F464277

General Info

Members Datasets Scaffolds Average Seq Length
565 280 1130 178

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_11113340|Ga0268264_111133401
Length 215
Sequence MKISIVRVECPIVQIREIIPFDRNSIRDRFVKRSGEAKMNKIFLSAIVGLITLAFVQAAETPKQPAAGAPAPDFSLTTSDGSQVSLKDYRGKWVVLYFYPKDFTSGCTMEARNFQRDLAKYQEAGAVVLGVSVDTAQSHKDFCAKEGLNFKLLADPDATVSTEYGSVMDYKGEKLAARNTFIINTEGQIAKVYTSVKPAEHSEQVLKDLAELKKS

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
194 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
195 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
241 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
245 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
246 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
247 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
248 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
251 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
252 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
253 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
256 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
257 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
258 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
259 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
260 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
261 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
265 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
266 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
267 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
268 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
269 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
272 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.07
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 28.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_11113340 3300028381 Bacteria 798
2 SwRhRL2b_contig_2073574 2162886007 Bacteria 3223
3 JGI24746J21847_1017739 3300001977 Bacteria 1010
4 Ga0065704_10003796 3300005289 Bacteria 3792
5 Ga0065712_10120636 3300005290 Bacteria 1676
6 Ga0065712_10144200 3300005290 Unclassified 1423
7 Ga0065712_10156489 3300005290 Bacteria 1331
8 Ga0065712_10455574 3300005290 Unclassified 678
9 Ga0065715_10026192 3300005293 Bacteria 2012
10 Ga0065715_10105598 3300005293 Bacteria 2882
11 Ga0065715_10108677 3300005293 Bacteria 2706
12 Ga0065715_10148709 3300005293 Bacteria 1755
13 Ga0070658_10303768 3300005327 Unclassified 1361
14 Ga0070676_10061867 3300005328 Bacteria 2226
15 Ga0070683_100229462 3300005329 Bacteria 1765
16 Ga0070683_100442216 3300005329 Unclassified 1241
17 Ga0070690_100062527 3300005330 Bacteria 2400
18 Ga0068869_100057361 3300005334 Bacteria 2843
19 Ga0068869_100310965 3300005334 Bacteria 1275
20 Ga0068869_100421383 3300005334 Bacteria 1101
21 Ga0070666_10257423 3300005335 Bacteria 1237
22 Ga0070680_100413000 3300005336 Bacteria 1151
23 Ga0070680_101010007 3300005336 Unclassified 718
24 Ga0070682_100438471 3300005337 Bacteria 997
25 Ga0068868_100107499 3300005338 Bacteria 2264
26 Ga0068868_100184988 3300005338 Bacteria 1730
27 Ga0068868_100264569 3300005338 Unclassified 1451
28 Ga0070660_100008373 3300005339 Bacteria 7229
29 Ga0070660_100467557 3300005339 Bacteria 1047
30 Ga0070689_100000147 3300005340 Bacteria 40915
31 Ga0070689_100146604 3300005340 Bacteria 1901
32 Ga0070687_100398144 3300005343 Bacteria 902
33 Ga0070687_100566253 3300005343 Unclassified 775
34 Ga0070661_100274719 3300005344 Bacteria 1306
35 Ga0070692_10050760 3300005345 Bacteria 2155
36 Ga0070692_10284600 3300005345 Unclassified 1003
37 Ga0070692_10513441 3300005345 Bacteria 779
38 Ga0070668_100031493 3300005347 Unclassified 4035
39 Ga0070669_100005415 3300005353 Bacteria 9203
40 Ga0070669_100037801 3300005353 Bacteria 3502
41 Ga0070669_100041229 3300005353 Bacteria 3357
42 Ga0070669_100383605 3300005353 Bacteria 1146
43 Ga0070669_101169773 3300005353 Unclassified 664
44 Ga0070675_100007199 3300005354 Bacteria 8575
45 Ga0070675_100030662 3300005354 Unclassified 4342
46 Ga0070671_100519161 3300005355 Bacteria 1025
47 Ga0070671_100902610 3300005355 Bacteria 772
48 Ga0070674_100006712 3300005356 Bacteria 6735
49 Ga0070674_100875999 3300005356 Unclassified 780
50 Ga0070673_100084819 3300005364 Bacteria 2577
51 Ga0070688_100002102 3300005365 Bacteria 10052
52 Ga0070659_100001121 3300005366 Bacteria 19545
53 Ga0070659_100002230 3300005366 Bacteria 13771
54 Ga0070659_100538336 3300005366 Bacteria 999
55 Ga0070667_100161570 3300005367 Unclassified 1973
56 Ga0070667_100855429 3300005367 Unclassified 845
57 Ga0070667_101069891 3300005367 Bacteria 754
58 Ga0070703_10000289 3300005406 Bacteria 23238
59 Ga0070709_10366865 3300005434 Unclassified 1067
60 Ga0070714_100099318 3300005435 Bacteria 2562
61 Ga0070714_100108440 3300005435 Unclassified 2455
62 Ga0070714_100211144 3300005435 Bacteria 1779
63 Ga0070714_100216430 3300005435 Unclassified 1758
64 Ga0070713_100019759 3300005436 Bacteria 5153
65 Ga0070713_100127255 3300005436 Bacteria 2242
66 Ga0070713_100374249 3300005436 Bacteria 1326
67 Ga0070713_100622158 3300005436 Bacteria 1027
68 Ga0070713_100878965 3300005436 Unclassified 861
69 Ga0070710_10012482 3300005437 Bacteria 4220
70 Ga0070710_10025637 3300005437 Bacteria 3124
71 Ga0070710_10500882 3300005437 Unclassified 831
72 Ga0070711_100015241 3300005439 Unclassified 4864
73 Ga0070711_100280314 3300005439 Bacteria 1318
74 Ga0070711_100346437 3300005439 Unclassified 1193
75 Ga0070711_100985023 3300005439 Unclassified 723
