F464219

General Info

Members Datasets Scaffolds Average Seq Length
564 331 1128 224

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255067|2600814238
Length 245
Sequence HGRLSSVVDREALAAMLVEGADRLRIDLTDAQRAALLDYVALLAKWNAVYNLTAIRDPRQMLIQHVLDSLAIVPHLAPELPRDSAVSVLDVGSGGGLPGIVLAIALPQWSITLNDIVHKKTAFQSQAKAELGLTNLSVVTGRVELLRPGIEVPGKFDVIVSRAFAELADFVTLARNLVSDRGAIWAMKGVRPDAEIDRLPAGSRAMQVVRLEVPFLDAERHLVEVRVDADGVAPTSASGKAEDGG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
164 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
165 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
274 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
275 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
276 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
277 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
278 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
279 2519103095 Burkholderia sp. KJ006 Isolate Nodule
280 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
281 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
282 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
283 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
284 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
285 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
286 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
287 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
288 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
289 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
290 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
291 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
292 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
293 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
294 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
295 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
296 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
297 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
298 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
299 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
300 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
301 2818991452 Burkholderia cepacia 561 Isolate Unclassified
302 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
303 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
304 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
305 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
306 2904564687 Burkholderia sp. 571 Isolate Unclassified
307 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
308 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
309 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
310 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
311 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
312 2928163908 Burkholderia sp. 567 Isolate Unclassified
313 2928170801 Burkholderia sp. 572 Isolate Unclassified
314 2928536128 Burkholderia sola 565 Isolate Unclassified
315 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
316 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
317 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
318 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
319 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
320 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
321 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
322 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
323 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
324 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
325 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
326 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
327 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
328 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
329 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
330 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
331 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.36
Metatranscriptomes 0.18
Isolates 10.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 1.6
Rhizoplane 7.09
Rhizosphere 71.1
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008299 3300001979 Bacteria 4147
2 JGI24739J22299_10010415 3300001989 Bacteria 3453
3 JGI24739J22299_10013604 3300001989 Bacteria 2968
4 JGI24739J22299_10017961 3300001989 Bacteria 2546
5 JGI24739J22299_10064324 3300001989 Bacteria 1153
6 JGI24739J22299_10073159 3300001989 Bacteria 1064
7 JGI24737J22298_10002504 3300001990 Bacteria 6532
8 JGI24737J22298_10010270 3300001990 Bacteria 3094
9 JGI24737J22298_10015939 3300001990 Bacteria 2427
10 JGI24735J21928_10000162 3300002067 Bacteria 23762
11 JGI24735J21928_10001613 3300002067 Bacteria 7983
12 JGI24735J21928_10010258 3300002067 Bacteria 2991
13 JGI24735J21928_10088092 3300002067 Bacteria 889
14 JGI24738J21930_10009732 3300002075 Bacteria 2155
15 JGI25156J39149_1000485 3300002705 Bacteria 23858
16 JGI25156J39149_1000815 3300002705 Bacteria 15924
17 JGI25165J46597_1001397 3300003214 Bacteria 13227
18 rootH1_10173721 3300003316 Bacteria 1426
19 rootH2_10009585 3300003320 Bacteria 3008
20 rootH2_10059072 3300003320 Bacteria 1330
21 rootL2_10109129 3300003322 Bacteria 1990
22 rootL2_10109130 3300003322 Bacteria 1346
23 JGI25160J50197_1000016 3300003354 Bacteria 247819
24 Ga0055533_1000331 3300003756 Bacteria 20806
25 Ga0055533_1003159 3300003756 Bacteria 3433
26 Ga0055532_1000022 3300003758 Bacteria 248737
27 Ga0055532_1000999 3300003758 Bacteria 8886
28 Ga0055532_1001455 3300003758 Bacteria 6581
29 Ga0055532_1001471 3300003758 Bacteria 6535
30 Ga0055527_1000016 3300003760 Bacteria 248736
