ga0207641_10018313 Ga0207641_100183136 365
129 3300048917 Ga0496114_0346521 Ga0496114_0346521_163_1293 365
130 3300005458 Ga0070681_10000393 Ga0070681_1000039320 366
131 3300005530 Ga0070679_100061160 Ga0070679_1000611603 366
132 3300006871 Ga0075434_100000003 Ga0075434_10000000335 366
133 3300007076 Ga0075435_100010435 Ga0075435_1000104357 366
134 3300025912 Ga0207707_10001889 Ga0207707_1000188915 366
135 3300050512 nmdc:mga0n895_6765_c1 nmdc:mga0n895_6765_c1_6987_8138 366
136 3300050513 nmdc:mga0rr50_2920_c1 nmdc:mga0rr50_2920_c1_3865_5016 366
137 3300050514 nmdc:mga08x19_4603_c3 nmdc:mga08x19_4603_c3_1299_2450 366
138 3300050515 nmdc:mga0a205_75160_c1 nmdc:mga0a205_75160_c1_426_1577 366
139 3300006846 Ga0075430_100011470 Ga0075430_1000114708 367
140 3300006847 Ga0075431_100211303 Ga0075431_1002113032 367
141 3300014325 Ga0163163_10003896 Ga0163163_100038967 367
142 3300037068 Ga0373925_0035982 Ga0373925_0035982_1484_2668 367
143 3300047321 Ga0495676_0029608 Ga0495676_0029608_438_1622 367
144 3300048908 Ga0496105_0004690 Ga0496105_0004690_5671_6855 367
145 3300048912 Ga0496109_0012331 Ga0496109_0012331_5442_6626 367
146 3300048913 Ga0496110_0043984 Ga0496110_0043984_626_1810 367
147 3300048914 Ga0496111_0021665 Ga0496111_0021665_853_2037 367
148 3300048916 Ga0496113_0007339 Ga0496113_0007339_981_2165 367
149 3300048918 Ga0496115_0002089 Ga0496115_0002089_8703_9887 367
150 3300050509 nmdc:mga0qj67_63182_c1 nmdc:mga0qj67_63182_c1_132_1298 367
151 3300005336 Ga0070680_100178870 Ga0070680_1001788702 368
152 3300005444 Ga0070694_100067615 Ga0070694_1000676153 368
153 3300005459 Ga0068867_100146230 Ga0068867_1001462302 368
154 3300005544 Ga0070686_100165348 Ga0070686_1001653482 368
155 3300005549 Ga0070704_100098358 Ga0070704_1000983582 368
156 3300006844 Ga0075428_100002145 Ga0075428_10000214519 368
157 3300006846 Ga0075430_100000319 Ga0075430_1000003193 368
158 3300006846 Ga0075430_100006309 Ga0075430_1000063096 368
159 3300006847 Ga0075431_100009654 Ga0075431_1000096546 368
160 3300006880 Ga0075429_100008539 Ga0075429_1000085396 368
161 3300009147 Ga0114129_10003796 Ga0114129_1000379621 368
162 3300025917 Ga0207660_10204867 Ga0207660_102048672 368
163 3300025923 Ga0207681_10087729 Ga0207681_100877292 368
164 3300025936 Ga0207670_10115989 Ga0207670_101159892 368
165 3300026075 Ga0207708_10058060 Ga0207708_100580602 368
166 3300026118 Ga0207675_100019861 Ga0207675_1000198616 368
167 3300027364 Ga0209967_1000598 Ga0209967_10005982 368
168 3300031731 Ga0307405_10062571 Ga0307405_100625712 368
169 3300045051 Ga0451576_0105022 Ga0451576_0105022_83_1240 368
170 3300049572 Ga0501036_0129926 Ga0501036_0129926_514_1671 368
171 3300049574 Ga0501038_0203995 Ga0501038_0203995_50_1207 368
172 3300049582 Ga0501048_0026841 Ga0501048_0026841_2122_3279 368
173 3300049588 Ga0501072_0014159 Ga0501072_0014159_1136_2293 368
174 3300049591 Ga0501075_0003293 Ga0501075_0003293_6173_7330 368
175 3300049743 Ga0501081_0001649 Ga0501081_0001649_10660_11817 368
176 3300049822 Ga0501035_0306681 Ga0501035_0306681_149_1306 368
177 3300050507 nmdc:mga05p37_10912_c1 nmdc:mga05p37_10912_c1_8445_9584 368
178 3300050508 nmdc:mga09592_18776_c1 nmdc:mga09592_18776_c1_380_1519 368
179 3300050509 nmdc:mga0qj67_252_c1 nmdc:mga0qj67_252_c1_34054_35217 368
180 3300050510 nmdc:mga06r32_16956_c1 nmdc:mga06r32_16956_c1_1903_3042 368
181 3300054114 Ga0501084_0023633 Ga0501084_0023633_2792_3949 368
182 3300060353 Ga0501082_0096941 Ga0501082_0096941_458_1615 368
183 3300061734 Ga0530510_0042441 Ga0530510_0042441_1334_2491 368