76 Ga0070711_101127510 3300005439 Bacteria 676
77 Ga0070705_100003998 3300005440 Bacteria 7201
78 Ga0070705_100147917 3300005440 Bacteria 1555
79 Ga0070700_100000065 3300005441 Bacteria 76224
80 Ga0070700_100098777 3300005441 Bacteria 1919
81 Ga0070694_100061716 3300005444 Bacteria 2559
82 Ga0070694_100138957 3300005444 Bacteria 1762
83 Ga0070694_100205612 3300005444 Unclassified 1470
84 Ga0070694_100249756 3300005444 Bacteria 1341
85 Ga0070694_100411527 3300005444 Bacteria 1061
86 Ga0070694_100536580 3300005444 Unclassified 935
87 Ga0070708_100005805 3300005445 Bacteria 9800
88 Ga0070708_100028757 3300005445 Bacteria 4785
89 Ga0070708_100074043 3300005445 Unclassified 3071
90 Ga0070708_100123463 3300005445 Unclassified 2391
91 Ga0070708_101302038 3300005445 Unclassified 679
92 Ga0070678_100342116 3300005456 Bacteria 1284
93 Ga0070662_100034218 3300005457 Bacteria 3582
94 Ga0070681_10001309 3300005458 Bacteria 21729
95 Ga0068867_100725817 3300005459 Bacteria 879
96 Ga0070685_10028870 3300005466 Unclassified 3078
97 Ga0070685_10476689 3300005466 Unclassified 879
98 Ga0070706_100000020 3300005467 Bacteria 165628
99 Ga0070706_100016203 3300005467 Bacteria 6884
100 Ga0070706_100027638 3300005467 Bacteria 5219
101 Ga0070706_100071533 3300005467 Bacteria 3208
102 Ga0070706_100144711 3300005467 Unclassified 2220
103 Ga0070706_100239311 3300005467 Bacteria 1695
104 Ga0070706_100265877 3300005467 Bacteria 1601
105 Ga0070706_100339043 3300005467 Bacteria 1401
106 Ga0070706_100432446 3300005467 Bacteria 1225
107 Ga0070706_100562049 3300005467 Bacteria 1061
108 Ga0070707_100009081 3300005468 Bacteria 9217
109 Ga0070707_100020702 3300005468 Bacteria 6207
110 Ga0070707_100073591 3300005468 Unclassified 3294
111 Ga0070707_100256186 3300005468 Bacteria 1703
112 Ga0070707_100315464 3300005468 Bacteria 1519
113 Ga0070707_100353155 3300005468 Bacteria 1428
114 Ga0070707_100381304 3300005468 Bacteria 1369
115 Ga0070698_100000826 3300005471 Bacteria 33892
116 Ga0070698_100003840 3300005471 Bacteria 16518
117 Ga0070699_100000083 3300005518 Bacteria 89561
118 Ga0070699_100003249 3300005518 Bacteria 14373
119 Ga0070679_100046977 3300005530 Unclassified 4304
120 Ga0070684_100173255 3300005535 Bacteria 1960
121 Ga0070697_100000699 3300005536 Bacteria 25148
122 Ga0070697_100002030 3300005536 Bacteria 15491
123 Ga0070697_100016984 3300005536 Bacteria 5721
124 Ga0070697_100134386 3300005536 Unclassified 2076
125 Ga0070697_100155061 3300005536 Bacteria 1932
126 Ga0070697_100171102 3300005536 Bacteria 1839
127 Ga0070697_100190170 3300005536 Bacteria 1742
128 Ga0070697_100277148 3300005536 Unclassified 1438
129 Ga0070697_100415442 3300005536 Unclassified 1169
130 Ga0070697_100712025 3300005536 Bacteria 886
131 Ga0068853_100007439 3300005539 Bacteria 8763
132 Ga0070672_100040253 3300005543 Unclassified 3584
133 Ga0070695_100374575 3300005545 Bacteria 1073
134 Ga0070696_100000120 3300005546 Bacteria 41117
135 Ga0070696_100011234 3300005546 Bacteria 5995
136 Ga0070696_100312875 3300005546 Bacteria 1206
137 Ga0070696_100379645 3300005546 Bacteria 1101
138 Ga0070665_100167490 3300005548 Unclassified 2199
139 Ga0070665_101292934 3300005548 Bacteria 739
140 Ga0070704_100666224 3300005549 Unclassified 920
141 Ga0068855_100173275 3300005563 Unclassified 2443
142 Ga0068855_100548418 3300005563 Bacteria 1252
143 Ga0070664_100000728 3300005564 Bacteria 25309
144 Ga0070664_100664541 3300005564 Unclassified 969
145 Ga0068857_100005650 3300005577 Bacteria 10694
146 Ga0068854_100019731 3300005578 Bacteria 4549
147 Ga0068854_100304731 3300005578 Bacteria 1290
148 Ga0068859_100312449 3300005617 Bacteria 1665
149 Ga0068859_100447039 3300005617 Bacteria 1389
150 Ga0068864_100023582 3300005618 Bacteria 5169
151 Ga0068861_100065718 3300005719 Bacteria 2795
152 Ga0068861_100293488 3300005719 Bacteria 1405
153 Ga0068858_100677212 3300005842 Unclassified 1003
154 Ga0068860_100010836 3300005843 Bacteria 8998
155 Ga0068860_100268042 3300005843 Bacteria 1666
156 Ga0068862_100010974 3300005844 Bacteria 7481
157 Ga0068862_100034047 3300005844 Unclassified 4308
158 Ga0068862_100046325 3300005844 Bacteria 3710
159 Ga0081455_10002511 3300005937 Bacteria 21778
160 Ga0081455_10003193 3300005937 Bacteria 19003
161 Ga0081455_10003354 3300005937 Bacteria 18464
162 Ga0081455_10105036 3300005937 Bacteria 2258
163 Ga0081455_10178172 3300005937 Bacteria 1612
164 Ga0081455_10251626 3300005937 Bacteria 1292
165 Ga0081540_1000057 3300005983 Bacteria 121566
166 Ga0081540_1010532 3300005983 Bacteria 6249
167 Ga0081539_10000721 3300005985 Bacteria 66220
168 Ga0081539_10013013 3300005985 Bacteria 6318
169 Ga0081539_10022413 3300005985 Bacteria 4179
170 Ga0070717_10015699 3300006028 Bacteria 5853
171 Ga0070717_10081226 3300006028 Bacteria 2721
172 Ga0070717_10164322 3300006028 Unclassified 1928
173 Ga0070717_10509749 3300006028 Bacteria 1088
174 Ga0070715_10047255 3300006163 Unclassified 1833
175 Ga0070716_100000083 3300006173 Bacteria 37164
176 Ga0070716_100113182 3300006173 Bacteria 1685
177 Ga0070716_100402146 3300006173 Bacteria 985
178 Ga0070716_100578625 3300006173 Unclassified 841
179 Ga0070712_100007387 3300006175 Bacteria 6855
180 Ga0070712_100018384 3300006175 Bacteria 4540
181 Ga0070712_100187675 3300006175 Unclassified 1615
182 Ga0070712_100239424 3300006175 Bacteria 1445
183 Ga0070712_100370005 3300006175 Unclassified 1177
184 Ga0070712_100406581 3300006175 Unclassified 1125
185 Ga0070712_100784982 3300006175 Unclassified 816
186 Ga0068871_100105993 3300006358 Bacteria 2359