31 Ga0055527_1000645 3300003760 Bacteria 10581
32 Ga0055527_1011892 3300003760 Bacteria 990
33 Ga0055535_1000017 3300003761 Bacteria 248735
34 Ga0055535_1001611 3300003761 Bacteria 10581
35 Ga0055535_1001620 3300003761 Bacteria 10545
36 Ga0055542_1000030 3300003762 Bacteria 248717
37 Ga0055542_1001587 3300003762 Bacteria 10545
38 Ga0055529_1000033 3300003763 Bacteria 248734
39 Ga0055529_1001023 3300003763 Bacteria 13397
40 Ga0058692_1001396 3300003856 Bacteria 8923
41 Ga0065165_1000875 3300005262 Bacteria 38986
42 Ga0070658_10000918 3300005327 Bacteria 25164
43 Ga0070683_100840846 3300005329 Bacteria 880
44 Ga0070690_100597942 3300005330 Bacteria 837
45 Ga0070670_100394947 3300005331 Bacteria 1220
46 Ga0070670_100406326 3300005331 Bacteria 1203
47 Ga0070682_100046562 3300005337 Bacteria 2692
48 Ga0070660_100000108 3300005339 Bacteria 51014
49 Ga0070689_100016265 3300005340 Bacteria 5441
50 Ga0070691_10022656 3300005341 Bacteria 2915
51 Ga0070661_100411394 3300005344 Bacteria 1071
52 Ga0070661_100554793 3300005344 Bacteria 925
53 Ga0070669_100245360 3300005353 Bacteria 1424
54 Ga0070675_100267401 3300005354 Bacteria 1500
55 Ga0070674_100475595 3300005356 Bacteria 1036
56 Ga0070659_100000170 3300005366 Bacteria 50095
57 Ga0070659_100538324 3300005366 Bacteria 999
58 Ga0070667_100008525 3300005367 Bacteria 8498
59 Ga0070667_100035878 3300005367 Bacteria 4156
60 Ga0070663_100001358 3300005455 Bacteria 13375
61 Ga0070663_100006865 3300005455 Bacteria 6890
62 Ga0070663_100052102 3300005455 Bacteria 2918
63 Ga0070663_100302797 3300005455 Bacteria 1280
64 Ga0070678_100180627 3300005456 Bacteria 1727
65 Ga0070662_100126031 3300005457 Bacteria 1968
66 Ga0068867_100051628 3300005459 Bacteria 3033
67 Ga0068853_100083623 3300005539 Bacteria 2797
68 Ga0070686_100142304 3300005544 Bacteria 1671
69 Ga0070695_100206410 3300005545 Bacteria 1407
70 Ga0070696_100020051 3300005546 Bacteria 4533
71 Ga0070693_100019485 3300005547 Bacteria 3557
72 Ga0070665_100111184 3300005548 Bacteria 2742
73 Ga0070665_100269666 3300005548 Bacteria 1704
74 Ga0068855_100027466 3300005563 Bacteria 6807
75 Ga0068855_100073701 3300005563 Bacteria 3966
76 Ga0068855_100216453 3300005563 Bacteria 2150
77 Ga0070664_100111910 3300005564 Bacteria 2383
78 Ga0070664_100237496 3300005564 Bacteria 1635
79 Ga0068854_100010510 3300005578 Bacteria 6005
80 Ga0068854_100579937 3300005578 Bacteria 955
81 Ga0068856_100011026 3300005614 Bacteria 8778
82 Ga0068856_100150902 3300005614 Bacteria 2333
83 Ga0068856_100241297 3300005614 Bacteria 1822
84 Ga0070702_100024955 3300005615 Bacteria 3197
85 Ga0070702_100254180 3300005615 Bacteria 1193
86 Ga0068852_100016544 3300005616 Bacteria 5757
87 Ga0068852_100368792 3300005616 Bacteria 1406
88 Ga0068852_100593927 3300005616 Bacteria 1111
89 Ga0068852_100898661 3300005616 Bacteria 903
90 Ga0068866_10003735 3300005718 Bacteria 6244
91 Ga0068851_10210879 3300005834 Bacteria 1088
92 Ga0068858_100097799 3300005842 Bacteria 2736
93 Ga0068858_100592563 3300005842 Bacteria 1075
94 Ga0068862_100858193 3300005844 Bacteria 890
95 Ga0097621_100572963 3300006237 Bacteria 1029
96 Ga0068871_100032007 3300006358 Bacteria 4150
97 Ga0075434_100072709 3300006871 Bacteria 3431
98 Ga0075434_100164365 3300006871 Bacteria 2239
99 Ga0075434_100215920 3300006871 Bacteria 1938
100 Ga0075436_100385255 3300006914 Bacteria 1014
101 Ga0075435_100073050 3300007076 Bacteria 2803
102 Ga0075435_100448204 3300007076 Bacteria 1113
103 Ga0099794_10009069 3300007265 Bacteria 4158
104 Ga0105251_10040804 3300009011 Bacteria 2262
105 Ga0105251_10117643 3300009011 Bacteria 1208
106 Ga0105244_10030008 3300009036 Bacteria 2897
107 Ga0105244_10201128 3300009036 Bacteria 939
108 Ga0105250_10001203 3300009092 Bacteria 14430
109 Ga0105250_10007917 3300009092 Bacteria 4542
110 Ga0105240_10024211 3300009093 Bacteria 8011
111 Ga0105240_10037252 3300009093 Bacteria 6252
112 Ga0105240_10196566 3300009093 Bacteria 2367
113 Ga0105245_10021830 3300009098 Bacteria 5619
114 Ga0105245_10279196 3300009098 Bacteria 1632
115 Ga0105245_10514925 3300009098 Bacteria 1214
116 Ga0105247_10024939 3300009101 Bacteria 3606
117 Ga0114129_10224888 3300009147 Bacteria 2530
118 Ga0105243_10191585 3300009148 Bacteria 1786
119 Ga0105241_10086316 3300009174 Bacteria 2468
120 Ga0105241_10163500 3300009174 Bacteria 1832
121 Ga0105242_10030014 3300009176 Bacteria 4340
122 Ga0105248_10003137 3300009177 Bacteria 18293
123 Ga0105248_10025295 3300009177 Bacteria 6600
124 Ga0105248_10165770 3300009177 Bacteria 2491
125 Ga0105237_10057000 3300009545 Bacteria 3911
126 Ga0105237_10105760 3300009545 Bacteria 2805
127 Ga0105237_10342861 3300009545 Bacteria 1498
128 Ga0105238_10013204 3300009551 Bacteria 8336
129 Ga0105238_10037160 3300009551 Bacteria 4952
130 Ga0105238_10071212 3300009551 Bacteria 3474
131 Ga0105238_10101465 3300009551 Bacteria 2860
132 Ga0105238_10160402 3300009551 Bacteria 2224
133 Ga0105238_10406566 3300009551 Bacteria 1355
134 Ga0105249_10177069 3300009553 Bacteria 2072
135 Ga0105239_10342597 3300010375 Bacteria 1687
136 Ga0105239_10779243 3300010375 Bacteria 1095
137 Ga0105246_10065071 3300011119 Bacteria 2549
138 Ga0105246_10075192 3300011119 Bacteria 2390
139 Ga0157373_10044313 3300013100 Bacteria 3176
140 Ga0157373_10081277 3300013100 Bacteria 2284
141 Ga0157370_10003903 3300013104 Bacteria 17377
142 Ga0157370_10016492 3300013104 Bacteria 7476
143 Ga0157370_10149851 3300013104 Bacteria 2171
144 Ga0157369_10000304 3300013105 Bacteria 65926
145 Ga0157369_10006755 3300013105 Bacteria 13242
146 Ga0157369_10249569 3300013105 Bacteria 1852