184 3300005334 Ga0068869_100039791 Ga0068869_1000397912 369
185 3300005617 Ga0068859_100189874 Ga0068859_1001898742 369
186 3300005844 Ga0068862_100065762 Ga0068862_1000657622 369
187 3300006914 Ga0075436_100012392 Ga0075436_1000123922 369
188 3300006914 Ga0075436_100100594 Ga0075436_1001005942 369
189 3300006931 Ga0097620_100189868 Ga0097620_1001898682 369
190 3300009101 Ga0105247_10231192 Ga0105247_102311921 369
191 3300014745 Ga0157377_10052185 Ga0157377_100521852 369
192 3300025942 Ga0207689_10028873 Ga0207689_100288733 369
193 3300028380 Ga0268265_10023406 Ga0268265_100234065 369
194 3300035241 Ga0373961_0025522 Ga0373961_0025522_330_1490 369
195 3300046684 Ga0495669_0005308 Ga0495669_0005308_3619_4779 369
196 3300047318 Ga0495636_0086486 Ga0495636_0086486_59_1219 369
197 3300050511 nmdc:mga08y16_28787_c1 nmdc:mga08y16_28787_c1_215_1375 369
198 3300050514 nmdc:mga08x19_68006_c1 nmdc:mga08x19_68006_c1_453_1613 369
199 3300041486 Ga0451807_0028406 Ga0451807_0028406_2032_3195 370
200 iso_pu_bacteria 2643221545 2643748305 370
201 iso_pu_bacteria 2643221691 2644508158 370
202 3300025901 Ga0207688_10081166 Ga0207688_100811662 371
203 3300025945 Ga0207679_10237611 Ga0207679_102376112 371
204 3300042001 Ga0439441_000359 Ga0439441_000359_385_1551 371
205 3300042461 Ga0439460_0010474 Ga0439460_0010474_1184_2350 371
206 3300046539 Ga0495621_0015002 Ga0495621_0015002_822_1985 371
207 iso_pu_bacteria 2537561587 2537873473 371
208 iso_pu_bacteria 2554235003 2554245852 371
209 iso_pu_bacteria 2558860242 2559296382 371
210 iso_pu_bacteria 2600255279 2601611764 371
211 iso_pu_bacteria 2600255308 2601749505 371
212 iso_pu_bacteria 2643221547 2643754626 371
213 iso_pu_bacteria 2643221582 2643917661 371
214 iso_pu_bacteria 2643221693 2644522816 371
215 iso_pu_bacteria 2757320392 2757572245 371
216 iso_pu_bacteria 2808606387 2808988600 371
217 iso_pu_bacteria 2818991439 2819557822 371
218 iso_pu_bacteria 2838675328 2838679780 371
219 iso_pu_bacteria 2838714209 2838717450 371
220 iso_pu_bacteria 2838719591 2838724349 371
221 iso_pu_bacteria 2838724970 2838729334 371
222 iso_pu_bacteria 2840764183 2840768355 371
223 iso_pu_bacteria 2841846520 2841850761 371
224 iso_pu_bacteria 2841859092 2841864050 371
225 iso_pu_bacteria 2842124991 2842129566 371
226 iso_pu_bacteria 2842130223 2842134711 371
227 iso_pu_bacteria 2842152218 2842156771 371
228 iso_pu_bacteria 2842170452 2842173029 371
229 iso_pu_bacteria 2842175837 2842180389 371
230 iso_pu_bacteria 2842187318 2842191952 371
231 iso_pu_bacteria 2842211629 2842216268 371
232 iso_pu_bacteria 2842224351 2842228988 371
233 iso_pu_bacteria 2842515876 2842520832 371
234 iso_pu_bacteria 2899792073 2899793634 371
235 iso_pu_bacteria 2899845264 2899848727 371
236 iso_pu_bacteria 2919114240 2919119204 371
237 iso_pu_bacteria 2926754445 2926759235 371
238 iso_pu_bacteria 2926760298 2926763328 371
239 iso_pu_bacteria 2929138655 2929142961 371
240 iso_pu_bacteria 2933006813 2933011376 371
241 iso_pu_bacteria 2933011516 2933016555 371
242 iso_pu_bacteria 2933594066 2933596052 371
243 iso_pu_bacteria 2979089926 2979091639 371
244 iso_pu_bacteria 2979095461 2979097160 371
245 iso_pu_bacteria 2979100975 2979102863 371
246 iso_pu_bacteria 2984509177 2984509248 371
247 iso_pu_bacteria 2984518228 2984520053 371
248 iso_pu_bacteria 2984537506 2984537577 371
249 iso_pu_bacteria 2984601300 2984604325 371
250 iso_pu_bacteria 650716007 650842775 371
251 iso_pu_bacteria 8054460903 8054464679 371
252 3300005329 Ga0070683_100008490 Ga0070683_1000084909 372