187 Ga0075428_100094174 3300006844 Plasmid 3266
188 Ga0075428_100205882 3300006844 Bacteria 2126
189 Ga0075433_10122599 3300006852 Bacteria 2308
190 Ga0075433_10361906 3300006852 Bacteria 1281
191 Ga0075434_100133416 3300006871 Bacteria 2503
192 Ga0075434_100393937 3300006871 Bacteria 1406
193 Ga0068865_100334063 3300006881 Bacteria 1223
194 Ga0075436_100160206 3300006914 Bacteria 1586
195 Ga0097620_100312454 3300006931 Bacteria 1665
196 Ga0097620_100447070 3300006931 Bacteria 1389
197 Ga0097620_101180891 3300006931 Unclassified 843
198 Ga0099794_10003201 3300007265 Bacteria 6205
199 Ga0099794_10004552 3300007265 Bacteria 5464
200 Ga0099794_10006227 3300007265 Bacteria 4820
201 Ga0099794_10020641 3300007265 Unclassified 2984
202 Ga0099794_10075285 3300007265 Bacteria 1659
203 Ga0099794_10151646 3300007265 Unclassified 1177
204 Ga0099794_10394457 3300007265 Bacteria 723
205 Ga0099795_10006999 3300007788 Bacteria 3118
206 Ga0111539_11079236 3300009094 Bacteria 933
207 Ga0105245_10025427 3300009098 Bacteria 5208
208 Ga0105245_10122615 3300009098 Unclassified 2429
209 Ga0105247_10060089 3300009101 Bacteria 2355
210 Ga0114129_10073724 3300009147 Bacteria 4756
211 Ga0105241_10042841 3300009174 Bacteria 3428
212 Ga0105242_10354156 3300009176 Unclassified 1357
213 Ga0105242_11403391 3300009176 Bacteria 726
214 Ga0105248_10021377 3300009177 Bacteria 7170
215 Ga0105248_10457721 3300009177 Bacteria 1438
216 Ga0105249_10014481 3300009553 Bacteria 6971
217 Ga0105249_10298762 3300009553 Bacteria 1614
218 Ga0105249_11124264 3300009553 Bacteria 856
219 Ga0105249_11752423 3300009553 Bacteria 694
220 Ga0105239_10166132 3300010375 Bacteria 2468
221 Ga0105239_10668504 3300010375 Bacteria 1187
222 Ga0105246_10149619 3300011119 Bacteria 1765
223 Ga0157373_10052957 3300013100 Unclassified 2886
224 Ga0157371_10432647 3300013102 Bacteria 966
225 Ga0157369_10832376 3300013105 Unclassified 948
226 Ga0157374_10014024 3300013296 Bacteria 7005
227 Ga0157374_10021950 3300013296 Bacteria 5688
228 Ga0157374_10059986 3300013296 Unclassified 3559
229 Ga0157374_10132257 3300013296 Bacteria 2415
230 Ga0157374_10244141 3300013296 Bacteria 1766
231 Ga0157374_10344630 3300013296 Bacteria 1479
232 Ga0157374_11341501 3300013296 Unclassified 738
233 Ga0157378_10018210 3300013297 Bacteria 6166
234 Ga0157378_10021872 3300013297 Bacteria 5624
235 Ga0157378_10025206 3300013297 Bacteria 5240
236 Ga0157378_10051876 3300013297 Bacteria 3649
237 Ga0157378_10079635 3300013297 Bacteria 2958
238 Ga0157378_10644014 3300013297 Unclassified 1075
239 Ga0163162_10040038 3300013306 Unclassified 4685
240 Ga0163162_10060187 3300013306 Bacteria 3832
241 Ga0163162_10089622 3300013306 Bacteria 3157
242 Ga0163162_10127300 3300013306 Bacteria 2654
243 Ga0163162_11480812 3300013306 Unclassified 773
244 Ga0163162_11573826 3300013306 Bacteria 749
245 Ga0157372_10044158 3300013307 Bacteria 4938
246 Ga0157372_10078523 3300013307 Bacteria 3730
247 Ga0157372_10482638 3300013307 Bacteria 1445
248 Ga0157372_10588626 3300013307 Unclassified 1297
249 Ga0157372_11086903 3300013307 Bacteria 925
250 Ga0157375_10056383 3300013308 Unclassified 3879
251 Ga0157375_10225101 3300013308 Bacteria 2035
252 Ga0157375_11603172 3300013308 Bacteria 769
253 Ga0163163_10370059 3300014325 Unclassified 1490
254 Ga0157380_10003575 3300014326 Bacteria 10692
255 Ga0157377_10054432 3300014745 Bacteria 2265
256 Ga0157376_10052730 3300014969 Unclassified 3383
257 Ga0157376_10170060 3300014969 Bacteria 1984
258 Ga0157376_10192758 3300014969 Bacteria 1870
259 Ga0163161_10079021 3300017792 Bacteria 2418
260 Ga0163161_10478148 3300017792 Bacteria 1011
261 Ga0163161_10601660 3300017792 Unclassified 906
262 Ga0207673_1000733 3300025290 Bacteria 3519
263 Ga0207697_10002734 3300025315 Bacteria 8996
264 Ga0207697_10003616 3300025315 Bacteria 7578
265 Ga0207697_10003759 3300025315 Bacteria 7418
266 Ga0207697_10005282 3300025315 Bacteria 6018
267 Ga0207697_10008553 3300025315 Unclassified 4471
268 Ga0207653_10000339 3300025885 Bacteria 24285
269 Ga0207682_10052356 3300025893 Bacteria 1692
270 Ga0207692_10045264 3300025898 Bacteria 2200
271 Ga0207692_10190492 3300025898 Unclassified 1200
272 Ga0207692_10195187 3300025898 Unclassified 1187
273 Ga0207692_10309879 3300025898 Unclassified 963
274 Ga0207710_10116296 3300025900 Bacteria 1273
275 Ga0207710_10181721 3300025900 Bacteria 1032
276 Ga0207688_10008650 3300025901 Bacteria 5540
277 Ga0207688_10165241 3300025901 Bacteria 1314
278 Ga0207688_10791107 3300025901 Unclassified 601
279 Ga0207680_10134234 3300025903 Unclassified 1634
280 Ga0207680_10932275 3300025903 Unclassified 622
281 Ga0207685_10139125 3300025905 Unclassified 1087
282 Ga0207685_10157748 3300025905 Bacteria 1033
283 Ga0207699_10116008 3300025906 Bacteria 1724
284 Ga0207699_10288196 3300025906 Unclassified 1143
285 Ga0207645_10007322 3300025907 Bacteria 7802
286 Ga0207645_10010166 3300025907 Bacteria 6469
287 Ga0207645_10011426 3300025907 Bacteria 6062
288 Ga0207645_10065200 3300025907 Bacteria 2327
289 Ga0207645_10307789 3300025907 Unclassified 1055
290 Ga0207705_10146136 3300025909 Unclassified 1769
291 Ga0207684_10000215 3300025910 Bacteria 89389
292 Ga0207684_10003816 3300025910 Bacteria 14533
293 Ga0207684_10022841 3300025910 Bacteria 5341
294 Ga0207684_10188970 3300025910 Bacteria 1776
295 Ga0207684_10189979 3300025910 Bacteria 1771
296 Ga0207684_10302449 3300025910 Unclassified 1379
297 Ga0207684_10390661 3300025910 Bacteria 1196
298 Ga0207684_10991422 3300025910 Bacteria 703
