F464127

General Info

Members Datasets Scaffolds Average Seq Length
564 451 307 260

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1001904|JGI25162J39368_10019043
Length 264
Sequence MLFGKTIVVTGVASGIGARTAELAGQLGADVIGIDVREPSQGIASFIKGDISSAAGVADIVRQLPHRIDALANVAGLSGSTGIAATLAVNFYGLRALSQAVAPHLREGGAIVNVASIAGYGWRANLERAKTLTAIEGFPDVAAVAAVAAEHGLKNEEGYPLSKELLLLWTMQAAHQPLFRDHGIRVNAISPGPVETPILKQFRAVLGDERVDSDITRVGRAGTSADIAPAILFLCSDGARWVSGANFPVDGGLEASINADVLGF

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
18 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
25 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
26 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
27 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
28 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
34 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
35 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
36 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
37 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
38 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
39 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
40 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
41 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
42 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
43 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
44 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
45 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
46 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
47 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
48 2718217927 Rhizobium sp. N324 Isolate Nodule
49 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
50 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
51 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
52 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
53 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
54 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
55 2718218423 Rhizobium sp. N941 Isolate Nodule
56 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
57 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
58 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
59 2721755809 Rhizobium sp. N541 Isolate Nodule
60 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
61 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
62 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
63 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
64 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
65 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
66 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
67 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
68 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
69 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
70 2791355256 Rhizobium sp. M10 Isolate Nodule
71 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
72 2791355261 Rhizobium sp. J15 Isolate Nodule
73 2791355262 Rhizobium sp. M1 Isolate Nodule
74 2791355263 Rhizobium chutanense C5 Isolate Nodule
75 2791355266 Rhizobium sp. L43 Isolate Nodule
76 2791355267 Rhizobium sp. L18 Isolate Nodule
77 2802429633 Rhizobium anhuiense J3 Isolate Nodule
78 2802429634 Rhizobium anhuiense S10 Isolate Nodule
79 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
80 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
81 2802429637 Rhizobium anhuiense C15 Isolate Nodule
82 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
83 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
84 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
85 2838048938 Rhizobium pisi 27/80 Isolate Nodule
86 2838061910 Rhizobium phaseoli L15 Isolate Nodule
87 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
88 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
89 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
90 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
91 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
92 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
93 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
94 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
95 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
96 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
97 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
98 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
99 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
100 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
101 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
102 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
103 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
104 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
105 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
106 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
107 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
108 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
109 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
110 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
111 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
112 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
113 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
114 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
115 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
116 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
117 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
118 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
119 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
120 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
121 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
122 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
123 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
124 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
125 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
126 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
127 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
128 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
129 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
130 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