253 3300006042 Ga0075368_10002169 Ga0075368_100021693 372
254 3300006178 Ga0075367_10000357 Ga0075367_100003579 372
255 3300006237 Ga0097621_100001440 Ga0097621_1000014405 372
256 3300006880 Ga0075429_100210108 Ga0075429_1002101082 372
257 3300014969 Ga0157376_10111777 Ga0157376_101117772 372
258 3300025909 Ga0207705_10146884 Ga0207705_101468842 372
259 3300025918 Ga0207662_10028204 Ga0207662_100282042 372
260 3300027360 Ga0209969_1000360 Ga0209969_10003602 372
261 3300027378 Ga0209981_1002027 Ga0209981_10020272 372
262 3300027462 Ga0210000_1000268 Ga0210000_10002683 372
263 3300027471 Ga0209995_1001640 Ga0209995_10016403 372
264 3300027543 Ga0209999_1002061 Ga0209999_10020613 372
265 3300027866 Ga0209813_10013727 Ga0209813_100137272 372
266 3300037312 Ga0395899_0001796 Ga0395899_0001796_7685_8851 372
267 3300037418 Ga0395900_0058638 Ga0395900_0058638_1024_2190 372
268 3300037471 Ga0395905_0026083 Ga0395905_0026083_3451_4617 372
269 3300038443 Ga0395901_0001705 Ga0395901_0001705_19084_20250 372
270 3300039437 Ga0436365_0961376 Ga0436365_0961376_1850_3019 372
271 3300048905 Ga0496102_0096896 Ga0496102_0096896_604_1788 372
272 3300050490 nmdc:mga03n38_60770_c1 nmdc:mga03n38_60770_c1_358_1518 372
273 3300050494 nmdc:mga06z11_7960_c1 nmdc:mga06z11_7960_c1_1178_2338 372
274 3300050495 nmdc:mga04h51_65123_c1 nmdc:mga04h51_65123_c1_14_1174 372
275 3300050507 nmdc:mga05p37_139979_c1 nmdc:mga05p37_139979_c1_111_1274 372
276 3300050507 nmdc:mga05p37_21875_c1 nmdc:mga05p37_21875_c1_1713_3005 372
277 3300050508 nmdc:mga09592_179399_c1 nmdc:mga09592_179399_c1_176_1339 372
278 iso_pu_bacteria 2599185210 2599605569 372
279 iso_pu_bacteria 2643221629 2644167345 372
280 iso_pu_bacteria 2643221662 2644349861 372
281 iso_pu_bacteria 2821443989 2821445651 372
282 iso_pu_bacteria 2919527303 2919534350 372
283 iso_pu_bacteria 2921643360 2921653993 372
284 iso_pu_bacteria 2945934425 2945936508 372
285 iso_pu_bacteria 2990703756 2990709582 372
286 iso_pu_bacteria 641736151 642425263 372
287 iso_pu_bacteria 8003570095 8003574810 372
288 3300006846 Ga0075430_100038383 Ga0075430_1000383834 373
289 3300006846 Ga0075430_100079581 Ga0075430_1000795813 373
290 3300013307 Ga0157372_10208248 Ga0157372_102082483 373
291 3300035117 Ga0373953_0041940 Ga0373953_0041940_153_1325 373
292 3300035118 Ga0373954_0000003 Ga0373954_0000003_38703_39875 373
293 3300035724 Ga0373933_0011065 Ga0373933_0011065_2898_4070 373
294 3300036401 Ga0373937_0000131 Ga0373937_0000131_57538_58710 373
295 3300044656 Ga0466969_0002021 Ga0466969_0002021_3396_4604 373
296 3300044683 Ga0466965_0008955 Ga0466965_0008955_2733_3941 373
297 3300044684 Ga0466966_0003694 Ga0466966_0003694_6222_7430 373
298 3300044693 Ga0466961_0001482 Ga0466961_0001482_6971_8179 373
299 3300044706 Ga0466964_0005963 Ga0466964_0005963_16_1224 373
300 3300044765 Ga0466970_0001757 Ga0466970_0001757_6284_7492 373
301 3300044842 Ga0466957_0006857 Ga0466957_0006857_4541_5749 373
302 3300045049 Ga0466959_0003967 Ga0466959_0003967_6396_7604 373
303 3300045051 Ga0451576_0336534 Ga0451576_0336534_40_1200 373
304 3300045836 Ga0466958_0001223 Ga0466958_0001223_4347_5555 373
305 3300046511 Ga0495608_0090008 Ga0495608_0090008_338_1510 373
306 3300048924 Ga0496121_0070553 Ga0496121_0070553_890_2098 373
307 3300050509 nmdc:mga0qj67_20_c1 nmdc:mga0qj67_20_c1_30812_31984 373
308 3300050510 nmdc:mga06r32_95314_c1 nmdc:mga06r32_95314_c1_1121_2413 373
309 3300060353 Ga0501082_0088701 Ga0501082_0088701_780_1934 373
310 iso_pu_bacteria 2643221580 2643910918 373
311 iso_pu_bacteria 2643221591 2643965888 373