299 Ga0207654_10037616 3300025911 Bacteria 2710
300 Ga0207707_10416225 3300025912 Bacteria 1153
301 Ga0207695_10342651 3300025913 Bacteria 1382
302 Ga0207693_10013832 3300025915 Bacteria 6498
303 Ga0207693_10022513 3300025915 Bacteria 5007
304 Ga0207693_10051513 3300025915 Bacteria 3230
305 Ga0207693_10071760 3300025915 Bacteria 2711
306 Ga0207693_10133311 3300025915 Bacteria 1953
307 Ga0207663_10017342 3300025916 Unclassified 4010
308 Ga0207663_10033184 3300025916 Unclassified 3072
309 Ga0207663_10608258 3300025916 Unclassified 859
310 Ga0207657_10013216 3300025919 Bacteria 8103
311 Ga0207657_10128943 3300025919 Bacteria 2075
312 Ga0207657_10330546 3300025919 Bacteria 1204
313 Ga0207657_10339075 3300025919 Bacteria 1186
314 Ga0207649_10159670 3300025920 Bacteria 1561
315 Ga0207649_10182506 3300025920 Bacteria 1469
316 Ga0207649_10991190 3300025920 Unclassified 661
317 Ga0207652_10182640 3300025921 Unclassified 1885
318 Ga0207646_10010847 3300025922 Bacteria 8858
319 Ga0207646_10087389 3300025922 Bacteria 2790
320 Ga0207646_10095418 3300025922 Bacteria 2664
321 Ga0207646_10744225 3300025922 Unclassified 875
322 Ga0207681_10022041 3300025923 Bacteria 4058
323 Ga0207681_10032217 3300025923 Bacteria 3430
324 Ga0207681_10052070 3300025923 Bacteria 2775
325 Ga0207659_10033541 3300025926 Unclassified 3534
326 Ga0207659_10189545 3300025926 Bacteria 1636
327 Ga0207687_10138282 3300025927 Unclassified 1845
328 Ga0207687_10529343 3300025927 Bacteria 987
329 Ga0207700_10092241 3300025928 Bacteria 2394
330 Ga0207700_10124851 3300025928 Bacteria 2092
331 Ga0207700_10494014 3300025928 Unclassified 1082
332 Ga0207700_10624054 3300025928 Unclassified 960
333 Ga0207664_10020094 3300025929 Bacteria 4945
334 Ga0207664_10120284 3300025929 Unclassified 2196
335 Ga0207664_10363625 3300025929 Unclassified 1282
336 Ga0207664_10622024 3300025929 Unclassified 970
337 Ga0207644_10181336 3300025931 Unclassified 1650
338 Ga0207644_10337471 3300025931 Unclassified 1221
339 Ga0207644_10408906 3300025931 Bacteria 1110
340 Ga0207690_10082442 3300025932 Bacteria 2249
341 Ga0207690_10444099 3300025932 Bacteria 1041
342 Ga0207706_10032299 3300025933 Unclassified 4662
343 Ga0207706_10049709 3300025933 Bacteria 3705
344 Ga0207706_10467568 3300025933 Bacteria 1090
345 Ga0207686_10941664 3300025934 Bacteria 699
346 Ga0207670_10004214 3300025936 Bacteria 7712
347 Ga0207670_10014628 3300025936 Bacteria 4665
348 Ga0207670_10027947 3300025936 Unclassified 3574
349 Ga0207670_10412687 3300025936 Bacteria 1082
350 Ga0207670_10601248 3300025936 Unclassified 903
351 Ga0207669_10038299 3300025937 Bacteria 2759
352 Ga0207669_10266294 3300025937 Bacteria 1284
353 Ga0207669_10802692 3300025937 Unclassified 780
354 Ga0207704_10125621 3300025938 Unclassified 1765
355 Ga0207704_10440898 3300025938 Bacteria 1037
356 Ga0207665_10000092 3300025939 Bacteria 58290
357 Ga0207665_10018808 3300025939 Bacteria 4540
358 Ga0207665_10023268 3300025939 Bacteria 4080
359 Ga0207665_10201590 3300025939 Unclassified 1450
360 Ga0207665_10226332 3300025939 Bacteria 1373
361 Ga0207665_10346853 3300025939 Bacteria 1120
362 Ga0207691_10000774 3300025940 Bacteria 31656
363 Ga0207691_10019193 3300025940 Bacteria 6472
364 Ga0207691_10036532 3300025940 Bacteria 4552
365 Ga0207711_10326833 3300025941 Bacteria 1418
366 Ga0207711_11258159 3300025941 Unclassified 682
367 Ga0207689_10037112 3300025942 Bacteria 4044
368 Ga0207689_10090076 3300025942 Bacteria 2520
369 Ga0207661_10012873 3300025944 Bacteria 6099
370 Ga0207661_10927187 3300025944 Bacteria 802
371 Ga0207661_11329447 3300025944 Unclassified 660
372 Ga0207679_10329401 3300025945 Bacteria 1325
373 Ga0207667_10307445 3300025949 Unclassified 1620
374 Ga0207651_10109022 3300025960 Unclassified 2073
375 Ga0207668_10018571 3300025972 Bacteria 4380
376 Ga0207668_10023976 3300025972 Bacteria 3931
377 Ga0207668_11430866 3300025972 Bacteria 623
378 Ga0207640_10534922 3300025981 Bacteria 982
379 Ga0207658_10809899 3300025986 Unclassified 850
380 Ga0207658_11542795 3300025986 Bacteria 607
381 Ga0207677_10100836 3300026023 Unclassified 2124
382 Ga0207677_10189840 3300026023 Bacteria 1624
383 Ga0207703_10059948 3300026035 Bacteria 3110
384 Ga0207639_10269708 3300026041 Bacteria 1492
385 Ga0207678_10119294 3300026067 Unclassified 2251
386 Ga0207678_11235887 3300026067 Unclassified 661
387 Ga0207708_10000091 3300026075 Bacteria 71484
388 Ga0207708_10004666 3300026075 Bacteria 10086
389 Ga0207702_10187878 3300026078 Bacteria 1907
390 Ga0207648_10077352 3300026089 Bacteria 2900
391 Ga0207648_10438640 3300026089 Bacteria 1188
392 Ga0207648_10765864 3300026089 Bacteria 897
393 Ga0207676_10053095 3300026095 Bacteria 3171
394 Ga0207676_11071763 3300026095 Bacteria 796
395 Ga0207674_10000169 3300026116 Bacteria 78781
396 Ga0207675_100097202 3300026118 Bacteria 2773
397 Ga0207675_100104647 3300026118 Bacteria 2668
398 Ga0207675_100552356 3300026118 Bacteria 1151
399 Ga0207675_101422675 3300026118 Unclassified 714
400 Ga0207683_10303587 3300026121 Bacteria 1461
401 Ga0209179_1018534 3300027512 Bacteria 1330
402 Ga0209588_1003987 3300027671 Bacteria 4131
403 Ga0209588_1023361 3300027671 Unclassified 1948
404 Ga0209588_1026992 3300027671 Bacteria 1826
405 Ga0209974_10023181 3300027876 Bacteria 2054
406 Ga0268266_10308467 3300028379 Bacteria 1478
407 Ga0268266_10359476 3300028379 Bacteria 1370
408 Ga0268265_10015285 3300028380 Bacteria 5250
409 Ga0268265_10022578 3300028380 Unclassified 4424
410 Ga0268265_10028345 3300028380 Bacteria 4008
411 Ga0268264_10629207 3300028381 Bacteria 1060