147 Ga0157374_10043146 3300013296 Bacteria 4164
148 Ga0157374_10547127 3300013296 Bacteria 1165
149 Ga0157378_10034654 3300013297 Bacteria 4464
150 Ga0157378_10173094 3300013297 Bacteria 2026
151 Ga0163162_10004087 3300013306 Bacteria 14005
152 Ga0163162_10061423 3300013306 Bacteria 3796
153 Ga0163162_10391066 3300013306 Bacteria 1523
154 Ga0163162_10424534 3300013306 Bacteria 1462
155 Ga0157372_10204161 3300013307 Bacteria 2290
156 Ga0157372_10421301 3300013307 Bacteria 1556
157 Ga0157372_10588090 3300013307 Bacteria 1297
158 Ga0157375_10025697 3300013308 Bacteria 5478
159 Ga0182006_1074354 3300015261 Bacteria 1252
160 Ga0182007_10005679 3300015262 Bacteria 5444
161 Ga0182005_1051205 3300015265 Bacteria 1123
162 Ga0183361_10001 3300016635 Bacteria 908583
163 Ga0163161_10009486 3300017792 Bacteria 6736
164 Ga0163161_10083711 3300017792 Bacteria 2351
165 Ga0224712_10000828 3300022467 Bacteria 6562
166 Ga0209566_100264 3300025225 Bacteria 49372
167 Ga0209674_100017 3300025226 Bacteria 689087
168 Ga0209674_100291 3300025226 Bacteria 35684
169 Ga0209674_104103 3300025226 Bacteria 2457
170 Ga0209672_100001 3300025228 Bacteria 2828210
171 Ga0209672_100115 3300025228 Bacteria 89213
172 Ga0209672_100136 3300025228 Bacteria 72753
173 Ga0209147_100022 3300025229 Bacteria 443906
174 Ga0209147_100164 3300025229 Bacteria 90422
175 Ga0209147_100215 3300025229 Bacteria 60346
176 Ga0209147_100360 3300025229 Bacteria 32565
177 Ga0209563_107328 3300025230 Bacteria 1819
178 Ga0207427_100535 3300025231 Bacteria 19800
179 Ga0209258_100033 3300025242 Bacteria 443845
180 Ga0209258_100261 3300025242 Bacteria 90726
181 Ga0209258_100271 3300025242 Bacteria 89095
182 Ga0209148_1000046 3300025254 Bacteria 443881
183 Ga0209148_1000104 3300025254 Bacteria 214254
184 Ga0209148_1000609 3300025254 Bacteria 32035
185 Ga0209759_1000231 3300025256 Bacteria 83320
186 Ga0209759_1000568 3300025256 Bacteria 37118
187 Ga0209759_1003271 3300025256 Bacteria 6549
188 Ga0209233_1000050 3300025261 Bacteria 450736
189 Ga0209455_1000038 3300025272 Bacteria 443899
190 Ga0209455_1000097 3300025272 Bacteria 214136
191 Ga0209673_1000124 3300025273 Bacteria 169015
192 Ga0209130_1006233 3300025284 Bacteria 3920
193 Ga0209564_1002969 3300025295 Bacteria 12201
194 Ga0209564_1005509 3300025295 Bacteria 7181
195 Ga0207426_1000007 3300025302 Bacteria 971011
196 Ga0207426_1001933 3300025302 Bacteria 14885
197 Ga0207696_1013061 3300025711 Bacteria 2911
198 Ga0207696_1041956 3300025711 Bacteria 1334
199 Ga0207655_1045261 3300025728 Bacteria 1839
200 Ga0207713_1013154 3300025735 Bacteria 4379
201 Ga0207713_1037975 3300025735 Bacteria 2048
202 Ga0207642_10003284 3300025899 Bacteria 5083
203 Ga0207688_10035584 3300025901 Bacteria 2759
204 Ga0207680_10041765 3300025903 Bacteria 2678
205 Ga0207647_10018758 3300025904 Bacteria 4669
206 Ga0207647_10031703 3300025904 Bacteria 3399
207 Ga0207647_10245813 3300025904 Bacteria 1027
208 Ga0207645_10066468 3300025907 Bacteria 2305
209 Ga0207705_10002099 3300025909 Bacteria 15494
210 Ga0207684_10542657 3300025910 Bacteria 995
211 Ga0207695_10019692 3300025913 Bacteria 7760
212 Ga0207695_10142456 3300025913 Bacteria 2344
213 Ga0207695_10449574 3300025913 Bacteria 1172
214 Ga0207671_10032399 3300025914 Bacteria 3891
215 Ga0207671_10184615 3300025914 Bacteria 1624
216 Ga0207693_10022544 3300025915 Bacteria 5003
217 Ga0207657_10001682 3300025919 Bacteria 23847
218 Ga0207681_10232208 3300025923 Bacteria 1432
219 Ga0207694_10011178 3300025924 Bacteria 6776
220 Ga0207694_10014967 3300025924 Bacteria 5850
221 Ga0207694_10680967 3300025924 Bacteria 867
222 Ga0207687_10023608 3300025927 Bacteria 4102
223 Ga0207687_10186865 3300025927 Bacteria 1609
224 Ga0207700_10885663 3300025928 Unclassified 799
225 Ga0207644_10061049 3300025931 Bacteria 2729
226 Ga0207690_10000012 3300025932 Bacteria 269610
227 Ga0207690_10112002 3300025932 Bacteria 1967
228 Ga0207690_10617377 3300025932 Bacteria 886
229 Ga0207706_10143720 3300025933 Bacteria 2099
230 Ga0207669_10025613 3300025937 Bacteria 3192
231 Ga0207711_10028161 3300025941 Bacteria 4726
232 Ga0207711_10220613 3300025941 Bacteria 1734
233 Ga0207689_10171064 3300025942 Bacteria 1791
234 Ga0207661_10667285 3300025944 Bacteria 956
235 Ga0207679_10268726 3300025945 Bacteria 1458
236 Ga0207679_10996291 3300025945 Bacteria 768
237 Ga0207667_10004701 3300025949 Bacteria 16704
238 Ga0207667_10037447 3300025949 Bacteria 5184
239 Ga0207712_10123516 3300025961 Bacteria 1962
240 Ga0207640_10058856 3300025981 Bacteria 2533
241 Ga0207658_10021654 3300025986 Bacteria 4465
242 Ga0207658_10591837 3300025986 Bacteria 996
243 Ga0207677_10400561 3300026023 Bacteria 1164
244 Ga0207703_10077256 3300026035 Bacteria 2764
245 Ga0207678_10000076 3300026067 Bacteria 78938
246 Ga0207678_10014544 3300026067 Bacteria 6923
247 Ga0207678_10050329 3300026067 Bacteria 3600
248 Ga0207678_10301727 3300026067 Bacteria 1376
249 Ga0207702_10030946 3300026078 Bacteria 4460
250 Ga0207702_10040850 3300026078 Bacteria 3888
251 Ga0207702_10261554 3300026078 Bacteria 1629
252 Ga0207648_10086407 3300026089 Bacteria 2736
253 Ga0207683_10000243 3300026121 Bacteria 48324
254 Ga0207698_10033021 3300026142 Bacteria 3756
255 Ga0207698_10343405 3300026142 Bacteria 1407
256 Ga0207698_10553592 3300026142 Bacteria 1128
257 Ga0209371_1000185 3300027312 Bacteria 90613
258 Ga0209371_1006051 3300027312 Bacteria 4602
259 Ga0265338_10000590 3300028800 Bacteria 64098
260 Ga0268256_1000847 3300030500 Bacteria 21660
261 Ga0307405_10182246 3300031731 Bacteria 1509
262 Ga0307412_10000011 3300031911 Bacteria 405842