312 iso_pu_bacteria 2643221674 2644412166 373
313 3300003187 JGI25151J46595_10004033 JGI25151J46595_100040337 374
314 3300003856 Ga0058692_1001660 Ga0058692_100166012 374
315 3300005262 Ga0065165_1001079 Ga0065165_100107929 374
316 3300005345 Ga0070692_10130020 Ga0070692_101300201 374
317 3300005356 Ga0070674_100019337 Ga0070674_1000193375 374
318 3300005365 Ga0070688_100027663 Ga0070688_1000276631 374
319 3300005367 Ga0070667_100272863 Ga0070667_1002728632 374
320 3300005444 Ga0070694_100170719 Ga0070694_1001707192 374
321 3300005456 Ga0070678_100047778 Ga0070678_1000477782 374
322 3300005548 Ga0070665_100002585 Ga0070665_10000258519 374
323 3300005617 Ga0068859_100206879 Ga0068859_1002068792 374
324 3300005618 Ga0068864_100052619 Ga0068864_1000526193 374
325 3300005618 Ga0068864_100150912 Ga0068864_1001509123 374
326 3300006051 Ga0075364_10024786 Ga0075364_100247862 374
327 3300006051 Ga0075364_10054580 Ga0075364_100545801 374
328 3300006177 Ga0075362_10006668 Ga0075362_100066682 374
329 3300006195 Ga0075366_10116562 Ga0075366_101165622 374
330 3300006844 Ga0075428_100000280 Ga0075428_10000028046 374
331 3300006880 Ga0075429_100003718 Ga0075429_1000037189 374
332 3300006931 Ga0097620_100206906 Ga0097620_1002069062 374
333 3300006948 Ga0099826_10000040 Ga0099826_1000004058 374
334 3300006948 Ga0099826_10013124 Ga0099826_100131243 374
335 3300007265 Ga0099794_10050607 Ga0099794_100506072 374
336 3300009094 Ga0111539_10000415 Ga0111539_1000041513 374
337 3300009148 Ga0105243_10004732 Ga0105243_100047325 374
338 3300009177 Ga0105248_10042700 Ga0105248_100427003 374
339 3300009177 Ga0105248_10282049 Ga0105248_102820492 374
340 3300013100 Ga0157373_10003308 Ga0157373_100033085 374
341 3300013102 Ga0157371_10000042 Ga0157371_10000042125 374
342 3300013104 Ga0157370_10000035 Ga0157370_1000003575 374
343 3300013306 Ga0163162_10128562 Ga0163162_101285622 374
344 3300014326 Ga0157380_10081415 Ga0157380_100814152 374
345 3300014497 Ga0182008_10050620 Ga0182008_100506202 374
346 3300025294 Ga0209025_1000374 Ga0209025_100037459 374
347 3300025303 Ga0209051_1001712 Ga0209051_100171211 374
348 3300025918 Ga0207662_10212048 Ga0207662_102120481 374
349 3300025926 Ga0207659_10081178 Ga0207659_100811782 374
350 3300025926 Ga0207659_10133111 Ga0207659_101331111 374
351 3300025931 Ga0207644_10041643 Ga0207644_100416433 374
352 3300025940 Ga0207691_10378131 Ga0207691_103781311 374
353 3300025941 Ga0207711_10020195 Ga0207711_100201954 374
354 3300025986 Ga0207658_10070887 Ga0207658_100708872 374
355 3300026088 Ga0207641_10128760 Ga0207641_101287601 374
356 3300026089 Ga0207648_10200478 Ga0207648_102004782 374
357 3300026121 Ga0207683_10037248 Ga0207683_100372484 374
358 3300026121 Ga0207683_10075957 Ga0207683_100759572 374
359 3300027312 Ga0209371_1000003 Ga0209371_1000003150 374
360 3300027312 Ga0209371_1000998 Ga0209371_10009983 374
361 3300027312 Ga0209371_1010382 Ga0209371_10103822 374
362 3300027666 Ga0209282_1000167 Ga0209282_100016737 374
363 3300027666 Ga0209282_1050107 Ga0209282_10501072 374
364 3300027907 Ga0207428_10004843 Ga0207428_100048434 374
365 3300028379 Ga0268266_10002425 Ga0268266_100024259 374
366 3300028379 Ga0268266_10124537 Ga0268266_101245372 374
367 3300028381 Ga0268264_10142385 Ga0268264_101423852 374
368 3300030500 Ga0268256_1000004 Ga0268256_1000004901 374
369 3300030500 Ga0268256_1002297 Ga0268256_100229710 374
370 3300030500 Ga0268256_1011138 Ga0268256_10111383 374
371 3300030500 Ga0268256_1012972 Ga0268256_10129722 374
372 3300031241 Ga0265325_10000291 Ga0265325_1000029137 374