412 Ga0307408_100012120 3300031548 Bacteria 5706
413 Ga0265314_10314002 3300031711 Bacteria 874
414 Ga0307405_10008182 3300031731 Bacteria 5288
415 Ga0307413_10036918 3300031824 Unclassified 2818
416 Ga0307410_10036349 3300031852 Bacteria 3207
417 Ga0307406_10010372 3300031901 Bacteria 5252
418 Ga0307406_10331911 3300031901 Unclassified 1181
419 Ga0307407_10449211 3300031903 Unclassified 935
420 Ga0307412_10005426 3300031911 Bacteria 7155
421 Ga0307412_11123067 3300031911 Bacteria 700
422 Ga0307409_100377583 3300031995 Unclassified 1346
423 Ga0307416_100012006 3300032002 Bacteria 5812
424 Ga0307416_100134656 3300032002 Bacteria 2232
425 Ga0307414_10008310 3300032004 Bacteria 5878
426 Ga0307411_10044996 3300032005 Bacteria 2836
427 Ga0307415_100032391 3300032126 Bacteria 3379
428 Ga0307415_100043238 3300032126 Unclassified 3004
429 Ga0373945_0067226 3300035116 Bacteria 1349
430 Ga0373956_0046750 3300035119 Bacteria 1935
431 Ga0373943_0040392 3300035170 Bacteria 2252
432 Ga0373943_0184000 3300035170 Unclassified 1150
433 Ga0373931_0217932 3300035691 Bacteria 1148
434 Ga0373935_0152677 3300035692 Bacteria 1568
435 Ga0373947_0020927 3300035725 Bacteria 3783
436 Ga0373947_0159709 3300035725 Bacteria 1457
437 Ga0373947_0308058 3300035725 Bacteria 1057
438 Ga0373925_0103938 3300037068 Unclassified 2187
439 Ga0395899_0281213 3300037312 Unclassified 1132
440 Ga0395900_0027844 3300037418 Bacteria 5789
441 Ga0395900_1207285 3300037418 Unclassified 672
442 Ga0395898_0011791 3300037466 Bacteria 9062
443 Ga0395905_0014347 3300037471 Bacteria 7571
444 Ga0395905_0215382 3300037471 Bacteria 1799
445 Ga0395905_1237841 3300037471 Bacteria 650
446 Ga0395901_0015822 3300038443 Bacteria 7687
447 Ga0395901_0025537 3300038443 Bacteria 6067
448 Ga0395901_0160699 3300038443 Bacteria 2360
449 Ga0451798_0091717 3300041458 Bacteria 1165
450 Ga0439451_021579 3300042009 Bacteria 1299
451 Ga0439454_007948 3300042011 Bacteria 1342
452 Ga0439455_0011145 3300042012 Unclassified 1991
453 Ga0451577_0615942 3300042876 Bacteria 985
454 Ga0439440_0015302 3300042993 Unclassified 1667
455 Ga0453683_0087125 3300044673 Bacteria 1957
456 Ga0451576_0162598 3300045051 Unclassified 2330
457 Ga0451576_1252948 3300045051 Bacteria 774
458 Ga0451576_1575236 3300045051 Bacteria 682
459 Ga0466967_0276282 3300045976 Bacteria 1611
460 Ga0466967_0419850 3300045976 Unclassified 1304
461 Ga0495592_0065965 3300046454 Bacteria 2649
462 Ga0495629_0279115 3300046459 Bacteria 1147
463 Ga0495641_0122641 3300046461 Bacteria 1160
464 Ga0495651_0343638 3300046462 Bacteria 988
465 Ga0495628_0021587 3300046516 Bacteria 5294
466 Ga0495630_0049181 3300046517 Bacteria 3155
467 Ga0495666_0163448 3300046526 Unclassified 1032
468 Ga0495652_0278993 3300046529 Bacteria 1224
469 Ga0495640_0485886 3300046533 Bacteria 752
470 Ga0495586_0009505 3300046535 Bacteria 5176
471 Ga0495645_0006846 3300046543 Bacteria 7922
472 Ga0495667_0620839 3300046559 Unclassified 673
473 Ga0495656_0133232 3300046615 Bacteria 1185
474 Ga0495635_0247989 3300046663 Bacteria 1201
475 Ga0495657_0162192 3300046675 Bacteria 1383
476 Ga0495657_0221813 3300046675 Unclassified 1146
477 Ga0495599_0001804 3300046678 Bacteria 12423
478 Ga0495623_0046597 3300046679 Unclassified 2751
479 Ga0495624_0143716 3300046690 Bacteria 1461
480 Ga0495600_0639800 3300046809 Unclassified 644
481 Ga0495581_0192240 3300047315 Bacteria 1194
482 Ga0495604_0067087 3300047317 Bacteria 2727
483 Ga0495674_0843374 3300047319 Bacteria 710
484 Ga0495680_0054931 3300047322 Bacteria 3090
485 Ga0495675_0042191 3300047444 Bacteria 2906
486 Ga0495684_0003489 3300047471 Bacteria 12308
487 Ga0495684_0355542 3300047471 Bacteria 1039
488 Ga0495684_0522440 3300047471 Bacteria 813
489 Ga0495602_0161545 3300048088 Bacteria 1748
490 Ga0495614_0374922 3300048089 Unclassified 666
491 Ga0496100_0011000 3300048903 Bacteria 5133
492 Ga0496101_0156957 3300048904 Unclassified 1743
493 Ga0496101_0233901 3300048904 Bacteria 1429
494 Ga0496104_0289000 3300048907 Unclassified 1552
495 Ga0496104_0329502 3300048907 Bacteria 1440
496 Ga0496104_0733820 3300048907 Bacteria 895
497 Ga0496105_0232144 3300048908 Bacteria 1499
498 Ga0496106_0216185 3300048909 Bacteria 1528
499 Ga0496107_0083771 3300048910 Unclassified 2325
500 Ga0496107_0521453 3300048910 Unclassified 881
501 Ga0496108_0167908 3300048911 Unclassified 1898
502 Ga0496108_0670376 3300048911 Unclassified 901
503 Ga0496109_0367202 3300048912 Bacteria 1359
504 Ga0496109_0767305 3300048912 Unclassified 902
505 Ga0496110_0636400 3300048913 Unclassified 966
506 Ga0496110_0868425 3300048913 Unclassified 808
507 Ga0496112_0096705 3300048915 Unclassified 2923
508 Ga0496112_0210986 3300048915 Bacteria 1899
509 Ga0496115_0013345 3300048918 Bacteria 6214
510 Ga0496115_0228143 3300048918 Bacteria 1536
511 Ga0496115_0773986 3300048918 Unclassified 749
512 Ga0496115_0777857 3300048918 Unclassified 747
513 Ga0501292_025909 3300049515 Unclassified 968
514 Ga0501299_028608 3300049522 Bacteria 1063
515 Ga0501067_0012315 3300049583 Bacteria 4742
516 Ga0501077_0001112 3300049593 Bacteria 16214
517 Ga0501202_005920 3300049652 Unclassified 2175
518 Ga0501202_062586 3300049652 Unclassified 844
519 Ga0501206_005655 3300049653 Unclassified 1612
520 Ga0501207_002098 3300049654 Bacteria 2547
521 Ga0501214_012982 3300049659 Unclassified 958
522 Ga0501216_019198 3300049660 Unclassified 1183
523 Ga0501216_022145 3300049660 Bacteria 1122
524 Ga0501217_005010 3300049661 Unclassified 2750
525 Ga0501223_005192 3300049663 Unclassified 2748