263 Ga0307412_10249652 3300031911 Bacteria 1377
264 Ga0373936_0024041 3300035113 Bacteria 2377
265 Ga0373936_0201657 3300035113 Bacteria 878
266 Ga0373943_0120401 3300035170 Bacteria 1394
267 Ga0373942_0030269 3300035207 Bacteria 1425
268 Ga0373933_0101332 3300035724 Bacteria 1787
269 Ga0373937_0004534 3300036401 Bacteria 11799
270 Ga0373925_0355836 3300037068 Bacteria 1189
271 Ga0395899_0000149 3300037312 Bacteria 105958
272 Ga0395899_0020448 3300037312 Bacteria 5018
273 Ga0395899_0116777 3300037312 Bacteria 1914
274 Ga0395900_0001006 3300037418 Bacteria 36517
275 Ga0395900_0013273 3300037418 Bacteria 8422
276 Ga0395900_0021791 3300037418 Bacteria 6551
277 Ga0395900_0047585 3300037418 Bacteria 4416
278 Ga0395900_0086440 3300037418 Bacteria 3223
279 Ga0395900_0133544 3300037418 Bacteria 2543
280 Ga0395898_0001927 3300037466 Bacteria 26381
281 Ga0395898_0017398 3300037466 Bacteria 7344
282 Ga0395905_0000079 3300037471 Bacteria 160663
283 Ga0395901_0000017 3300038443 Bacteria 345003
284 Ga0395901_0000560 3300038443 Bacteria 43097
285 Ga0395901_0001431 3300038443 Bacteria 24880
286 Ga0395901_0068750 3300038443 Bacteria 3689
287 Ga0436360_1119489 3300039438 Bacteria 912
288 Ga0436361_0710261 3300039447 Bacteria 2418
289 Ga0451839_1319518 3300041496 Bacteria 943
290 Ga0466969_0022111 3300044656 Bacteria 3285
291 Ga0466972_0030610 3300044658 Bacteria 2649
292 Ga0466972_0168151 3300044658 Bacteria 1029
293 Ga0466973_0003647 3300044659 Bacteria 12557
294 Ga0466974_0072964 3300044660 Bacteria 2292
295 Ga0466982_0267918 3300044672 Bacteria 990
296 Ga0466965_0000641 3300044683 Bacteria 12822
297 Ga0466965_0146277 3300044683 Bacteria 1233
298 Ga0466966_0000753 3300044684 Bacteria 20547
299 Ga0466966_0008454 3300044684 Bacteria 6814
300 Ga0466966_0049476 3300044684 Bacteria 2677
301 Ga0466966_0091821 3300044684 Bacteria 1884
302 Ga0466961_0001307 3300044693 Bacteria 15368
303 Ga0466961_0008416 3300044693 Bacteria 6567
304 Ga0466961_0011964 3300044693 Bacteria 5545
305 Ga0466961_0075478 3300044693 Bacteria 2137
306 Ga0466963_0007936 3300044694 Bacteria 6355
307 Ga0466963_0022467 3300044694 Bacteria 3995
308 Ga0466963_0092715 3300044694 Bacteria 2058
309 Ga0466963_0211859 3300044694 Bacteria 1356
310 Ga0466964_0005966 3300044706 Bacteria 4539
311 Ga0466964_0027519 3300044706 Bacteria 2233
312 Ga0453684_0955893 3300044712 Unclassified 914
313 Ga0466971_0002927 3300044719 Bacteria 7245
314 Ga0466971_0015476 3300044719 Bacteria 3357
315 Ga0466971_0088636 3300044719 Bacteria 1415
316 Ga0466971_0155401 3300044719 Bacteria 1069
317 Ga0466968_0017301 3300044735 Bacteria 2880
318 Ga0466968_0335245 3300044735 Bacteria 733
319 Ga0466970_0063832 3300044765 Bacteria 1974
320 Ga0466957_0016390 3300044842 Bacteria 4335
321 Ga0466957_0026909 3300044842 Bacteria 3414
322 Ga0466957_0037153 3300044842 Bacteria 2932
323 Ga0466957_0080762 3300044842 Bacteria 2024
324 Ga0466957_0084923 3300044842 Bacteria 1976
325 Ga0466960_0147431 3300044901 Bacteria 1254
326 Ga0466959_0023662 3300045049 Bacteria 4546
327 Ga0466959_0103802 3300045049 Bacteria 2033
328 Ga0466959_0391823 3300045049 Bacteria 945
329 Ga0466958_0002823 3300045836 Bacteria 8840
330 Ga0466958_0030993 3300045836 Bacteria 3178
331 Ga0466958_0151390 3300045836 Bacteria 1463
332 Ga0495592_0049359 3300046454 Bacteria 3128
333 Ga0495603_0045773 3300046455 Bacteria 2608
334 Ga0495590_0001307 3300046457 Bacteria 10826
335 Ga0495590_0006325 3300046457 Bacteria 4634
336 Ga0495629_0046954 3300046459 Bacteria 3028
337 Ga0495629_0230428 3300046459 Bacteria 1277
338 Ga0495638_0003608 3300046460 Bacteria 12099
339 Ga0495651_0221713 3300046462 Bacteria 1308
340 Ga0495653_0035440 3300046463 Bacteria 3937
341 Ga0495653_0049688 3300046463 Bacteria 3229
342 Ga0495650_0011531 3300046471 Bacteria 4833
343 Ga0495650_0045027 3300046471 Bacteria 1860
344 Ga0495650_0162188 3300046471 Bacteria 796
345 Ga0495580_0009192 3300046472 Bacteria 7789
346 Ga0495580_0019564 3300046472 Bacteria 5030
347 Ga0495605_0010235 3300046474 Bacteria 5252
348 Ga0495605_0044590 3300046474 Bacteria 2192
349 Ga0495605_0287892 3300046474 Bacteria 697
350 Ga0495639_0091698 3300046475 Bacteria 1426
351 Ga0495664_0023768 3300046477 Bacteria 3557
352 Ga0495664_0279785 3300046477 Bacteria 1008
353 Ga0495585_0011407 3300046492 Bacteria 5258
354 Ga0495596_0037491 3300046500 Bacteria 1916
355 Ga0495606_0012434 3300046507 Bacteria 6824
356 Ga0495606_0012702 3300046507 Bacteria 6720
357 Ga0495606_0013933 3300046507 Bacteria 6309
358 Ga0495608_0041099 3300046511 Bacteria 3096
359 Ga0495610_0002064 3300046512 Bacteria 17146
360 Ga0495620_0053869 3300046515 Bacteria 1702
361 Ga0495628_0037208 3300046516 Bacteria 3902
362 Ga0495628_0057173 3300046516 Bacteria 3069
363 Ga0495628_0160510 3300046516 Bacteria 1708
364 Ga0495628_0264639 3300046516 Bacteria 1280
365 Ga0495630_0008445 3300046517 Bacteria 7391
366 Ga0495631_0080811 3300046518 Bacteria 1402
367 Ga0495643_0130923 3300046522 Bacteria 1259
368 Ga0495666_0005713 3300046526 Bacteria 6270
369 Ga0495642_0045310 3300046528 Bacteria 1797
370 Ga0495642_0066975 3300046528 Bacteria 1497
371 Ga0495652_0012402 3300046529 Bacteria 7689
372 Ga0495652_0097119 3300046529 Bacteria 2397
373 Ga0495665_0035137 3300046531 Bacteria 2678
374 Ga0495665_0097399 3300046531 Bacteria 1544
375 Ga0495640_0054639 3300046533 Bacteria 2734
376 Ga0495586_0046564 3300046535 Bacteria 2338
377 Ga0495621_0001060 3300046539 Bacteria 7042
378 Ga0495621_0092959 3300046539 Bacteria 1139
379 Ga0495597_0107347 3300046542 Bacteria 1173
380 Ga0495622_0039090 3300046557 Bacteria 2209