373 3300031247 Ga0265340_10047749 Ga0265340_100477492 374
374 3300031344 Ga0265316_10126203 Ga0265316_101262032 374
375 3300035241 Ga0373961_0012161 Ga0373961_0012161_395_1555 374
376 3300035691 Ga0373931_0002472 Ga0373931_0002472_4137_5297 374
377 3300035691 Ga0373931_0019088 Ga0373931_0019088_1094_2254 374
378 3300038443 Ga0395901_0338626 Ga0395901_0338626_113_1273 374
379 3300039437 Ga0436365_0841579 Ga0436365_0841579_482_1642 374
380 3300039437 Ga0436365_1860307 Ga0436365_1860307_60_1220 374
381 3300046454 Ga0495592_0140163 Ga0495592_0140163_21_1181 374
382 3300046674 Ga0495588_0004233 Ga0495588_0004233_220_1386 374
383 3300047470 Ga0495681_0012386 Ga0495681_0012386_828_1994 374
384 3300048904 Ga0496101_0274616 Ga0496101_0274616_39_1199 374
385 3300048907 Ga0496104_0000406 Ga0496104_0000406_36493_37653 374
386 3300048907 Ga0496104_0015099 Ga0496104_0015099_2029_3189 374
387 3300048907 Ga0496104_0325136 Ga0496104_0325136_114_1274 374
388 3300048909 Ga0496106_0034458 Ga0496106_0034458_1228_2388 374
389 3300048914 Ga0496111_0029356 Ga0496111_0029356_1299_2459 374
390 3300048915 Ga0496112_0060128 Ga0496112_0060128_1441_2601 374
391 3300048915 Ga0496112_0140335 Ga0496112_0140335_102_1262 374
392 3300048916 Ga0496113_0025506 Ga0496113_0025506_2094_3254 374
393 3300048916 Ga0496113_0054287 Ga0496113_0054287_508_1668 374
394 3300048916 Ga0496113_0118789 Ga0496113_0118789_217_1380 374
395 3300048917 Ga0496114_0074200 Ga0496114_0074200_1630_2790 374
396 3300048918 Ga0496115_0036572 Ga0496115_0036572_2049_3209 374
397 3300048919 Ga0496116_0137214 Ga0496116_0137214_91_1254 374
398 3300048920 Ga0496117_0000036 Ga0496117_0000036_242262_243425 374
399 3300048920 Ga0496117_0017949 Ga0496117_0017949_1218_2381 374
400 3300048920 Ga0496117_0130898 Ga0496117_0130898_152_1315 374
401 3300048921 Ga0496118_0155092 Ga0496118_0155092_158_1321 374
402 3300048922 Ga0496119_0012723 Ga0496119_0012723_2618_3781 374
403 3300048923 Ga0496120_0000036 Ga0496120_0000036_148001_149164 374
404 3300048924 Ga0496121_0000005 Ga0496121_0000005_915035_916198 374
405 3300048924 Ga0496121_0073066 Ga0496121_0073066_64_1227 374
406 3300048925 Ga0496122_0000002 Ga0496122_0000002_637941_639104 374
407 3300048925 Ga0496122_0016734 Ga0496122_0016734_735_1898 374
408 3300048925 Ga0496122_0051655 Ga0496122_0051655_1790_2953 374
409 3300048926 Ga0496123_0000002 Ga0496123_0000002_1172579_1173742 374
410 3300048926 Ga0496123_0000002 Ga0496123_0000002_637941_639104 374
411 3300048927 Ga0496124_0000080 Ga0496124_0000080_111586_112749 374
412 3300048927 Ga0496124_0005551 Ga0496124_0005551_9313_10476 374
413 3300048927 Ga0496124_0070316 Ga0496124_0070316_366_1529 374
414 3300048927 Ga0496124_0097604 Ga0496124_0097604_27_1190 374
415 3300048928 Ga0496125_0000159 Ga0496125_0000159_39132_40295 374
416 3300049572 Ga0501036_0045274 Ga0501036_0045274_50_1225 374
417 3300049573 Ga0501037_0021597 Ga0501037_0021597_2999_4174 374
418 3300049575 Ga0501039_0001422 Ga0501039_0001422_11722_12897 374
419 3300049575 Ga0501039_0233210 Ga0501039_0233210_244_1419 374
420 3300049577 Ga0501041_0002140 Ga0501041_0002140_4037_5212 374
421 3300049578 Ga0501042_0036746 Ga0501042_0036746_761_1936 374
422 3300049579 Ga0501043_0011893 Ga0501043_0011893_4922_6097 374
423 3300049580 Ga0501046_0023901 Ga0501046_0023901_3171_4346 374
424 3300049591 Ga0501075_0053071 Ga0501075_0053071_20_1195 374
425 3300049592 Ga0501076_0003274 Ga0501076_0003274_5873_7048 374
426 3300049742 Ga0501080_0005820 Ga0501080_0005820_3123_4298 374
427 3300049743 Ga0501081_0000516 Ga0501081_0000516_12755_13930 374