526 Ga0501223_038384 3300049663 Bacteria 930
527 Ga0501224_048603 3300049664 Bacteria 648
528 Ga0501227_001574 3300049665 Bacteria 5084
529 Ga0501233_003635 3300049668 Bacteria 2782
530 Ga0501235_004470 3300049669 Unclassified 3022
531 Ga0501235_006191 3300049669 Unclassified 2607
532 Ga0501236_013158 3300049670 Bacteria 1128
533 Ga0501240_001826 3300049673 Unclassified 2150
534 Ga0501243_006662 3300049675 Bacteria 1754
535 Ga0501250_023274 3300049680 Bacteria 817
536 Ga0501253_009858 3300049683 Bacteria 1421
537 Ga0501259_003763 3300049688 Unclassified 2411
538 Ga0501260_012653 3300049689 Unclassified 865
539 Ga0501221_034856 3300049704 Bacteria 1071
540 Ga0501225_0002220 3300049705 Bacteria 6003
541 Ga0501225_0015038 3300049705 Bacteria 2158
542 Ga0501225_0027513 3300049705 Bacteria 1563
543 Ga0501229_013681 3300049706 Unclassified 1042
544 Ga0501234_002464 3300049707 Unclassified 2910
545 Ga0501245_083126 3300049708 Unclassified 622
546 Ga0501241_094802 3300049758 Bacteria 636
547 Ga0501263_025792 3300049760 Bacteria 811
548 Ga0501270_022317 3300049767 Bacteria 976
549 Ga0501273_017289 3300049770 Bacteria 951
550 Ga0501273_058462 3300049770 Unclassified 603
551 Ga0501204_001781 3300049850 Bacteria 2154
552 Ga0501226_008495 3300049853 Unclassified 1146
553 nmdc:mga05p37_219679_c1 3300050507 Bacteria 2294
554 nmdc:mga08y16_159175_c1 3300050511 Bacteria 2346
555 nmdc:mga08y16_688484_c1 3300050511 Bacteria 1023
556 nmdc:mga08y16_72711_c1 3300050511 Bacteria 3583
557 nmdc:mga0n895_27679_c1 3300050512 Bacteria 5387
558 nmdc:mga0n895_81536_c1 3300050512 Bacteria 3224
559 nmdc:mga08x19_12807_c1 3300050514 Bacteria 5058
560 nmdc:mga08x19_265228_c1 3300050514 Bacteria 1188
561 nmdc:mga0a205_261499_c1 3300050515 Bacteria 1608
562 nmdc:mga0a205_330497_c1 3300050515 Bacteria 1394
563 Ga0495601_0013922 3300053077 Unclassified 4843
564 Ga0495619_0103026 3300053085 Bacteria 1944
565 Ga0501082_0000023 3300060353 Bacteria 104756
566 Ga0268264_11113340
567 SwRhRL2b_contig_2073574
568 JGI24746J21847_1017739
569 Ga0065704_10003796
570 Ga0065712_10120636
571 Ga0065712_10144200
572 Ga0065712_10156489
573 Ga0065712_10455574
574 Ga0065715_10026192
575 Ga0065715_10105598
576 Ga0065715_10108677
577 Ga0065715_10148709
578 Ga0070658_10303768
579 Ga0070676_10061867
580 Ga0070683_100229462
581 Ga0070683_100442216
582 Ga0070690_100062527
583 Ga0068869_100057361
584 Ga0068869_100310965
585 Ga0068869_100421383
586 Ga0070666_10257423
587 Ga0070680_100413000
588 Ga0070680_101010007
589 Ga0070682_100438471
590 Ga0068868_100107499
591 Ga0068868_100184988
592 Ga0068868_100264569
593 Ga0070660_100008373
594 Ga0070660_100467557
595 Ga0070689_100000147
596 Ga0070689_100146604
597 Ga0070687_100398144
598 Ga0070687_100566253
599 Ga0070661_100274719
600 Ga0070692_10050760
601 Ga0070692_10284600
602 Ga0070692_10513441
603 Ga0070668_100031493
604 Ga0070669_100005415
605 Ga0070669_100037801
606 Ga0070669_100041229
607 Ga0070669_100383605
608 Ga0070669_101169773
609 Ga0070675_100007199
610 Ga0070675_100030662
611 Ga0070671_100519161
612 Ga0070671_100902610
613 Ga0070674_100006712
614 Ga0070674_100875999
615 Ga0070673_100084819
616 Ga0070688_100002102
617 Ga0070659_100001121
618 Ga0070659_100002230
619 Ga0070659_100538336
620 Ga0070667_100161570
621 Ga0070667_100855429
622 Ga0070667_101069891
623 Ga0070703_10000289
624 Ga0070709_10366865
625 Ga0070714_100099318
626 Ga0070714_100108440
627 Ga0070714_100211144
628 Ga0070714_100216430
629 Ga0070713_100019759
630 Ga0070713_100127255
631 Ga0070713_100374249
632 Ga0070713_100622158
633 Ga0070713_100878965
634 Ga0070710_10012482
635 Ga0070710_10025637
636 Ga0070710_10500882
637 Ga0070711_100015241
638 Ga0070711_100280314
639 Ga0070711_100346437
640 Ga0070711_100985023
641 Ga0070711_101127510
642 Ga0070705_100003998
643 Ga0070705_100147917
644 Ga0070700_100000065
645 Ga0070700_100098777
646 Ga0070694_100061716
647 Ga0070694_100138957
648 Ga0070694_100205612
649 Ga0070694_100249756
650 Ga0070694_100411527
651 Ga0070694_100536580
652 Ga0070708_100005805
653 Ga0070708_100028757
654 Ga0070708_100074043
655 Ga0070708_100123463
656 Ga0070708_101302038
657 Ga0070678_100342116
658 Ga0070662_100034218
659 Ga0070681_10001309
660 Ga0068867_100725817
661 Ga0070685_10028870
662 Ga0070685_10476689
663 Ga0070706_100000020
664 Ga0070706_100016203
665 Ga0070706_100027638
666 Ga0070706_100071533
667 Ga0070706_100144711
668 Ga0070706_100239311
669 Ga0070706_100265877
670 Ga0070706_100339043
671 Ga0070706_100432446
672 Ga0070706_100562049
673 Ga0070707_100009081
674 Ga0070707_100020702
675 Ga0070707_100073591
676 Ga0070707_100256186
677 Ga0070707_100315464
678 Ga0070707_100353155
679 Ga0070707_100381304
680 Ga0070698_100000826
681 Ga0070698_100003840
682 Ga0070699_100000083
683 Ga0070699_100003249
684 Ga0070679_100046977
685 Ga0070684_100173255
686 Ga0070697_100000699
687 Ga0070697_100002030
688 Ga0070697_100016984
689 Ga0070697_100134386
690 Ga0070697_100155061
691 Ga0070697_100171102
692 Ga0070697_100190170
693 Ga0070697_100277148
694 Ga0070697_100415442
695 Ga0070697_100712025
696 Ga0068853_100007439
697 Ga0070672_100040253
698 Ga0070695_100374575
699 Ga0070696_100000120
700 Ga0070696_100011234
701 Ga0070696_100312875
702 Ga0070696_100379645
703 Ga0070665_100167490
704 Ga0070665_101292934
705 Ga0070704_100666224
706 Ga0068855_100173275
707 Ga0068855_100548418
708 Ga0070664_100000728
709 Ga0070664_100664541
710 Ga0068857_100005650
711 Ga0068854_100019731
712 Ga0068854_100304731
713 Ga0068859_100312449