381 Ga0495667_0120201 3300046559 Bacteria 1696
382 Ga0495668_0135325 3300046616 Bacteria 1349
383 Ga0495634_0016007 3300046642 Bacteria 5372
384 Ga0495635_0014181 3300046663 Bacteria 5577
385 Ga0495635_0067155 3300046663 Bacteria 2460
386 Ga0495635_0499510 3300046663 Bacteria 801
387 Ga0495588_0152624 3300046674 Bacteria 1221
388 Ga0495657_0042521 3300046675 Bacteria 3102
389 Ga0495623_0010886 3300046679 Bacteria 5889
390 Ga0495646_0008207 3300046680 Bacteria 6638
391 Ga0495646_0070875 3300046680 Bacteria 2052
392 Ga0495669_0031092 3300046684 Bacteria 2344
393 Ga0495613_0122706 3300046689 Bacteria 1865
394 Ga0495624_0026337 3300046690 Bacteria 3812
395 Ga0495671_0055001 3300046692 Bacteria 1972
396 Ga0495649_0049480 3300046694 Bacteria 2283
397 Ga0495649_0054377 3300046694 Bacteria 2165
398 Ga0495649_0095142 3300046694 Bacteria 1586
399 Ga0495649_0289597 3300046694 Bacteria 835
400 Ga0495589_0006136 3300046794 Bacteria 6347
401 Ga0495589_0148657 3300046794 Bacteria 1119
402 Ga0495600_0071757 3300046809 Bacteria 2262
403 Ga0495600_0238219 3300046809 Bacteria 1160
404 Ga0495581_0003276 3300047315 Bacteria 9290
405 Ga0495604_0821000 3300047317 Bacteria 585
406 Ga0495674_0045193 3300047319 Bacteria 3911
407 Ga0495674_0077394 3300047319 Bacteria 2860
408 Ga0495674_0159070 3300047319 Bacteria 1890
409 Ga0495672_0018782 3300047320 Bacteria 4578
410 Ga0495672_0025657 3300047320 Bacteria 3767
411 Ga0495672_0250731 3300047320 Bacteria 859
412 Ga0495680_0002302 3300047322 Bacteria 19622
413 Ga0495680_0018900 3300047322 Bacteria 5835
414 Ga0495683_0008442 3300047323 Bacteria 5509
415 Ga0495683_0020350 3300047323 Bacteria 3423
416 Ga0495683_0040197 3300047323 Bacteria 2362
417 Ga0495687_000053 3300047443 Bacteria 195897
418 Ga0495687_013231 3300047443 Bacteria 4318
419 Ga0495687_014777 3300047443 Bacteria 3998
420 Ga0495687_082974 3300047443 Bacteria 1249
421 Ga0495675_0118910 3300047444 Bacteria 1646
422 Ga0495675_0200222 3300047444 Bacteria 1216
423 Ga0495679_019418 3300047446 Bacteria 2389
424 Ga0495685_114577 3300047447 Bacteria 886
425 Ga0495673_0004942 3300047469 Bacteria 8205
426 Ga0495686_0000519 3300047472 Bacteria 55675
427 Ga0495593_0001073 3300047673 Bacteria 15971
428 Ga0495593_0058962 3300047673 Bacteria 2012
429 Ga0495614_0000394 3300048089 Bacteria 17743
430 Ga0495626_0027833 3300048091 Bacteria 2745
431 Ga0496100_0051349 3300048903 Bacteria 2676
432 Ga0496100_0073174 3300048903 Bacteria 2293
433 Ga0496100_0475555 3300048903 Bacteria 960
434 Ga0496101_0041404 3300048904 Bacteria 3284
435 Ga0496101_0121926 3300048904 Bacteria 1971
436 Ga0496102_0019578 3300048905 Bacteria 5962
437 Ga0496102_0021631 3300048905 Bacteria 5690
438 Ga0496102_0022182 3300048905 Bacteria 5623
439 Ga0496102_0184399 3300048905 Bacteria 1966
440 Ga0496103_0044831 3300048906 Bacteria 2726
441 Ga0496103_0080956 3300048906 Bacteria 2042
442 Ga0496103_0308921 3300048906 Bacteria 1017
443 Ga0496104_0006859 3300048907 Bacteria 10038
444 Ga0496104_0071060 3300048907 Bacteria 3309
445 Ga0496104_0147271 3300048907 Bacteria 2261
446 Ga0496104_0164683 3300048907 Bacteria 2126
447 Ga0496105_0021948 3300048908 Bacteria 5168
448 Ga0496105_0100945 3300048908 Bacteria 2383
449 Ga0496105_0113599 3300048908 Bacteria 2234
450 Ga0496105_0162607 3300048908 Bacteria 1832
451 Ga0496106_0005601 3300048909 Bacteria 9298
452 Ga0496106_0010079 3300048909 Bacteria 6979
453 Ga0496106_0096360 3300048909 Bacteria 2289
454 Ga0496106_0723584 3300048909 Bacteria 792
455 Ga0496107_0018086 3300048910 Bacteria 4958
456 Ga0496107_0037776 3300048910 Bacteria 3466
457 Ga0496108_0023455 3300048911 Bacteria 5078
458 Ga0496110_0159185 3300048913 Bacteria 2046
459 Ga0496110_0861552 3300048913 Bacteria 811
460 Ga0496111_0622369 3300048914 Bacteria 789
461 Ga0496112_0021662 3300048915 Bacteria 6114
462 Ga0496112_0686200 3300048915 Bacteria 952
463 Ga0496114_0109376 3300048917 Bacteria 2367
464 Ga0496115_0061709 3300048918 Bacteria 3023
465 Ga0496115_0440748 3300048918 Bacteria 1053
466 Ga0496116_0188134 3300048919 Bacteria 1096
467 Ga0496116_0190855 3300048919 Bacteria 1085
468 Ga0496117_0005096 3300048920 Bacteria 14050
469 Ga0496117_0033695 3300048920 Bacteria 3869
470 Ga0496117_0049094 3300048920 Bacteria 3006
471 Ga0496117_0102980 3300048920 Bacteria 1800
472 Ga0496118_0002738 3300048921 Bacteria 23192
473 Ga0496118_0009248 3300048921 Bacteria 10001
474 Ga0496118_0028658 3300048921 Bacteria 4684
475 Ga0496118_0102162 3300048921 Bacteria 1933
476 Ga0496118_0235976 3300048921 Bacteria 1051
477 Ga0496119_0054052 3300048922 Bacteria 2448
478 Ga0496119_0080480 3300048922 Bacteria 1879
479 Ga0496119_0219065 3300048922 Bacteria 975
480 Ga0496121_0003102 3300048924 Bacteria 24024
481 Ga0496121_0028785 3300048924 Bacteria 5161
482 Ga0496121_0036653 3300048924 Bacteria 4367
483 Ga0496121_0071196 3300048924 Bacteria 2797
484 Ga0496122_0095549 3300048925 Bacteria 2008
485 Ga0496123_0010042 3300048926 Bacteria 8430
486 Ga0496123_0036711 3300048926 Bacteria 3470
487 Ga0496123_0056115 3300048926 Bacteria 2578
488 Ga0496124_0061443 3300048927 Bacteria 3149
489 Ga0496125_0026123 3300048928 Bacteria 5332
490 Ga0496125_0439180 3300048928 Bacteria 751
491 Ga0496126_0000118 3300048929 Bacteria 184719
492 Ga0496126_0195437 3300048929 Bacteria 1711
493 Ga0495678_047755 3300049459 Bacteria 1674
494 Ga0495682_0013009 3300049460 Bacteria 3175
495 Ga0501039_1258505 3300049575 Bacteria 571
496 Ga0501079_0778626 3300049741 Bacteria 753
497 Ga0501280_001070 3300049776 Bacteria 5549
498 nmdc:mga0n895_529811_c1 3300050512 Bacteria 1185
499 nmdc:mga0rr50_464926_c1 3300050513 Bacteria 1073