131 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
132 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
133 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
134 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
135 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
136 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
137 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
138 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
139 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
140 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
141 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
142 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
143 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
144 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
145 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
146 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
147 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
148 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
149 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
150 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
151 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
152 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
153 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
154 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
155 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
156 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
157 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
158 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
159 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
160 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
161 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
162 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
163 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
164 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
165 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
166 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
167 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
168 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
169 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
170 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
171 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
172 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
173 2933599457 Rhizobium phaseoli M3 Isolate Nodule
174 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
175 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
176 2936381700 Rhizobium chutanense C16 Isolate Unclassified
177 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
178 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
179 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
180 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
181 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
182 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
183 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
184 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
185 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
186 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
187 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
188 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
189 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
190 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
191 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
192 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
193 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
194 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
195 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
196 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
197 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
198 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
199 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
200 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
201 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
202 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
203 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
204 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
205 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
206 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
207 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
208 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
209 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
210 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
211 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
212 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
213 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
214 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
215 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
216 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
217 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
218 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
219 3004167301 Mesorhizobium loti 582 Isolate Unclassified
220 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
221 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
222 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
223 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
224 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
225 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
226 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
227 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
228 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
229 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
230 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
231 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
232 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
233 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
234 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
235 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
236 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
237 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
238 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
239 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
240 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
241 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
242 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
243 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
244 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
245 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
246 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
247 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
248 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
249 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
250 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
251 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
252 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
253 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
254 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
255 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
256 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
257 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
261 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
262 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
263 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
264 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
265 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
266 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
267 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
268 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
269 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
270 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
271 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
272 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
273 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
275 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
276 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
277 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
278 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
281 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
288 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
308 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
309 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
310 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
311 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
312 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
313 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
314 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
315 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
316 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
317 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
318 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
319 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
320 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
324 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
331 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
332 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
333 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
334 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
335 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
336 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
337 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
338 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
349 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
350 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
362 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
363 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
364 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
367 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
384 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
399 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
400 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
404 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
410 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
415 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
416 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
417 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
418 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
419 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
420 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
421 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
422 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
423 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
424 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
425 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
426 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
427 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
428 8005258706 Rhizobium sp. R693 Isolate Nodule
429 8005275841 Rhizobium sp. N4311 Isolate Nodule
430 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
431 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
432 8005382845 Rhizobium sp. R634 Isolate Nodule
433 8005395548 Rhizobium sp. R339 Isolate Nodule
434 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
435 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
436 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
437 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
438 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
439 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
440 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
441 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
442 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
443 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
444 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
445 8018176218 Rhizobium sp. N122 Isolate Nodule
446 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
447 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
448 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
449 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
450 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