714 Ga0068859_100447039
715 Ga0068864_100023582
716 Ga0068861_100065718
717 Ga0068861_100293488
718 Ga0068858_100677212
719 Ga0068860_100010836
720 Ga0068860_100268042
721 Ga0068862_100010974
722 Ga0068862_100034047
723 Ga0068862_100046325
724 Ga0081455_10002511
725 Ga0081455_10003193
726 Ga0081455_10003354
727 Ga0081455_10105036
728 Ga0081455_10178172
729 Ga0081455_10251626
730 Ga0081540_1000057
731 Ga0081540_1010532
732 Ga0081539_10000721
733 Ga0081539_10013013
734 Ga0081539_10022413
735 Ga0070717_10015699
736 Ga0070717_10081226
737 Ga0070717_10164322
738 Ga0070717_10509749
739 Ga0070715_10047255
740 Ga0070716_100000083
741 Ga0070716_100113182
742 Ga0070716_100402146
743 Ga0070716_100578625
744 Ga0070712_100007387
745 Ga0070712_100018384
746 Ga0070712_100187675
747 Ga0070712_100239424
748 Ga0070712_100370005
749 Ga0070712_100406581
750 Ga0070712_100784982
751 Ga0068871_100105993
752 Ga0075428_100094174
753 Ga0075428_100205882
754 Ga0075433_10122599
755 Ga0075433_10361906
756 Ga0075434_100133416
757 Ga0075434_100393937
758 Ga0068865_100334063
759 Ga0075436_100160206
760 Ga0097620_100312454
761 Ga0097620_100447070
762 Ga0097620_101180891
763 Ga0099794_10003201
764 Ga0099794_10004552
765 Ga0099794_10006227
766 Ga0099794_10020641
767 Ga0099794_10075285
768 Ga0099794_10151646
769 Ga0099794_10394457
770 Ga0099795_10006999
771 Ga0111539_11079236
772 Ga0105245_10025427
773 Ga0105245_10122615
774 Ga0105247_10060089
775 Ga0114129_10073724
776 Ga0105241_10042841
777 Ga0105242_10354156
778 Ga0105242_11403391
779 Ga0105248_10021377
780 Ga0105248_10457721
781 Ga0105249_10014481
782 Ga0105249_10298762
783 Ga0105249_11124264
784 Ga0105249_11752423
785 Ga0105239_10166132
786 Ga0105239_10668504
787 Ga0105246_10149619
788 Ga0157373_10052957
789 Ga0157371_10432647
790 Ga0157369_10832376
791 Ga0157374_10014024
792 Ga0157374_10021950
793 Ga0157374_10059986
794 Ga0157374_10132257
795 Ga0157374_10244141
796 Ga0157374_10344630
797 Ga0157374_11341501
798 Ga0157378_10018210
799 Ga0157378_10021872
800 Ga0157378_10025206
801 Ga0157378_10051876
802 Ga0157378_10079635
803 Ga0157378_10644014
804 Ga0163162_10040038
805 Ga0163162_10060187
806 Ga0163162_10089622
807 Ga0163162_10127300
808 Ga0163162_11480812
809 Ga0163162_11573826
810 Ga0157372_10044158
811 Ga0157372_10078523
812 Ga0157372_10482638
813 Ga0157372_10588626
814 Ga0157372_11086903
815 Ga0157375_10056383
816 Ga0157375_10225101
817 Ga0157375_11603172
818 Ga0163163_10370059
819 Ga0157380_10003575
820 Ga0157377_10054432
821 Ga0157376_10052730
822 Ga0157376_10170060
823 Ga0157376_10192758
824 Ga0163161_10079021
825 Ga0163161_10478148
826 Ga0163161_10601660
827 Ga0207673_1000733
828 Ga0207697_10002734
829 Ga0207697_10003616
830 Ga0207697_10003759
831 Ga0207697_10005282
832 Ga0207697_10008553
833 Ga0207653_10000339
834 Ga0207682_10052356
835 Ga0207692_10045264
836 Ga0207692_10190492
837 Ga0207692_10195187
838 Ga0207692_10309879
839 Ga0207710_10116296
840 Ga0207710_10181721
841 Ga0207688_10008650
842 Ga0207688_10165241
843 Ga0207688_10791107
844 Ga0207680_10134234
845 Ga0207680_10932275
846 Ga0207685_10139125
847 Ga0207685_10157748
848 Ga0207699_10116008
849 Ga0207699_10288196
850 Ga0207645_10007322
851 Ga0207645_10010166
852 Ga0207645_10011426
853 Ga0207645_10065200
854 Ga0207645_10307789
855 Ga0207705_10146136
856 Ga0207684_10000215
857 Ga0207684_10003816
858 Ga0207684_10022841
859 Ga0207684_10188970
860 Ga0207684_10189979
861 Ga0207684_10302449
862 Ga0207684_10390661
863 Ga0207684_10991422
864 Ga0207654_10037616
865 Ga0207707_10416225
866 Ga0207695_10342651
867 Ga0207693_10013832
868 Ga0207693_10022513
869 Ga0207693_10051513
870 Ga0207693_10071760
871 Ga0207693_10133311
872 Ga0207663_10017342
873 Ga0207663_10033184
874 Ga0207663_10608258
875 Ga0207657_10013216
876 Ga0207657_10128943
877 Ga0207657_10330546
878 Ga0207657_10339075
879 Ga0207649_10159670
880 Ga0207649_10182506
881 Ga0207649_10991190
882 Ga0207652_10182640
883 Ga0207646_10010847
884 Ga0207646_10087389
885 Ga0207646_10095418
886 Ga0207646_10744225
887 Ga0207681_10022041
888 Ga0207681_10032217
889 Ga0207681_10052070
890 Ga0207659_10033541
891 Ga0207659_10189545
892 Ga0207687_10138282
893 Ga0207687_10529343
894 Ga0207700_10092241
895 Ga0207700_10124851
896 Ga0207700_10494014
897 Ga0207700_10624054
898 Ga0207664_10020094
899 Ga0207664_10120284
900 Ga0207664_10363625
901 Ga0207664_10622024
902 Ga0207644_10181336
903 Ga0207644_10337471
904 Ga0207644_10408906
905 Ga0207690_10082442
906 Ga0207690_10444099
907 Ga0207706_10032299
908 Ga0207706_10049709
909 Ga0207706_10467568
910 Ga0207686_10941664
911 Ga0207670_10004214
912 Ga0207670_10014628
913 Ga0207670_10027947
914 Ga0207670_10412687
915 Ga0207670_10601248
916 Ga0207669_10038299
917 Ga0207669_10266294
918 Ga0207669_10802692
919 Ga0207704_10125621
920 Ga0207704_10440898
921 Ga0207665_10000092
922 Ga0207665_10018808
923 Ga0207665_10023268
924 Ga0207665_10201590
925 Ga0207665_10226332
926 Ga0207665_10346853
927 Ga0207691_10000774
928 Ga0207691_10019193
929 Ga0207691_10036532
930 Ga0207711_10326833
931 Ga0207711_11258159
932 Ga0207689_10037112
933 Ga0207689_10090076
934 Ga0207661_10012873
935 Ga0207661_10927187
936 Ga0207661_11329447
937 Ga0207679_10329401
938 Ga0207667_10307445
939 Ga0207651_10109022
940 Ga0207668_10018571
941 Ga0207668_10023976
942 Ga0207668_11430866
943 Ga0207640_10534922
944 Ga0207658_10809899
945 Ga0207658_11542795
946 Ga0207677_10100836
947 Ga0207677_10189840
948 Ga0207703_10059948
949 Ga0207639_10269708
950 Ga0207678_10119294
951 Ga0207678_11235887