428 3300050490 nmdc:mga03n38_43705_c1 nmdc:mga03n38_43705_c1_99_1262 374
429 3300050491 nmdc:mga00v17_19_c1 nmdc:mga00v17_19_c1_87841_89004 374
430 3300050491 nmdc:mga00v17_37632_c1 nmdc:mga00v17_37632_c1_662_1825 374
431 3300050492 nmdc:mga0yw44_110897_c1 nmdc:mga0yw44_110897_c1_294_1457 374
432 3300050494 nmdc:mga06z11_14215_c1 nmdc:mga06z11_14215_c1_2192_3352 374
433 3300050494 nmdc:mga06z11_91576_c1 nmdc:mga06z11_91576_c1_357_1520 374
434 3300050496 nmdc:mga07m45_92448_c1 nmdc:mga07m45_92448_c1_252_1481 374
435 3300050508 nmdc:mga09592_1594_c1 nmdc:mga09592_1594_c1_9055_10230 374
436 3300050511 nmdc:mga08y16_3283_c1 nmdc:mga08y16_3283_c1_8113_9288 374
437 3300050516 nmdc:mga0sz30_1633_c1 nmdc:mga0sz30_1633_c1_431_1594 374
438 3300050516 nmdc:mga0sz30_42148_c1 nmdc:mga0sz30_42148_c1_570_1736 374
439 3300050516 nmdc:mga0sz30_70001_c1 nmdc:mga0sz30_70001_c1_281_1444 374
440 3300053077 Ga0495601_0037111 Ga0495601_0037111_1221_2381 374
441 3300053078 Ga0495612_0019557 Ga0495612_0019557_1492_2652 374
442 3300053085 Ga0495619_0136818 Ga0495619_0136818_198_1358 374
443 3300053107 Ga0500560_000204 Ga0500560_000204_974_2137 374
444 3300053125 Ga0500618_001007 Ga0500618_001007_4984_6147 374
445 3300053137 Ga0500561_0000036 Ga0500561_0000036_13688_14851 374
446 3300053157 Ga0500624_000553 Ga0500624_000553_886_2049 374
447 3300053161 Ga0500634_0000373 Ga0500634_0000373_5009_6172 374
448 3300053161 Ga0500634_0003279 Ga0500634_0003279_4100_5281 374
449 3300053177 Ga0500636_0000011 Ga0500636_0000011_134144_135307 374
450 3300053177 Ga0500636_0000283 Ga0500636_0000283_26623_27786 374
451 3300054114 Ga0501084_0046438 Ga0501084_0046438_1228_2403 374
452 3300060353 Ga0501082_0085318 Ga0501082_0085318_1203_2378 374
453 3300002070 JGI24750J21931_1001065 JGI24750J21931_10010652 375
454 3300003659 JGI25404J52841_10019199 JGI25404J52841_100191991 375
455 3300005331 Ga0070670_100059446 Ga0070670_1000594462 375
456 3300005340 Ga0070689_100059283 Ga0070689_1000592832 375
457 3300005355 Ga0070671_100062872 Ga0070671_1000628722 375
458 3300005983 Ga0081540_1000259 Ga0081540_100025914 375
459 3300005983 Ga0081540_1007648 Ga0081540_10076485 375
460 3300006038 Ga0075365_10186601 Ga0075365_101866012 375
461 3300006051 Ga0075364_10112777 Ga0075364_101127772 375
462 3300025291 Ga0209675_1000882 Ga0209675_10008825 375
463 3300025918 Ga0207662_10012814 Ga0207662_100128141 375
464 3300025925 Ga0207650_10022119 Ga0207650_100221193 375
465 3300025932 Ga0207690_10045508 Ga0207690_100455083 375
466 3300025936 Ga0207670_10074915 Ga0207670_100749152 375
467 3300046514 Ga0495618_0080264 Ga0495618_0080264_11_1174 375
468 3300048905 Ga0496102_0074532 Ga0496102_0074532_1304_2467 375
469 3300048905 Ga0496102_0205089 Ga0496102_0205089_170_1333 375
470 3300048906 Ga0496103_0100724 Ga0496103_0100724_150_1313 375
471 3300048907 Ga0496104_0003010 Ga0496104_0003010_5199_6362 375
472 3300048907 Ga0496104_0009357 Ga0496104_0009357_4040_5203 375
473 3300048907 Ga0496104_0017063 Ga0496104_0017063_731_1894 375
474 3300048908 Ga0496105_0001047 Ga0496105_0001047_2064_3227 375
475 3300048908 Ga0496105_0008980 Ga0496105_0008980_413_1576 375
476 3300048908 Ga0496105_0098643 Ga0496105_0098643_1088_2251 375
477 3300048910 Ga0496107_0042533 Ga0496107_0042533_1427_2590 375
478 3300048911 Ga0496108_0002003 Ga0496108_0002003_14595_15758 375
479 3300048911 Ga0496108_0028128 Ga0496108_0028128_161_1324 375
480 3300048912 Ga0496109_0001337 Ga0496109_0001337_11062_12225 375
481 3300048912 Ga0496109_0034899 Ga0496109_0034899_2657_3820 375