451 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.26
Metatranscriptomes 0.18
Isolates 45.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 37.06
Rhizoplane 1.77
Rhizosphere 29.43
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000017 3300002704 Bacteria 159274
2 JGI25156J39149_1000034 3300002705 Bacteria 114036
3 JGI25156J39149_1004396 3300002705 Bacteria 4301
4 JGI25162J39368_1001904 3300002737 Bacteria 9569
5 JGI25154J39366_1000034 3300002738 Bacteria 176764
6 JGI25157J39369_1000092 3300002741 Bacteria 76674
7 JGI25157J39369_1000841 3300002741 Bacteria 15215
8 JGI25151J46595_10001182 3300003187 Bacteria 18788
9 JGI25165J46597_1000015 3300003214 Bacteria 380891
10 JGI25165J46597_1000248 3300003214 Bacteria 73257
11 JGI25165J46597_1013003 3300003214 Bacteria 1154
12 JGI25153J46596_10035443 3300003215 Bacteria 1616
13 rootH1_10053831 3300003323 Bacteria 17119
14 JGI25160J50197_1009726 3300003354 Bacteria 3538
15 JGI25161J50226_1002387 3300003374 Bacteria 4835
16 Ga0055529_1004769 3300003763 Bacteria 2034
17 Ga0055526_1001352 3300003771 Bacteria 17533
18 Ga0055526_1014982 3300003771 Bacteria 3144
19 Ga0055526_1017019 3300003771 Bacteria 2805
20 Ga0055524_1001137 3300003775 Bacteria 16010
21 Ga0055528_1000195 3300003790 Bacteria 51738
22 Ga0055528_1000293 3300003790 Bacteria 42514
23 Ga0055528_1022750 3300003790 Bacteria 1940
24 Ga0055528_1037793 3300003790 Bacteria 1129
25 Ga0055540_1000095 3300003792 Bacteria 97555
26 Ga0055543_1000579 3300004625 Bacteria 20192
27 Ga0065165_1040569 3300005262 Bacteria 1387
28 Ga0070660_100006878 3300005339 Bacteria 7887
29 Ga0070663_100133225 3300005455 Bacteria 1889
30 Ga0070681_10359478 3300005458 Bacteria 1366
31 Ga0070665_100029227 3300005548 Bacteria 5548
32 Ga0068855_100131558 3300005563 Bacteria 2857
33 Ga0068855_100138459 3300005563 Bacteria 2776
34 Ga0068856_100576499 3300005614 Bacteria 1146
35 Ga0068852_100161239 3300005616 Bacteria 2094
36 Ga0075365_10021173 3300006038 Bacteria 4051
37 Ga0075365_10097668 3300006038 Bacteria 2008
38 Ga0075365_10125072 3300006038 Bacteria 1776
39 Ga0075365_10154082 3300006038 Bacteria 1599
40 Ga0075363_100221542 3300006048 Bacteria 1084
41 Ga0075363_100295169 3300006048 Bacteria 940
42 Ga0075362_10030407 3300006177 Bacteria 2332
43 Ga0075362_10130264 3300006177 Bacteria 1196
44 Ga0075367_10021559 3300006178 Bacteria 3602
45 Ga0075367_10061899 3300006178 Bacteria 2234
46 Ga0075367_10134939 3300006178 Bacteria 1527
47 Ga0075369_10039437 3300006186 Bacteria 2017
48 Ga0075369_10069376 3300006186 Bacteria 1550
49 Ga0075369_10077440 3300006186 Bacteria 1471
50 Ga0075366_10029949 3300006195 Bacteria 3198
51 Ga0075366_10047294 3300006195 Bacteria 2550
52 Ga0075370_10039505 3300006353 Bacteria 2659
53 Ga0075370_10055060 3300006353 Bacteria 2260
54 Ga0105240_10000012 3300009093 Bacteria 496639
55 Ga0105240_10133399 3300009093 Bacteria 2976
56 Ga0105240_10188709 3300009093 Bacteria 2425
57 Ga0105240_10262196 3300009093 Bacteria 1993
58 Ga0105240_10398778 3300009093 Bacteria 1550
59 Ga0105245_10362655 3300009098 Bacteria 1438
60 Ga0105245_10831827 3300009098 Bacteria 962
61 Ga0105241_10023515 3300009174 Bacteria 4570
62 Ga0105237_10000054 3300009545 Bacteria 155063
63 Ga0105237_10094186 3300009545 Bacteria 2984
64 Ga0105238_10059833 3300009551 Bacteria 3815
65 Ga0105238_10898005 3300009551 Bacteria 904
66 Ga0123341_1000082 3300009765 Bacteria 40371
67 Ga0105239_10019669 3300010375 Bacteria 7453
68 Ga0105239_10021081 3300010375 Bacteria 7191
69 Ga0105239_10131063 3300010375 Bacteria 2789
70 Ga0105239_10173542 3300010375 Bacteria 2411
71 Ga0157370_10000078 3300013104 Bacteria 107381
72 Ga0157369_10160205 3300013105 Bacteria 2375
73 Ga0157369_10343524 3300013105 Bacteria 1550
74 Ga0182008_10022455 3300014497 Bacteria 3232
75 Ga0182007_10000467 3300015262 Bacteria 24434
76 Ga0182005_1001411 3300015265 Bacteria 9741
77 Ga0213876_10018319 3300021384 Bacteria 3698
78 Ga0228598_1024823 3300024227 Bacteria 1179
79 Ga0209435_100023 3300025206 Bacteria 201972
80 Ga0209563_106137 3300025230 Bacteria 2093
81 Ga0209437_100040 3300025233 Bacteria 448096
82 Ga0207425_1002531 3300025245 Bacteria 6383
83 Ga0209646_1000080 3300025246 Bacteria 201975
84 Ga0209026_1000025 3300025250 Bacteria 352548
85 Ga0209026_1000076 3300025250 Bacteria 201975
86 Ga0209677_100158 3300025253 Bacteria 61587
87 Ga0209148_1000057 3300025254 Bacteria 360463
88 Ga0209759_1000059 3300025256 Bacteria 201975
89 Ga0209759_1000197 3300025256 Bacteria 95422
90 Ga0209129_1001934 3300025258 Bacteria 10858
91 Ga0209233_1000010 3300025261 Bacteria 1194329
92 Ga0209233_1000051 3300025261 Bacteria 447617
93 Ga0209233_1000161 3300025261 Bacteria 158607
94 Ga0209233_1012006 3300025261 Bacteria 2527
95 Ga0209455_1000131 3300025272 Bacteria 160715
96 Ga0209673_1000255 3300025273 Bacteria 100723
97 Ga0209673_1000799 3300025273 Bacteria 41728
98 Ga0209673_1001248 3300025273 Bacteria 26407
99 Ga0209673_1039737 3300025273 Bacteria 1354
100 Ga0209025_1001451 3300025294 Bacteria 31106
101 Ga0209025_1012049 3300025294 Bacteria 5601
102 Ga0209564_1000215 3300025295 Bacteria 132838
103 Ga0209564_1000571 3300025295 Bacteria 58425
104 Ga0209564_1017563 3300025295 Bacteria 2780
105 Ga0209758_1000440 3300025297 Bacteria 69850
106 Ga0209758_1019676 3300025297 Bacteria 3241
107 Ga0209758_1034129 3300025297 Bacteria 2030
108 Ga0209050_1006206 3300025298 Bacteria 7171
109 Ga0209256_1000155 3300025299 Bacteria 144379
110 Ga0209256_1000520 3300025299 Bacteria 56308
111 Ga0209256_1028461 3300025299 Bacteria 1575
112 Ga0207426_1000556 3300025302 Bacteria 51341
113 Ga0209051_1000027 3300025303 Bacteria 412172
114 Ga0209051_1001550 3300025303 Bacteria 19043
115 Ga0207647_10060757 3300025904 Bacteria 2309
116 Ga0207705_10001844 3300025909 Bacteria 16658
117 Ga0207705_10099944 3300025909 Bacteria 2133
118 Ga0207654_10179105 3300025911 Bacteria 1382
119 Ga0207707_10105841 3300025912 Bacteria 2459
120 Ga0207695_10000097 3300025913 Bacteria 262517
121 Ga0207695_10052304 3300025913 Bacteria 4280
122 Ga0207695_10084830 3300025913 Bacteria 3197
123 Ga0207695_10170441 3300025913 Bacteria 2102
124 Ga0207671_10000023 3300025914 Bacteria 274756
125 Ga0207657_10017407 3300025919 Bacteria 6891
126 Ga0207694_10051918 3300025924 Bacteria 3178