500 nmdc:mga0rr50_672165_c1 3300050513 Bacteria 884
501 nmdc:mga08x19_361868_c1 3300050514 Bacteria 1014
502 Ga0466962_0000108 3300061719 Bacteria 33805
503 Ga0466962_0006095 3300061719 Bacteria 5796
504 Ga0466962_0024285 3300061719 Bacteria 2912
505 Ga0466962_0074750 3300061719 Bacteria 1619
506 2600814238 2600255067 Bacteria 6795583
507 2501410117 2501025504 Bacteria 8008976
508 2509128046 2508501125 Bacteria 7208311
509 2513959548 2513237151 Bacteria 6309801
510 2514046884 2513237166 Bacteria 10373764
511 2516018483 2515154189 Bacteria 9629850
512 2519457306 2519103095 Bacteria 6629912
513 2527078487 2526164713 Bacteria 6780608
514 2563055493 2562617112 Bacteria 10918404
515 2585292152 2582581311 Bacteria 6763856
516 2599738753 2599185239 Bacteria 8686614
517 2599747635 2599185240 Bacteria 7968121
518 2600209519 2599185355 Bacteria 7968906
519 2676745578 2675903129 Bacteria 7964495
520 2713478862 2711768613 Bacteria 11048459
521 2735816432 2734482258 Unclassified 2930739
522 2738823078 2738541296 Bacteria 7285013
523 2738835285 2738541298 Bacteria 7286732
524 2738876764 2738541306 Bacteria 7284992
525 2739188773 2738543002 Bacteria 7284546
526 2739223425 2738543008 Bacteria 7282815
527 2792839285 2791355137 Bacteria 9654227
528 2808971335 2808606384 Bacteria 8474373
529 2809006281 2808606390 Bacteria 8476311
530 2809013302 2808606391 Bacteria 8308166
531 2817259507 2816332253 Bacteria 6764532
532 2817277176 2816332256 Bacteria 6891714
533 2817454090 2816332286 Bacteria 6853759
534 2819634707 2818991452 Bacteria 8442785
535 2863425395 2863421361 Bacteria 7300805
536 2870069634 2870068957 Bacteria 8925310
537 2883096109 2883087390 Bacteria 9532701
538 2904488138 2904483920 Bacteria 7545285
539 2904570141 2904564687 Bacteria 7609577
540 2904577327 2904571731 Bacteria 7608790
541 2904617508 2904615490 Bacteria 10047340
542 2919531101 2919527303 Bacteria 7718827
543 2921647154 2921643360 Bacteria 11448031
544 2928163726 2928157003 Bacteria 7522202
545 2928170523 2928163908 Bacteria 7561269
546 2928175844 2928170801 Bacteria 8785406
547 2928541484 2928536128 Bacteria 7657547
548 2945934833 2945934425 Bacteria 7444609
549 2981995765 2981990288 Bacteria 7590678
550 2990704590 2990703756 Bacteria 7715990
551 642425149 641736151 Bacteria 7477263
552 642416465 641736154 Bacteria 7689995
553 642594842 642555112 Bacteria 8676562
554 8018848097 8018845410 Bacteria 8933938
555 8020810297 8020807995 Bacteria 6801506
556 8020939181 8020938398 Bacteria 7472757
557 8020948529 8020945358 Bacteria 8467355
558 8020956239 8020953355 Bacteria 7439080
559 8021127040 8021120328 Bacteria 8782274
560 8039101479 8039098773 Bacteria 6602928
561 8040169603 8040167225 Bacteria 6542727
562 8040174636 8040173305 Bacteria 6827067
563 8055270781 8055266321 Bacteria 7999742
564 8055305583 8055301274 Bacteria 8587385
565 JGI24740J21852_10008299
566 JGI24739J22299_10010415
567 JGI24739J22299_10013604
568 JGI24739J22299_10017961
569 JGI24739J22299_10064324
570 JGI24739J22299_10073159
571 JGI24737J22298_10002504
572 JGI24737J22298_10010270
573 JGI24737J22298_10015939
574 JGI24735J21928_10000162
575 JGI24735J21928_10001613
576 JGI24735J21928_10010258
577 JGI24735J21928_10088092
578 JGI24738J21930_10009732
579 JGI25156J39149_1000485
580 JGI25156J39149_1000815
581 JGI25165J46597_1001397
582 rootH1_10173721
583 rootH2_10009585
584 rootH2_10059072
585 rootL2_10109129
586 rootL2_10109130
587 JGI25160J50197_1000016
588 Ga0055533_1000331
589 Ga0055533_1003159
590 Ga0055532_1000022
591 Ga0055532_1000999
592 Ga0055532_1001455
593 Ga0055532_1001471
594 Ga0055527_1000016
595 Ga0055527_1000645
596 Ga0055527_1011892
597 Ga0055535_1000017
598 Ga0055535_1001611
599 Ga0055535_1001620
600 Ga0055542_1000030
601 Ga0055542_1001587
602 Ga0055529_1000033
603 Ga0055529_1001023
604 Ga0058692_1001396
605 Ga0065165_1000875
606 Ga0070658_10000918
607 Ga0070683_100840846
608 Ga0070690_100597942
609 Ga0070670_100394947
610 Ga0070670_100406326
611 Ga0070682_100046562
612 Ga0070660_100000108
613 Ga0070689_100016265
614 Ga0070691_10022656
615 Ga0070661_100411394
616 Ga0070661_100554793
617 Ga0070669_100245360
618 Ga0070675_100267401
619 Ga0070674_100475595
620 Ga0070659_100000170
621 Ga0070659_100538324
622 Ga0070667_100008525
623 Ga0070667_100035878
624 Ga0070663_100001358
625 Ga0070663_100006865
626 Ga0070663_100052102
627 Ga0070663_100302797
628 Ga0070678_100180627
629 Ga0070662_100126031
630 Ga0068867_100051628
631 Ga0068853_100083623
632 Ga0070686_100142304
633 Ga0070695_100206410
634 Ga0070696_100020051
635 Ga0070693_100019485
636 Ga0070665_100111184
637 Ga0070665_100269666
638 Ga0068855_100027466
639 Ga0068855_100073701
640 Ga0068855_100216453
641 Ga0070664_100111910
642 Ga0070664_100237496
643 Ga0068854_100010510
644 Ga0068854_100579937
645 Ga0068856_100011026
646 Ga0068856_100150902
647 Ga0068856_100241297
648 Ga0070702_100024955
649 Ga0070702_100254180
650 Ga0068852_100016544
651 Ga0068852_100368792
652 Ga0068852_100593927
653 Ga0068852_100898661
654 Ga0068866_10003735
655 Ga0068851_10210879
656 Ga0068858_100097799
657 Ga0068858_100592563
658 Ga0068862_100858193
659 Ga0097621_100572963
660 Ga0068871_100032007
661 Ga0075434_100072709
662 Ga0075434_100164365
663 Ga0075434_100215920
664 Ga0075436_100385255
665 Ga0075435_100073050
666 Ga0075435_100448204
667 Ga0099794_10009069
668 Ga0105251_10040804
669 Ga0105251_10117643
670 Ga0105244_10030008
671 Ga0105244_10201128
672 Ga0105250_10001203
673 Ga0105250_10007917
674 Ga0105240_10024211
675 Ga0105240_10037252
676 Ga0105240_10196566
677 Ga0105245_10021830