482 3300048912 Ga0496109_0134775 Ga0496109_0134775_1005_2168 375
483 3300048913 Ga0496110_0004175 Ga0496110_0004175_8722_9885 375
484 3300048914 Ga0496111_0007887 Ga0496111_0007887_111_1274 375
485 3300048914 Ga0496111_0136853 Ga0496111_0136853_243_1406 375
486 3300048915 Ga0496112_0001344 Ga0496112_0001344_4889_6052 375
487 3300048915 Ga0496112_0012523 Ga0496112_0012523_36_1199 375
488 3300048915 Ga0496112_0074063 Ga0496112_0074063_1058_2221 375
489 3300048916 Ga0496113_0003718 Ga0496113_0003718_2639_3802 375
490 3300048916 Ga0496113_0078649 Ga0496113_0078649_1295_2458 375
491 3300048918 Ga0496115_0010283 Ga0496115_0010283_4930_6093 375
492 3300048929 Ga0496126_0176268 Ga0496126_0176268_518_1687 375
493 3300049576 Ga0501040_0049808 Ga0501040_0049808_183_1346 375
494 3300049588 Ga0501072_0091602 Ga0501072_0091602_543_1706 375
495 3300049590 Ga0501074_0126979 Ga0501074_0126979_285_1508 375
496 3300049741 Ga0501079_0085933 Ga0501079_0085933_762_1925 375
497 3300050489 nmdc:mga03683_21713_c1 nmdc:mga03683_21713_c1_261_1433 375
498 3300050492 nmdc:mga0yw44_63705_c1 nmdc:mga0yw44_63705_c1_80_1243 375
499 3300050495 nmdc:mga04h51_39259_c1 nmdc:mga04h51_39259_c1_358_1521 375
500 3300050507 nmdc:mga05p37_21649_c1 nmdc:mga05p37_21649_c1_1190_2353 375
501 3300050511 nmdc:mga08y16_165920_c1 nmdc:mga08y16_165920_c1_600_1763 375
502 3300053085 Ga0495619_0085500 Ga0495619_0085500_321_1484 375
503 3300053119 Ga0500595_020004 Ga0500595_020004_804_1967 375
504 3300053151 Ga0500604_0000777 Ga0500604_0000777_2684_3853 375
505 3300053153 Ga0500616_0057974 Ga0500616_0057974_521_1684 375
506 3300061734 Ga0530510_0176938 Ga0530510_0176938_137_1300 375
507 3300001989 JGI24739J22299_10002028 JGI24739J22299_100020286 376
508 3300002067 JGI24735J21928_10005357 JGI24735J21928_100053572 376
509 3300002075 JGI24738J21930_10003831 JGI24738J21930_100038315 376
510 3300003354 JGI25160J50197_1000152 JGI25160J50197_100015253 376
511 3300005262 Ga0065165_1001764 Ga0065165_100176416 376
512 3300013105 Ga0157369_10034340 Ga0157369_100343404 376
513 3300025206 Ga0209435_100806 Ga0209435_1008062 376
514 3300025256 Ga0209759_1000097 Ga0209759_100009712 376
515 3300025284 Ga0209130_1005205 Ga0209130_10052055 376
516 3300025295 Ga0209564_1006003 Ga0209564_10060036 376
517 3300025302 Ga0207426_1000103 Ga0207426_1000103218 376
518 3300025302 Ga0207426_1002112 Ga0207426_10021126 376
519 3300031911 Ga0307412_10000003 Ga0307412_10000003357 376
520 3300044684 Ga0466966_0002405 Ga0466966_0002405_6756_7925 376
521 3300044693 Ga0466961_0001327 Ga0466961_0001327_13180_14343 376
522 3300044693 Ga0466961_0003884 Ga0466961_0003884_1362_2531 376
523 3300044765 Ga0466970_0048420 Ga0466970_0048420_1075_2244 376
524 3300045049 Ga0466959_0001528 Ga0466959_0001528_7390_8559 376
525 3300046455 Ga0495603_0000913 Ga0495603_0000913_12879_14084 376
526 3300046459 Ga0495629_0000084 Ga0495629_0000084_12964_14169 376
527 3300046471 Ga0495650_0000543 Ga0495650_0000543_12165_13370 376
528 3300046471 Ga0495650_0040317 Ga0495650_0040317_531_1694 376
529 3300046472 Ga0495580_0012872 Ga0495580_0012872_1053_2258 376
530 3300046472 Ga0495580_0044850 Ga0495580_0044850_1649_2857 376
531 3300046475 Ga0495639_0010035 Ga0495639_0010035_1612_2817 376
532 3300046500 Ga0495596_0007132 Ga0495596_0007132_3441_4604 376
533 3300046506 Ga0495583_0014486 Ga0495583_0014486_796_2001 376
534 3300046507 Ga0495606_0059600 Ga0495606_0059600_839_2002 376
535 3300046512 Ga0495610_0000404 Ga0495610_0000404_38319_39482 376
536 3300046524 Ga0495648_0006282 Ga0495648_0006282_1900_3108 376