952 Ga0207708_10000091
953 Ga0207708_10004666
954 Ga0207702_10187878
955 Ga0207648_10077352
956 Ga0207648_10438640
957 Ga0207648_10765864
958 Ga0207676_10053095
959 Ga0207676_11071763
960 Ga0207674_10000169
961 Ga0207675_100097202
962 Ga0207675_100104647
963 Ga0207675_100552356
964 Ga0207675_101422675
965 Ga0207683_10303587
966 Ga0209179_1018534
967 Ga0209588_1003987
968 Ga0209588_1023361
969 Ga0209588_1026992
970 Ga0209974_10023181
971 Ga0268266_10308467
972 Ga0268266_10359476
973 Ga0268265_10015285
974 Ga0268265_10022578
975 Ga0268265_10028345
976 Ga0268264_10629207
977 Ga0307408_100012120
978 Ga0265314_10314002
979 Ga0307405_10008182
980 Ga0307413_10036918
981 Ga0307410_10036349
982 Ga0307406_10010372
983 Ga0307406_10331911
984 Ga0307407_10449211
985 Ga0307412_10005426
986 Ga0307412_11123067
987 Ga0307409_100377583
988 Ga0307416_100012006
989 Ga0307416_100134656
990 Ga0307414_10008310
991 Ga0307411_10044996
992 Ga0307415_100032391
993 Ga0307415_100043238
994 Ga0373945_0067226
995 Ga0373956_0046750
996 Ga0373943_0040392
997 Ga0373943_0184000
998 Ga0373931_0217932
999 Ga0373935_0152677
1000 Ga0373947_0020927
1001 Ga0373947_0159709
1002 Ga0373947_0308058
1003 Ga0373925_0103938
1004 Ga0395899_0281213
1005 Ga0395900_0027844
1006 Ga0395900_1207285
1007 Ga0395898_0011791
1008 Ga0395905_0014347
1009 Ga0395905_0215382
1010 Ga0395905_1237841
1011 Ga0395901_0015822
1012 Ga0395901_0025537
1013 Ga0395901_0160699
1014 Ga0451798_0091717
1015 Ga0439451_021579
1016 Ga0439454_007948
1017 Ga0439455_0011145
1018 Ga0451577_0615942
1019 Ga0439440_0015302
1020 Ga0453683_0087125
1021 Ga0451576_0162598
1022 Ga0451576_1252948
1023 Ga0451576_1575236
1024 Ga0466967_0276282
1025 Ga0466967_0419850
1026 Ga0495592_0065965
1027 Ga0495629_0279115
1028 Ga0495641_0122641
1029 Ga0495651_0343638
1030 Ga0495628_0021587
1031 Ga0495630_0049181
1032 Ga0495666_0163448
1033 Ga0495652_0278993
1034 Ga0495640_0485886
1035 Ga0495586_0009505
1036 Ga0495645_0006846
1037 Ga0495667_0620839
1038 Ga0495656_0133232
1039 Ga0495635_0247989
1040 Ga0495657_0162192
1041 Ga0495657_0221813
1042 Ga0495599_0001804
1043 Ga0495623_0046597
1044 Ga0495624_0143716
1045 Ga0495600_0639800
1046 Ga0495581_0192240
1047 Ga0495604_0067087
1048 Ga0495674_0843374
1049 Ga0495680_0054931
1050 Ga0495675_0042191
1051 Ga0495684_0003489
1052 Ga0495684_0355542
1053 Ga0495684_0522440
1054 Ga0495602_0161545
1055 Ga0495614_0374922
1056 Ga0496100_0011000
1057 Ga0496101_0156957
1058 Ga0496101_0233901
1059 Ga0496104_0289000
1060 Ga0496104_0329502
1061 Ga0496104_0733820
1062 Ga0496105_0232144
1063 Ga0496106_0216185
1064 Ga0496107_0083771
1065 Ga0496107_0521453
1066 Ga0496108_0167908
1067 Ga0496108_0670376
1068 Ga0496109_0367202
1069 Ga0496109_0767305
1070 Ga0496110_0636400
1071 Ga0496110_0868425
1072 Ga0496112_0096705
1073 Ga0496112_0210986
1074 Ga0496115_0013345
1075 Ga0496115_0228143
1076 Ga0496115_0773986
1077 Ga0496115_0777857
1078 Ga0501292_025909
1079 Ga0501299_028608
1080 Ga0501067_0012315
1081 Ga0501077_0001112
1082 Ga0501202_005920
1083 Ga0501202_062586
1084 Ga0501206_005655
1085 Ga0501207_002098
1086 Ga0501214_012982
1087 Ga0501216_019198
1088 Ga0501216_022145
1089 Ga0501217_005010
1090 Ga0501223_005192
1091 Ga0501223_038384
1092 Ga0501224_048603
1093 Ga0501227_001574
1094 Ga0501233_003635
1095 Ga0501235_004470
1096 Ga0501235_006191
1097 Ga0501236_013158
1098 Ga0501240_001826
1099 Ga0501243_006662
1100 Ga0501250_023274
1101 Ga0501253_009858
1102 Ga0501259_003763
1103 Ga0501260_012653
1104 Ga0501221_034856
1105 Ga0501225_0002220
1106 Ga0501225_0015038
1107 Ga0501225_0027513
1108 Ga0501229_013681
1109 Ga0501234_002464
1110 Ga0501245_083126
1111 Ga0501241_094802
1112 Ga0501263_025792
1113 Ga0501270_022317
1114 Ga0501273_017289
1115 Ga0501273_058462
1116 Ga0501204_001781
1117 Ga0501226_008495
1118 nmdc:mga05p37_219679_c1
1119 nmdc:mga08y16_159175_c1
1120 nmdc:mga08y16_688484_c1
1121 nmdc:mga08y16_72711_c1
1122 nmdc:mga0n895_27679_c1
1123 nmdc:mga0n895_81536_c1
1124 nmdc:mga08x19_12807_c1
1125 nmdc:mga08x19_265228_c1
1126 nmdc:mga0a205_261499_c1
1127 nmdc:mga0a205_330497_c1
1128 Ga0495601_0013922
1129 Ga0495619_0103026
1130 Ga0501082_0000023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

67

192

0.97

PF08534

Redoxin

Redoxin

66

209

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9399 27 175
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.934 33 178
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9305 28 179
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9205 30 176
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.9183 28 175
ID Description Score Start End Superfamily
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9354 38 175 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.934 33 177 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9333 31 174 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9303 30 175 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9245 30 179 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Z8QUA8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.973 30 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A7Y2E4E3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9713 28 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A7C3RYT7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9667 38 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A1W1DFK8-F1-model_v4 Thiol peroxidase, Bcp-type (EC 1.11.1.15) 0.9637 61 176 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9625 27 123

Map