127 Ga0207709_10091259 3300025935 Bacteria 1991
128 Ga0207691_10564314 3300025940 Bacteria 965
129 Ga0207667_10013667 3300025949 Bacteria 9279
130 Ga0207667_10119337 3300025949 Bacteria 2718
131 Ga0207678_10030102 3300026067 Bacteria 4740
132 Ga0207702_10475344 3300026078 Bacteria 1216
133 Ga0207702_10596233 3300026078 Bacteria 1084
134 Ga0207702_10764551 3300026078 Bacteria 954
135 Ga0207698_10144402 3300026142 Bacteria 2055
136 Ga0268266_10089382 3300028379 Bacteria 2697
137 Ga0268266_10132159 3300028379 Bacteria 2233
138 Ga0265318_10026475 3300028577 Bacteria 2283
139 Ga0265330_10079288 3300031235 Bacteria 1416
140 Ga0265325_10002923 3300031241 Bacteria 11381
141 Ga0265325_10030527 3300031241 Bacteria 2889
142 Ga0265325_10084419 3300031241 Bacteria 1574
143 Ga0265325_10149905 3300031241 Bacteria 1104
144 Ga0265329_10024826 3300031242 Bacteria 1987
145 Ga0265329_10064427 3300031242 Bacteria 1160
146 Ga0265340_10105251 3300031247 Bacteria 1308
147 Ga0265339_10009987 3300031249 Bacteria 5923
148 Ga0265339_10023797 3300031249 Bacteria 3538
149 Ga0265339_10027702 3300031249 Bacteria 3229
150 Ga0265339_10141320 3300031249 Bacteria 1224
151 Ga0265331_10075060 3300031250 Bacteria 1577
152 Ga0265316_10025051 3300031344 Bacteria 4984
153 Ga0265316_10308159 3300031344 Bacteria 1152
154 Ga0307513_10093869 3300031456 Bacteria 3048
155 Ga0265313_10031162 3300031595 Bacteria 2736
156 Ga0265313_10052042 3300031595 Bacteria 1957
157 Ga0265313_10053938 3300031595 Bacteria 1911
158 Ga0265314_10012378 3300031711 Bacteria 6965
159 Ga0265314_10099963 3300031711 Bacteria 1867
160 Ga0265314_10108213 3300031711 Bacteria 1772
161 Ga0265314_10143588 3300031711 Bacteria 1473
162 Ga0265342_10011936 3300031712 Bacteria 5908
163 Ga0265342_10014599 3300031712 Bacteria 5210
164 Ga0265342_10118358 3300031712 Bacteria 1493
165 Ga0307409_100139886 3300031995 Bacteria 2084
166 Ga0307510_10308079 3300033180 Bacteria 1043
167 Ga0373935_0439893 3300035692 Bacteria 941
168 Ga0373927_0000326 3300035695 Bacteria 37493
169 Ga0372808_004764 3300036459 Bacteria 1752
170 Ga0373925_0003284 3300037068 Bacteria 12576
171 Ga0395900_0481097 3300037418 Bacteria 1194
172 Ga0395905_0007034 3300037471 Bacteria 11244
173 Ga0395905_0008344 3300037471 Bacteria 10218
174 Ga0395905_0319440 3300037471 Bacteria 1442
175 Ga0395905_0629385 3300037471 Bacteria 975
176 Ga0395901_0014030 3300038443 Bacteria 8154
177 Ga0395901_0239858 3300038443 Bacteria 1891
178 Ga0436365_0174155 3300039437 Bacteria 5922
179 Ga0436361_0599682 3300039447 Bacteria 1493
180 Ga0451835_1186635 3300041492 Bacteria 1519
181 Ga0451837_1058106 3300041494 Bacteria 1592
182 Ga0451839_0551580 3300041496 Bacteria 909
183 Ga0451845_0893095 3300041501 Bacteria 1519
184 Ga0451847_0485079 3300041503 Bacteria 1493
185 Ga0451849_0226360 3300041505 Bacteria 1413
186 Ga0451849_0557144 3300041505 Bacteria 896
187 Ga0451843_0992941 3300041509 Bacteria 1167
188 Ga0451855_1138494 3300041511 Bacteria 1065
189 Ga0451855_2054512 3300041511 Bacteria 3082
190 Ga0495592_0265897 3300046454 Bacteria 1127
191 Ga0495638_0003314 3300046460 Bacteria 12707
192 Ga0495638_0014548 3300046460 Bacteria 5312
193 Ga0495651_0059033 3300046462 Bacteria 2943
194 Ga0495650_0018213 3300046471 Bacteria 3496
195 Ga0495605_0058317 3300046474 Bacteria 1856
196 Ga0495662_0017955 3300046476 Bacteria 3423
197 Ga0495606_0002718 3300046507 Bacteria 19948
198 Ga0495606_0116838 3300046507 Bacteria 1601
199 Ga0495606_0188243 3300046507 Bacteria 1185
200 Ga0495610_0001800 3300046512 Bacteria 18666
201 Ga0495618_0055869 3300046514 Bacteria 2500
202 Ga0495620_0000910 3300046515 Bacteria 18178
203 Ga0495632_0038251 3300046519 Bacteria 2430
204 Ga0495632_0085059 3300046519 Bacteria 1505
205 Ga0495637_0094898 3300046520 Bacteria 1172
206 Ga0495643_0001649 3300046522 Bacteria 19641
207 Ga0495652_0249372 3300046529 Bacteria 1316
208 Ga0495654_0140684 3300046530 Bacteria 1076
209 Ga0495597_0032476 3300046542 Bacteria 2369
210 Ga0495622_0033236 3300046557 Bacteria 2408
211 Ga0495668_0026193 3300046616 Bacteria 3310
212 Ga0495668_0051486 3300046616 Bacteria 2280
213 Ga0495625_0006422 3300046660 Bacteria 10470
214 Ga0495625_0009678 3300046660 Bacteria 8029
215 Ga0495625_0023411 3300046660 Bacteria 4718
216 Ga0495657_0033770 3300046675 Bacteria 3559
217 Ga0495599_0221362 3300046678 Bacteria 1158
218 Ga0495670_0006115 3300046691 Bacteria 5906
219 Ga0495649_0228486 3300046694 Bacteria 961
220 Ga0495600_0016406 3300046809 Bacteria 4701
221 Ga0495600_0234558 3300046809 Bacteria 1170
222 Ga0495660_0003181 3300046810 Bacteria 10218
223 Ga0495604_0065631 3300047317 Bacteria 2762
224 Ga0495687_050296 3300047443 Bacteria 1777
225 Ga0495687_053964 3300047443 Bacteria 1690
226 Ga0495686_0002269 3300047472 Bacteria 18532
227 Ga0495686_0017070 3300047472 Bacteria 4901
228 Ga0495615_0018706 3300048090 Bacteria 1529
229 Ga0495626_0033341 3300048091 Bacteria 2469
230 Ga0496100_0000977 3300048903 Bacteria 13737
231 Ga0496101_0011521 3300048904 Bacteria 5871
232 Ga0496101_0042305 3300048904 Bacteria 3252
233 Ga0496103_0005345 3300048906 Bacteria 7697
234 Ga0496105_0269206 3300048908 Bacteria 1376
235 Ga0496110_0098688 3300048913 Bacteria 2618
236 Ga0496112_0032929 3300048915 Bacteria 5034
237 Ga0496113_0002340 3300048916 Bacteria 10963
238 Ga0496115_0567039 3300048918 Bacteria 906
239 Ga0496116_0014046 3300048919 Bacteria 6414
240 Ga0496117_0002025 3300048920 Bacteria 26845
241 Ga0496117_0006347 3300048920 Bacteria 12009
242 Ga0496118_0003588 3300048921 Bacteria 19306
243 Ga0496119_0007199 3300048922 Bacteria 10076
244 Ga0496119_0032489 3300048922 Bacteria 3477
245 Ga0496119_0034051 3300048922 Bacteria 3364
246 Ga0496120_0001339 3300048923 Bacteria 30369
247 Ga0496120_0001658 3300048923 Bacteria 25728
248 Ga0496120_0054659 3300048923 Bacteria 2261
249 Ga0496121_0002053 3300048924 Bacteria 31873
250 Ga0496121_0092967 3300048924 Bacteria 2350
251 Ga0496122_0005791 3300048925 Bacteria 14545
252 Ga0496122_0158119 3300048925 Bacteria 1387
253 Ga0496123_0003464 3300048926 Bacteria 17648
254 Ga0496124_0010484 3300048927 Bacteria 9377
255 Ga0496124_0119744 3300048927 Bacteria 2105
256 Ga0496125_0007198 3300048928 Bacteria 11861
257 Ga0496126_0006466 3300048929 Bacteria 13056