537 3300046528 Ga0495642_0005457 Ga0495642_0005457_506_1711 376
538 3300046531 Ga0495665_0019374 Ga0495665_0019374_1741_2946 376
539 3300046543 Ga0495645_0000231 Ga0495645_0000231_26356_27561 376
540 3300046543 Ga0495645_0001708 Ga0495645_0001708_12324_13487 376
541 3300046684 Ga0495669_0010490 Ga0495669_0010490_1637_2842 376
542 3300046692 Ga0495671_0022251 Ga0495671_0022251_653_1858 376
543 3300046794 Ga0495589_0002263 Ga0495589_0002263_6882_8087 376
544 3300047315 Ga0495581_0013142 Ga0495581_0013142_2392_3597 376
545 3300047320 Ga0495672_0037443 Ga0495672_0037443_1741_2949 376
546 3300047323 Ga0495683_0010589 Ga0495683_0010589_937_2100 376
547 3300047323 Ga0495683_0043143 Ga0495683_0043143_187_1392 376
548 3300047443 Ga0495687_007101 Ga0495687_007101_2001_3164 376
549 3300047443 Ga0495687_041294 Ga0495687_041294_651_1859 376
550 3300047469 Ga0495673_0011500 Ga0495673_0011500_406_1614 376
551 3300047673 Ga0495593_0021592 Ga0495593_0021592_1680_2885 376
552 3300047673 Ga0495593_0028164 Ga0495593_0028164_925_2133 376
553 3300048903 Ga0496100_0017708 Ga0496100_0017708_2329_3534 376
554 3300048905 Ga0496102_0200903 Ga0496102_0200903_104_1312 376
555 3300048908 Ga0496105_0027766 Ga0496105_0027766_1192_2397 376
556 3300048913 Ga0496110_0107547 Ga0496110_0107547_600_1769 376
557 3300048915 Ga0496112_0284856 Ga0496112_0284856_265_1473 376
558 3300048917 Ga0496114_0004297 Ga0496114_0004297_4536_5741 376
559 3300048918 Ga0496115_0066246 Ga0496115_0066246_718_1923 376
560 3300048920 Ga0496117_0002472 Ga0496117_0002472_18870_20033 376
561 3300048921 Ga0496118_0000990 Ga0496118_0000990_36373_37536 376
562 3300048924 Ga0496121_0105273 Ga0496121_0105273_169_1377 376
563 3300049460 Ga0495682_0003424 Ga0495682_0003424_2793_4001 376
564 3300049460 Ga0495682_0004180 Ga0495682_0004180_3367_4536 376
565 iso_pu_bacteria 2515154123 2515687161 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06187

DUF993

Protein of unknown function (DUF993)

48

416

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9597 1 373
4dnh-assembly1.cif.gz_A crystal structure of hypothetical protein smc04132 from sinorhizobium meliloti 1021 0.9497 1 373
7lvl-assembly1.cif.gz_A dihydrodipicolinate synthase bound with allosteric inhibitor (s)-lysine from candidatus liberibacter solanacearum 0.8126 34 357
3nev-assembly1.cif.gz_C crystal structure of yage, a prophage protein from e. coli k12 in complex with kdgal 0.8117 34 354
7kpc-assembly1.cif.gz_D dihydrodipicolinate synthase (dhdps) from c.jejuni, e88q mutant with pyruvate bound in the active site and l-lysine bound at the allosteric site 0.8114 34 351
ID Description Score Start End Superfamily
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9293 1 368 3.20.20.70
4dnhA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9171 1 368 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7965 34 354 3.20.20.70
3di0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7865 31 329 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7818 34 354 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A526URZ2-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9952 293 355
AF-A0A436JX64-F1-model_v4 deleted 0.9944 266 373
AF-A0A2V6UMI6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9942 274 373
AF-A0A2N4XXX9-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9877 283 373
AF-A0A2W5QC32-F1-model_v4 Dihydrodipicolinate synthase family protein 0.981 300 373

Feature Viewer

pLDDT pTM Quality
91.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map