678 Ga0105245_10279196
679 Ga0105245_10514925
680 Ga0105247_10024939
681 Ga0114129_10224888
682 Ga0105243_10191585
683 Ga0105241_10086316
684 Ga0105241_10163500
685 Ga0105242_10030014
686 Ga0105248_10003137
687 Ga0105248_10025295
688 Ga0105248_10165770
689 Ga0105237_10057000
690 Ga0105237_10105760
691 Ga0105237_10342861
692 Ga0105238_10013204
693 Ga0105238_10037160
694 Ga0105238_10071212
695 Ga0105238_10101465
696 Ga0105238_10160402
697 Ga0105238_10406566
698 Ga0105249_10177069
699 Ga0105239_10342597
700 Ga0105239_10779243
701 Ga0105246_10065071
702 Ga0105246_10075192
703 Ga0157373_10044313
704 Ga0157373_10081277
705 Ga0157370_10003903
706 Ga0157370_10016492
707 Ga0157370_10149851
708 Ga0157369_10000304
709 Ga0157369_10006755
710 Ga0157369_10249569
711 Ga0157374_10043146
712 Ga0157374_10547127
713 Ga0157378_10034654
714 Ga0157378_10173094
715 Ga0163162_10004087
716 Ga0163162_10061423
717 Ga0163162_10391066
718 Ga0163162_10424534
719 Ga0157372_10204161
720 Ga0157372_10421301
721 Ga0157372_10588090
722 Ga0157375_10025697
723 Ga0182006_1074354
724 Ga0182007_10005679
725 Ga0182005_1051205
726 Ga0183361_10001
727 Ga0163161_10009486
728 Ga0163161_10083711
729 Ga0224712_10000828
730 Ga0209566_100264
731 Ga0209674_100017
732 Ga0209674_100291
733 Ga0209674_104103
734 Ga0209672_100001
735 Ga0209672_100115
736 Ga0209672_100136
737 Ga0209147_100022
738 Ga0209147_100164
739 Ga0209147_100215
740 Ga0209147_100360
741 Ga0209563_107328
742 Ga0207427_100535
743 Ga0209258_100033
744 Ga0209258_100261
745 Ga0209258_100271
746 Ga0209148_1000046
747 Ga0209148_1000104
748 Ga0209148_1000609
749 Ga0209759_1000231
750 Ga0209759_1000568
751 Ga0209759_1003271
752 Ga0209233_1000050
753 Ga0209455_1000038
754 Ga0209455_1000097
755 Ga0209673_1000124
756 Ga0209130_1006233
757 Ga0209564_1002969
758 Ga0209564_1005509
759 Ga0207426_1000007
760 Ga0207426_1001933
761 Ga0207696_1013061
762 Ga0207696_1041956
763 Ga0207655_1045261
764 Ga0207713_1013154
765 Ga0207713_1037975
766 Ga0207642_10003284
767 Ga0207688_10035584
768 Ga0207680_10041765
769 Ga0207647_10018758
770 Ga0207647_10031703
771 Ga0207647_10245813
772 Ga0207645_10066468
773 Ga0207705_10002099
774 Ga0207684_10542657
775 Ga0207695_10019692
776 Ga0207695_10142456
777 Ga0207695_10449574
778 Ga0207671_10032399
779 Ga0207671_10184615
780 Ga0207693_10022544
781 Ga0207657_10001682
782 Ga0207681_10232208
783 Ga0207694_10011178
784 Ga0207694_10014967
785 Ga0207694_10680967
786 Ga0207687_10023608
787 Ga0207687_10186865
788 Ga0207700_10885663
789 Ga0207644_10061049
790 Ga0207690_10000012
791 Ga0207690_10112002
792 Ga0207690_10617377
793 Ga0207706_10143720
794 Ga0207669_10025613
795 Ga0207711_10028161
796 Ga0207711_10220613
797 Ga0207689_10171064
798 Ga0207661_10667285
799 Ga0207679_10268726
800 Ga0207679_10996291
801 Ga0207667_10004701
802 Ga0207667_10037447
803 Ga0207712_10123516
804 Ga0207640_10058856
805 Ga0207658_10021654
806 Ga0207658_10591837
807 Ga0207677_10400561
808 Ga0207703_10077256
809 Ga0207678_10000076
810 Ga0207678_10014544
811 Ga0207678_10050329
812 Ga0207678_10301727
813 Ga0207702_10030946
814 Ga0207702_10040850
815 Ga0207702_10261554
816 Ga0207648_10086407
817 Ga0207683_10000243
818 Ga0207698_10033021
819 Ga0207698_10343405
820 Ga0207698_10553592
821 Ga0209371_1000185
822 Ga0209371_1006051
823 Ga0265338_10000590
824 Ga0268256_1000847
825 Ga0307405_10182246
826 Ga0307412_10000011
827 Ga0307412_10249652
828 Ga0373936_0024041
829 Ga0373936_0201657
830 Ga0373943_0120401
831 Ga0373942_0030269
832 Ga0373933_0101332
833 Ga0373937_0004534
834 Ga0373925_0355836
835 Ga0395899_0000149
836 Ga0395899_0020448
837 Ga0395899_0116777
838 Ga0395900_0001006
839 Ga0395900_0013273
840 Ga0395900_0021791
841 Ga0395900_0047585
842 Ga0395900_0086440
843 Ga0395900_0133544
844 Ga0395898_0001927
845 Ga0395898_0017398
846 Ga0395905_0000079
847 Ga0395901_0000017
848 Ga0395901_0000560
849 Ga0395901_0001431
850 Ga0395901_0068750
851 Ga0436360_1119489
852 Ga0436361_0710261
853 Ga0451839_1319518
854 Ga0466969_0022111
855 Ga0466972_0030610
856 Ga0466972_0168151
857 Ga0466973_0003647
858 Ga0466974_0072964
859 Ga0466982_0267918
860 Ga0466965_0000641
861 Ga0466965_0146277
862 Ga0466966_0000753
863 Ga0466966_0008454
864 Ga0466966_0049476
865 Ga0466966_0091821
866 Ga0466961_0001307
867 Ga0466961_0008416
868 Ga0466961_0011964
869 Ga0466961_0075478
870 Ga0466963_0007936
871 Ga0466963_0022467
872 Ga0466963_0092715
873 Ga0466963_0211859
874 Ga0466964_0005966
875 Ga0466964_0027519
876 Ga0453684_0955893
877 Ga0466971_0002927
878 Ga0466971_0015476
879 Ga0466971_0088636
880 Ga0466971_0155401
881 Ga0466968_0017301
882 Ga0466968_0335245
883 Ga0466970_0063832
884 Ga0466957_0016390
885 Ga0466957_0026909
886 Ga0466957_0037153
887 Ga0466957_0080762
888 Ga0466957_0084923
889 Ga0466960_0147431
890 Ga0466959_0023662
891 Ga0466959_0103802
892 Ga0466959_0391823
893 Ga0466958_0002823
894 Ga0466958_0030993
895 Ga0466958_0151390
896 Ga0495592_0049359
897 Ga0495603_0045773
898 Ga0495590_0001307
899 Ga0495590_0006325
900 Ga0495629_0046954
901 Ga0495629_0230428
902 Ga0495638_0003608
903 Ga0495651_0221713
904 Ga0495653_0035440
905 Ga0495653_0049688
906 Ga0495650_0011531
907 Ga0495650_0045027
908 Ga0495650_0162188
909 Ga0495580_0009192
910 Ga0495580_0019564
911 Ga0495605_0010235
912 Ga0495605_0044590
913 Ga0495605_0287892
914 Ga0495639_0091698
915 Ga0495664_0023768
916 Ga0495664_0279785
917 Ga0495585_0011407
918 Ga0495596_0037491
919 Ga0495606_0012434
920 Ga0495606_0012702
921 Ga0495606_0013933
922 Ga0495608_0041099
923 Ga0495610_0002064
924 Ga0495620_0053869
925 Ga0495628_0037208
926 Ga0495628_0057173