258 Ga0496126_0036962 3300048929 Bacteria 4562
259 Ga0496126_0090750 3300048929 Bacteria 2688
260 Ga0496126_0123503 3300048929 Bacteria 2243
261 Ga0501034_0058877 3300049571 Bacteria 3859
262 Ga0501034_0363331 3300049571 Bacteria 1374
263 Ga0501034_0574095 3300049571 Bacteria 1035
264 Ga0501037_0327163 3300049573 Bacteria 1060
265 Ga0501043_0118005 3300049579 Bacteria 2082
266 Ga0501047_0361552 3300049581 Bacteria 1287
267 Ga0501068_0041511 3300049584 Bacteria 2765
268 Ga0501070_0092354 3300049586 Bacteria 2505
269 Ga0501070_0105795 3300049586 Bacteria 2326
270 Ga0501073_0119650 3300049589 Bacteria 1825
271 Ga0501080_0207081 3300049742 Bacteria 1798
272 Ga0501035_0091637 3300049822 Bacteria 2675
273 Ga0501044_0464593 3300049823 Bacteria 1170
274 nmdc:mga03683_66953_c1 3300050489 Bacteria 1528
275 nmdc:mga0yw44_12738_c1 3300050492 Bacteria 4396
276 nmdc:mga0yw44_134703_c1 3300050492 Bacteria 1602
277 nmdc:mga0yw44_167637_c1 3300050492 Bacteria 1441
278 nmdc:mga0yw44_31176_c1 3300050492 Bacteria 3097
279 nmdc:mga0k408_24929_c1 3300050493 Bacteria 3384
280 nmdc:mga06z11_11680_c1 3300050494 Bacteria 3794
281 nmdc:mga06z11_148999_c1 3300050494 Bacteria 1329
282 nmdc:mga06z11_36247_c1 3300050494 Bacteria 2434
283 nmdc:mga07m45_13901_c1 3300050496 Bacteria 4278
284 nmdc:mga0sz30_1086_c2 3300050516 Bacteria 7326
285 nmdc:mga0sz30_117079_c1 3300050516 Bacteria 1170
286 nmdc:mga0sz30_67682_c1 3300050516 Bacteria 1534
287 Ga0495601_0268635 3300053077 Bacteria 1113
288 Ga0500610_0048797 3300053079 Bacteria 2201
289 Ga0495619_0057678 3300053085 Bacteria 2577
290 Ga0500578_0020310 3300053086 Bacteria 4269
291 Ga0500569_000094 3300053109 Bacteria 13764
292 Ga0500595_033824 3300053119 Bacteria 1694
293 Ga0500608_019990 3300053122 Bacteria 3076
294 Ga0500618_003242 3300053125 Bacteria 5662
295 Ga0500658_0000080 3300053134 Bacteria 44662
296 Ga0500559_0002401 3300053136 Bacteria 9723
297 Ga0500573_0322363 3300053140 Bacteria 762
298 Ga0500590_049586 3300053148 Bacteria 2136
299 Ga0500616_0023887 3300053153 Bacteria 3401
300 Ga0500616_0077699 3300053153 Bacteria 1676
301 Ga0500620_000018 3300053155 Bacteria 33396
302 Ga0500622_0003223 3300053156 Bacteria 11096
303 Ga0500627_0120060 3300053158 Bacteria 1185
304 Ga0500636_0096625 3300053177 Bacteria 1685
305 Ga0500636_0189511 3300053177 Bacteria 1097
306 Ga0500611_004654 3300053727 Bacteria 1866
307 Ga0500596_005464 3300053735 Bacteria 2233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0249372 Ga0495652_0249372_22_681 219
2 3300053140 Ga0500573_0322363 Ga0500573_0322363_74_733 219
3 3300046809 Ga0495600_0234558 Ga0495600_0234558_11_718 235
4 3300006048 Ga0075363_100221542 Ga0075363_1002215421 249
5 3300025940 Ga0207691_10564314 Ga0207691_105643142 249
6 3300031241 Ga0265325_10084419 Ga0265325_100844192 252
7 3300031241 Ga0265325_10149905 Ga0265325_101499052 253
8 3300031249 Ga0265339_10027702 Ga0265339_100277022 253
9 3300031711 Ga0265314_10108213 Ga0265314_101082131 253
10 3300031712 Ga0265342_10118358 Ga0265342_101183582 253
11 3300031241 Ga0265325_10030527 Ga0265325_100305272 254
12 iso_pu_bacteria 8024486573 8024489268 256
13 iso_pu_bacteria 2509276021 2509391348 257
14 iso_pu_bacteria 2509276033 2509445490 257
15 iso_pu_bacteria 2510065019 2510136038 257
16 iso_pu_bacteria 2510461076 2510892289 257
17 iso_pu_bacteria 2510917022 2511131831 257
18 iso_pu_bacteria 2513237084 2513568335 257
19 iso_pu_bacteria 2513237085 2513581299 257
20 iso_pu_bacteria 2513237088 2513597757 257
21 iso_pu_bacteria 2513237093 2513630797 257
22 iso_pu_bacteria 2513237103 2513713780 257
23 iso_pu_bacteria 2513237162 2514021087 257
24 iso_pu_bacteria 2515075009 2515109054 257
25 iso_pu_bacteria 2515154113 2515632204 257
26 iso_pu_bacteria 2515154114 2515643546 257
27 iso_pu_bacteria 2515154116 2515658351 257
28 iso_pu_bacteria 2515154134 2515744384 257
29 iso_pu_bacteria 2516653085 2517080592 257
30 iso_pu_bacteria 2517093000 2517097947 257
31 iso_pu_bacteria 2517287029 2517410050 257
32 iso_pu_bacteria 2582581306 2585267288 257
33 iso_pu_bacteria 2582581308 2585278122 257
34 iso_pu_bacteria 2582581316 2585332773 257
35 iso_pu_bacteria 2582581865 2585386357 257
36 iso_pu_bacteria 2582581866 2585393365 257
37 iso_pu_bacteria 2582581867 2585403997 257
38 iso_pu_bacteria 2585427527 2585532218 257
39 iso_pu_bacteria 2585427528 2585541768 257
40 iso_pu_bacteria 2585427530 2585552578 257
41 iso_pu_bacteria 2585427531 2585564424 257
42 iso_pu_bacteria 2585427590 2585824810 257
43 iso_pu_bacteria 2585427593 2585840014 257
44 iso_pu_bacteria 2585427609 2585903114 257
45 iso_pu_bacteria 2585428125 2587978545 257
46 iso_pu_bacteria 2615840626 2616307640 257
47 iso_pu_bacteria 2615840698 2616555138 257
48 iso_pu_bacteria 2617270742 2617380796 257
49 iso_pu_bacteria 2693429783 2694630955 257
50 iso_pu_bacteria 2693429784 2694636547 257
51 iso_pu_bacteria 2718217927 2719389606 257
52 iso_pu_bacteria 2718217997 2719669205 257
53 iso_pu_bacteria 2718218199 2720489899 257
54 iso_pu_bacteria 2718218232 2720610563 257
55 iso_pu_bacteria 2718218233 2720618133 257
56 iso_pu_bacteria 2718218235 2720629144 257
57 iso_pu_bacteria 2718218269 2720773224 257
58 iso_pu_bacteria 2718218423 2721402374 257
59 iso_pu_bacteria 2721755556 2723030634 257
60 iso_pu_bacteria 2721755684 2723565051 257
61 iso_pu_bacteria 2721755685 2723570351 257
62 iso_pu_bacteria 2721755809 2724036208 257
63 iso_pu_bacteria 2721755819 2724093253 257
64 iso_pu_bacteria 2721755822 2724101898 257
65 iso_pu_bacteria 2721755823 2724113570 257
66 iso_pu_bacteria 2724679232 2725948749 257
67 iso_pu_bacteria 2728369352 2730111167 257
68 iso_pu_bacteria 2738541333 2739036387 257
69 iso_pu_bacteria 2765235942 2766069180 257
70 iso_pu_bacteria 2775507266 2778173509 257
71 iso_pu_bacteria 2791355256 2793297207 257
72 iso_pu_bacteria 2791355259 2793317437 257
73 iso_pu_bacteria 2791355261 2793327928 257
74 iso_pu_bacteria 2791355262 2793337897 257
75 iso_pu_bacteria 2791355263 2793342489 257
76 iso_pu_bacteria 2791355266 2793362787 257
77 iso_pu_bacteria 2791355267 2793371039 257
78 iso_pu_bacteria 2802429633 2806046493 257
79 iso_pu_bacteria 2802429634 2806052973 257
80 iso_pu_bacteria 2802429635 2806059820 257
81 iso_pu_bacteria 2802429636 2806068441 257
82 iso_pu_bacteria 2802429637 2806074865 257
83 iso_pu_bacteria 2818991453 2819640463 257
84 iso_pu_bacteria 2838016132 2838016594 257
85 iso_pu_bacteria 2838042994 2838048138 257
86 iso_pu_bacteria 2838048938 2838049967 257
87 iso_pu_bacteria 2838061910 2838064377 257
88 iso_pu_bacteria 2838068647 2838069129 257
89 iso_pu_bacteria 2838680041 2838684818 257
90 iso_pu_bacteria 2838686498 2838693904 257
91 iso_pu_bacteria 2838694306 2838698979 257
92 iso_pu_bacteria 2838707686 2838712141 257
93 iso_pu_bacteria 2838729681 2838733247 257
94 iso_pu_bacteria 2838742623 2838749356 257
95 iso_pu_bacteria 2841851746 2841858600 257
96 iso_pu_bacteria 2841864319 2841868564 257
97 iso_pu_bacteria 2842110456 2842111473 257
98 iso_pu_bacteria 2842118031 2842122540 257
99 iso_pu_bacteria 2842156927 2842163406 257
100 iso_pu_bacteria 2842163707 2842164505 257
101 iso_pu_bacteria 2842180545 2842187083 257
102 iso_pu_bacteria 2842229732 2842236673 257
103 iso_pu_bacteria 2842237096 2842241553 257
104 iso_pu_bacteria 2842243621 2842250357 257
105 iso_pu_bacteria 2842257432 2842264255 257
106 iso_pu_bacteria 2842264693 2842265468 257
107 iso_pu_bacteria 2842271015 2842278397 257
108 iso_pu_bacteria 2842291075 2842295937 257
109 iso_pu_bacteria 2842304105 2842307274 257
110 iso_pu_bacteria 2842311132 2842313619 257
111 iso_pu_bacteria 2842341865 2842342511 257
112 iso_pu_bacteria 2842363717 2842365715 257
113 iso_pu_bacteria 2842370503 2842374182 257
114 iso_pu_bacteria 2842377471 2842382341 257
115 iso_pu_bacteria 2842384541 2842389088 257
116 iso_pu_bacteria 2842395702 2842400433 257
117 iso_pu_bacteria 2842422224 2842422319 257
118 iso_pu_bacteria 2842428310 2842428481 257
119 iso_pu_bacteria 2842434925 2842435095 257
120 iso_pu_bacteria 2842441272 2842442042 257
121 iso_pu_bacteria 2842447887 2842447911 257
122 iso_pu_bacteria 2842462802 2842462907 257
123 iso_pu_bacteria 2842469257 2842469427 257
124 iso_pu_bacteria 2842482326 2842486282 257
125 iso_pu_bacteria 2844454524 2844460053 257
126 iso_pu_bacteria 2856349417 2856355913 257
127 iso_pu_bacteria 2856356410 2856362167 257
128 iso_pu_bacteria 2857516855 2857518294 257
129 iso_pu_bacteria 2871488783 2871494644 257
130 iso_pu_bacteria 2878753008 2878758774 257
131 iso_pu_bacteria 2881155292 2881161701 257
132 iso_pu_bacteria 2881845957 2881846165 257
133 iso_pu_bacteria 2881853255 2881859237 257
134 iso_pu_bacteria 2881861095 2881863286 257
135 iso_pu_bacteria 2882912400 2882916164 257
136 iso_pu_bacteria 2885318864 2885319387 257
137 iso_pu_bacteria 2885342637 2885350472 257
138 iso_pu_bacteria 2885350715 2885356739 257
139 iso_pu_bacteria 2888337043 2888342068 257
140 iso_pu_bacteria 2903492973 2903503987 257
141 iso_pu_bacteria 2924784321 2924788976 257
142 iso_pu_bacteria 2933570622 2933574070 257
143 iso_pu_bacteria 2933599457 2933599794 257
144 iso_pu_bacteria 2935894831 2935898897 257
145 iso_pu_bacteria 2935901341 2935906034 257
146 iso_pu_bacteria 2936381700 2936383244 257
147 iso_pu_bacteria 2937822353 2937824341 257
148 iso_pu_bacteria 2961170736 2961176148 257
149 iso_pu_bacteria 2967996073 2968002035 257
150 iso_pu_bacteria 2968003550 2968008941 257
151 iso_pu_bacteria 2968117919 2968119841 257
152 iso_pu_bacteria 2970503327 2970508814 257
153 iso_pu_bacteria 2977821940 2977827314 257
154 iso_pu_bacteria 2977828996 2977836784 257
155 iso_pu_bacteria 2979808191 2979811538 257
156 iso_pu_bacteria 8004374579 8004380295 257
157 iso_pu_bacteria 8005258706 8005259800 257
158 iso_pu_bacteria 8005258706 8005260466 257
159 iso_pu_bacteria 8005275841 8005277951 257
160 iso_pu_bacteria 8005282627 8005285039 257
161 iso_pu_bacteria 8005307578 8005308376 257
162 iso_pu_bacteria 8005382845 8005383047 257
163 iso_pu_bacteria 8005395548 8005398648 257
164 iso_pu_bacteria 8005430974 8005433589 257
165 iso_pu_bacteria 8005460587 8005467456 257
166 iso_pu_bacteria 8005497431 8005502402 257
167 iso_pu_bacteria 8005556819 8005563353 257
168 iso_pu_bacteria 8005563573 8005566127 257
169 iso_pu_bacteria 8005570704 8005572498 257
170 iso_pu_bacteria 8005619151 8005624765 257
171 iso_pu_bacteria 8005626139 8005626165 257
172 iso_pu_bacteria 8005668836 8005673830 257
173 iso_pu_bacteria 8005695170 8005701106 257
174 iso_pu_bacteria 8018163183 8018168833 257
175 iso_pu_bacteria 8018176218 8018176503 257
176 iso_pu_bacteria 8023680758 8023681512 257
177 iso_pu_bacteria 8024479707 8024485110 257
178 iso_pu_bacteria 8046767195 8046773367 257
179 iso_pu_bacteria 8056375014 8056379626 257
180 iso_pu_bacteria 8057874678 8057878998 257
181 iso_pu_bacteria 2512875016 2512929278 259
182 iso_pu_bacteria 2512875024 2512964090 259
183 iso_pu_bacteria 2513237164 2514034167 259
184 iso_pu_bacteria 2529292951 2530649171 259
185 iso_pu_bacteria 2588253730 2588514833 259
186 iso_pu_bacteria 2599185301 2599936874 259
187 iso_pu_bacteria 2643221595 2643986306 259
188 iso_pu_bacteria 2643221627 2644152538 259
189 iso_pu_bacteria 2756170246 2756672768 259
190 iso_pu_bacteria 2791355123 2792745801 259
191 iso_pu_bacteria 2844002411 2844005225 259
192 iso_pu_bacteria 2856364286 2856369352 259
193 iso_pu_bacteria 2857349434 2857351266 259
194 iso_pu_bacteria 2869278585 2869284015 259
195 iso_pu_bacteria 2869285874 2869286575 259
196 iso_pu_bacteria 2871429161 2871434728 259
197 iso_pu_bacteria 2871466892 2871473001 259
198 iso_pu_bacteria 2871495908 2871496622 259
199 iso_pu_bacteria 2874139085 2874144633 259
200 iso_pu_bacteria 2874146452 2874149933 259
201 iso_pu_bacteria 2874155637 2874158191 259
202 iso_pu_bacteria 2874168670 2874173918 259
203 iso_pu_bacteria 2876363079 2876367166 259
204 iso_pu_bacteria 2876377896 2876384126 259
205 iso_pu_bacteria 2876413966 2876416395 259
206 iso_pu_bacteria 2878738818 2878743991 259
207 iso_pu_bacteria 2878745973 2878751861 259
208 iso_pu_bacteria 2878760144 2878760849 259
209 iso_pu_bacteria 2878767105 2878767812 259
210 iso_pu_bacteria 2889010040 2889010577 259
211 iso_pu_bacteria 2903448605 2903453366 259
212 iso_pu_bacteria 2903492973 2903504807 259
213 iso_pu_bacteria 2903521522 2903526657 259
214 iso_pu_bacteria 2903528002 2903530724 259
215 iso_pu_bacteria 2903540706 2903541420 259
216 iso_pu_bacteria 2906308376 2906314259 259
217 iso_pu_bacteria 2906321335 2906327425 259