927 Ga0495628_0160510
928 Ga0495628_0264639
929 Ga0495630_0008445
930 Ga0495631_0080811
931 Ga0495643_0130923
932 Ga0495666_0005713
933 Ga0495642_0045310
934 Ga0495642_0066975
935 Ga0495652_0012402
936 Ga0495652_0097119
937 Ga0495665_0035137
938 Ga0495665_0097399
939 Ga0495640_0054639
940 Ga0495586_0046564
941 Ga0495621_0001060
942 Ga0495621_0092959
943 Ga0495597_0107347
944 Ga0495622_0039090
945 Ga0495667_0120201
946 Ga0495668_0135325
947 Ga0495634_0016007
948 Ga0495635_0014181
949 Ga0495635_0067155
950 Ga0495635_0499510
951 Ga0495588_0152624
952 Ga0495657_0042521
953 Ga0495623_0010886
954 Ga0495646_0008207
955 Ga0495646_0070875
956 Ga0495669_0031092
957 Ga0495613_0122706
958 Ga0495624_0026337
959 Ga0495671_0055001
960 Ga0495649_0049480
961 Ga0495649_0054377
962 Ga0495649_0095142
963 Ga0495649_0289597
964 Ga0495589_0006136
965 Ga0495589_0148657
966 Ga0495600_0071757
967 Ga0495600_0238219
968 Ga0495581_0003276
969 Ga0495604_0821000
970 Ga0495674_0045193
971 Ga0495674_0077394
972 Ga0495674_0159070
973 Ga0495672_0018782
974 Ga0495672_0025657
975 Ga0495672_0250731
976 Ga0495680_0002302
977 Ga0495680_0018900
978 Ga0495683_0008442
979 Ga0495683_0020350
980 Ga0495683_0040197
981 Ga0495687_000053
982 Ga0495687_013231
983 Ga0495687_014777
984 Ga0495687_082974
985 Ga0495675_0118910
986 Ga0495675_0200222
987 Ga0495679_019418
988 Ga0495685_114577
989 Ga0495673_0004942
990 Ga0495686_0000519
991 Ga0495593_0001073
992 Ga0495593_0058962
993 Ga0495614_0000394
994 Ga0495626_0027833
995 Ga0496100_0051349
996 Ga0496100_0073174
997 Ga0496100_0475555
998 Ga0496101_0041404
999 Ga0496101_0121926
1000 Ga0496102_0019578
1001 Ga0496102_0021631
1002 Ga0496102_0022182
1003 Ga0496102_0184399
1004 Ga0496103_0044831
1005 Ga0496103_0080956
1006 Ga0496103_0308921
1007 Ga0496104_0006859
1008 Ga0496104_0071060
1009 Ga0496104_0147271
1010 Ga0496104_0164683
1011 Ga0496105_0021948
1012 Ga0496105_0100945
1013 Ga0496105_0113599
1014 Ga0496105_0162607
1015 Ga0496106_0005601
1016 Ga0496106_0010079
1017 Ga0496106_0096360
1018 Ga0496106_0723584
1019 Ga0496107_0018086
1020 Ga0496107_0037776
1021 Ga0496108_0023455
1022 Ga0496110_0159185
1023 Ga0496110_0861552
1024 Ga0496111_0622369
1025 Ga0496112_0021662
1026 Ga0496112_0686200
1027 Ga0496114_0109376
1028 Ga0496115_0061709
1029 Ga0496115_0440748
1030 Ga0496116_0188134
1031 Ga0496116_0190855
1032 Ga0496117_0005096
1033 Ga0496117_0033695
1034 Ga0496117_0049094
1035 Ga0496117_0102980
1036 Ga0496118_0002738
1037 Ga0496118_0009248
1038 Ga0496118_0028658
1039 Ga0496118_0102162
1040 Ga0496118_0235976
1041 Ga0496119_0054052
1042 Ga0496119_0080480
1043 Ga0496119_0219065
1044 Ga0496121_0003102
1045 Ga0496121_0028785
1046 Ga0496121_0036653
1047 Ga0496121_0071196
1048 Ga0496122_0095549
1049 Ga0496123_0010042
1050 Ga0496123_0036711
1051 Ga0496123_0056115
1052 Ga0496124_0061443
1053 Ga0496125_0026123
1054 Ga0496125_0439180
1055 Ga0496126_0000118
1056 Ga0496126_0195437
1057 Ga0495678_047755
1058 Ga0495682_0013009
1059 Ga0501039_1258505
1060 Ga0501079_0778626
1061 Ga0501280_001070
1062 nmdc:mga0n895_529811_c1
1063 nmdc:mga0rr50_464926_c1
1064 nmdc:mga0rr50_672165_c1
1065 nmdc:mga08x19_361868_c1
1066 Ga0466962_0000108
1067 Ga0466962_0006095
1068 Ga0466962_0024285
1069 Ga0466962_0074750
1070 2600814238
1071 2501410117
1072 2509128046
1073 2513959548
1074 2514046884
1075 2516018483
1076 2519457306
1077 2527078487
1078 2563055493
1079 2585292152
1080 2599738753
1081 2599747635
1082 2600209519
1083 2676745578
1084 2713478862
1085 2735816432
1086 2738823078
1087 2738835285
1088 2738876764
1089 2739188773
1090 2739223425
1091 2792839285
1092 2808971335
1093 2809006281
1094 2809013302
1095 2817259507
1096 2817277176
1097 2817454090
1098 2819634707
1099 2863425395
1100 2870069634
1101 2883096109
1102 2904488138
1103 2904570141
1104 2904577327
1105 2904617508
1106 2919531101
1107 2921647154
1108 2928163726
1109 2928170523
1110 2928175844
1111 2928541484
1112 2945934833
1113 2981995765
1114 2990704590
1115 642425149
1116 642416465
1117 642594842
1118 8018848097
1119 8020810297
1120 8020939181
1121 8020948529
1122 8020956239
1123 8021127040
1124 8039101479
1125 8040169603
1126 8040174636
1127 8055270781
1128 8055305583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

32

223

0.94

PF13847

Methyltransf_31

Methyltransferase domain

82

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8961 12 226
3g89-assembly2.cif.gz_B t. thermophilus 16s rrna g527 methyltransferase in complex with adomet and amp in space group p61 0.8859 12 226
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8846 13 226
3g8a-assembly6.cif.gz_F t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 0.8818 12 226
3g8a-assembly3.cif.gz_C t. thermophilus 16s rrna g527 methyltransferase in complex with adohcy in space group p61 0.8787 12 225
ID Description Score Start End Superfamily
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9247 29 226 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9149 52 145 3.40.50.150
3g8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8968 12 226 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8846 13 226 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8719 13 226 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2W4LXI0-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.976 14 224 GO:0005829
GO:0070043
AF-A0A536SIX0-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9754 14 226 GO:0005829
GO:0070043
AF-A0A7Y3CXY2-F1-model_v4 deleted 0.9703 12 224
AF-A0A2E0EW97-F1-model_v4 deleted 0.9685 11 225
AF-A0A0R2WEQ7-F1-model_v4 deleted 0.968 23 224

Map