218 iso_pu_bacteria 2906378014 2906378205 259
219 iso_pu_bacteria 2924718760 2924722168 259
220 iso_pu_bacteria 2924762789 2924765007 259
221 iso_pu_bacteria 2924776078 2924781908 259
222 iso_pu_bacteria 2937813078 2937815631 259
223 iso_pu_bacteria 2937848649 2937850314 259
224 iso_pu_bacteria 2937877337 2937884763 259
225 iso_pu_bacteria 2937972304 2937978036 259
226 iso_pu_bacteria 2937994558 2937995276 259
227 iso_pu_bacteria 2938014810 2938018364 259
228 iso_pu_bacteria 2958034702 2958040404 259
229 iso_pu_bacteria 2958041894 2958055252 259
230 iso_pu_bacteria 2958064165 2958068249 259
231 iso_pu_bacteria 2958084443 2958092072 259
232 iso_pu_bacteria 2958130278 2958130978 259
233 iso_pu_bacteria 2958144490 2958148698 259
234 iso_pu_bacteria 2958165035 2958165752 259
235 iso_pu_bacteria 2958179912 2958184899 259
236 iso_pu_bacteria 2961077736 2961083066 259
237 iso_pu_bacteria 2961163497 2961164211 259
238 iso_pu_bacteria 2963644680 2963649959 259
239 iso_pu_bacteria 2965018300 2965019200 259
240 iso_pu_bacteria 2968016561 2968021970 259
241 iso_pu_bacteria 2968083720 2968086730 259
242 iso_pu_bacteria 2968171901 2968172611 259
243 iso_pu_bacteria 2970469710 2970474560 259
244 iso_pu_bacteria 2970554993 2970555704 259
245 iso_pu_bacteria 2970593180 2970598627 259
246 iso_pu_bacteria 2977843712 2977845867 259
247 iso_pu_bacteria 2977942078 2977942639 259
248 iso_pu_bacteria 2977986579 2977991667 259
249 iso_pu_bacteria 2987636660 2987638450 259
250 iso_pu_bacteria 2987652177 2987655168 259
251 iso_pu_bacteria 2987659509 2987660217 259
252 iso_pu_bacteria 2987666974 2987667913 259
253 iso_pu_bacteria 2996348954 2996353969 259
254 iso_pu_bacteria 3000135777 3000141070 259
255 iso_pu_bacteria 3004167301 3004171499 259
256 iso_pu_bacteria 3004188549 3004189266 259
257 iso_pu_bacteria 3004203850 3004205307 259
258 iso_pu_bacteria 3004211236 3004213619 259
259 iso_pu_bacteria 3004218560 3004223210 259
260 iso_pu_bacteria 3004275668 3004280637 259
261 iso_pu_bacteria 3004334049 3004338788 259
262 iso_pu_bacteria 637000159 637079036 259
263 iso_pu_bacteria 8004387939 8004393749 259
264 iso_pu_bacteria 8004640170 8004640949 259
265 iso_pu_bacteria 8004714634 8004720517 259
266 3300002704 JGI25155J39150_1000017 JGI25155J39150_100001712 261
267 3300002705 JGI25156J39149_1000034 JGI25156J39149_100003498 261
268 3300002705 JGI25156J39149_1004396 JGI25156J39149_10043963 261
269 3300002737 JGI25162J39368_1001904 JGI25162J39368_10019043 261
270 3300002738 JGI25154J39366_1000034 JGI25154J39366_1000034158 261
271 3300002741 JGI25157J39369_1000092 JGI25157J39369_100009267 261
272 3300002741 JGI25157J39369_1000841 JGI25157J39369_100084117 261
273 3300003187 JGI25151J46595_10001182 JGI25151J46595_100011825 261
274 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015311 261
275 3300003214 JGI25165J46597_1000248 JGI25165J46597_10002487 261
276 3300003214 JGI25165J46597_1013003 JGI25165J46597_10130032 261
277 3300003215 JGI25153J46596_10035443 JGI25153J46596_100354432 261
278 3300003323 rootH1_10053831 rootH1_100538316 261
279 3300003354 JGI25160J50197_1009726 JGI25160J50197_10097263 261
280 3300003374 JGI25161J50226_1002387 JGI25161J50226_10023875 261
281 3300003763 Ga0055529_1004769 Ga0055529_10047692 261
282 3300003771 Ga0055526_1001352 Ga0055526_100135215 261
283 3300003771 Ga0055526_1014982 Ga0055526_10149824 261
284 3300003771 Ga0055526_1017019 Ga0055526_10170194 261
285 3300003775 Ga0055524_1001137 Ga0055524_10011378 261
286 3300003790 Ga0055528_1000195 Ga0055528_100019544 261
287 3300003790 Ga0055528_1000293 Ga0055528_100029336 261
288 3300003790 Ga0055528_1022750 Ga0055528_10227502 261
289 3300003790 Ga0055528_1037793 Ga0055528_10377932 261
290 3300003792 Ga0055540_1000095 Ga0055540_100009531 261
291 3300004625 Ga0055543_1000579 Ga0055543_100057910 261
292 3300005262 Ga0065165_1040569 Ga0065165_10405691 261
293 3300005339 Ga0070660_100006878 Ga0070660_1000068788 261
294 3300005455 Ga0070663_100133225 Ga0070663_1001332252 261
295 3300005458 Ga0070681_10359478 Ga0070681_103594782 261
296 3300005548 Ga0070665_100029227 Ga0070665_1000292273 261
297 3300005563 Ga0068855_100131558 Ga0068855_1001315583 261
298 3300005563 Ga0068855_100138459 Ga0068855_1001384592 261
299 3300005614 Ga0068856_100576499 Ga0068856_1005764992 261
300 3300005616 Ga0068852_100161239 Ga0068852_1001612392 261
301 3300006038 Ga0075365_10021173 Ga0075365_100211734 261
302 3300006038 Ga0075365_10097668 Ga0075365_100976682 261
303 3300006038 Ga0075365_10125072 Ga0075365_101250722 261
304 3300006038 Ga0075365_10154082 Ga0075365_101540822 261
305 3300006048 Ga0075363_100295169 Ga0075363_1002951692 261
306 3300006177 Ga0075362_10030407 Ga0075362_100304072 261
307 3300006177 Ga0075362_10130264 Ga0075362_101302641 261
308 3300006178 Ga0075367_10021559 Ga0075367_100215593 261
309 3300006178 Ga0075367_10061899 Ga0075367_100618991 261
310 3300006178 Ga0075367_10134939 Ga0075367_101349392 261
311 3300006186 Ga0075369_10039437 Ga0075369_100394372 261
312 3300006186 Ga0075369_10069376 Ga0075369_100693762 261
313 3300006186 Ga0075369_10077440 Ga0075369_100774402 261
314 3300006195 Ga0075366_10029949 Ga0075366_100299491 261
315 3300006195 Ga0075366_10047294 Ga0075366_100472942 261
316 3300006353 Ga0075370_10039505 Ga0075370_100395053 261
317 3300006353 Ga0075370_10055060 Ga0075370_100550602 261
318 3300009093 Ga0105240_10000012 Ga0105240_10000012376 261
319 3300009093 Ga0105240_10133399 Ga0105240_101333993 261
320 3300009093 Ga0105240_10188709 Ga0105240_101887092 261
321 3300009093 Ga0105240_10262196 Ga0105240_102621962 261
322 3300009093 Ga0105240_10398778 Ga0105240_103987781 261
323 3300009098 Ga0105245_10362655 Ga0105245_103626552 261
324 3300009098 Ga0105245_10831827 Ga0105245_108318272 261
325 3300009174 Ga0105241_10023515 Ga0105241_100235152 261
326 3300009545 Ga0105237_10000054 Ga0105237_10000054142 261
327 3300009545 Ga0105237_10094186 Ga0105237_100941863 261
328 3300009551 Ga0105238_10059833 Ga0105238_100598332 261
329 3300009551 Ga0105238_10898005 Ga0105238_108980051 261
330 3300009765 Ga0123341_1000082 Ga0123341_100008233 261
331 3300010375 Ga0105239_10019669 Ga0105239_100196697 261
332 3300010375 Ga0105239_10021081 Ga0105239_100210814 261
333 3300010375 Ga0105239_10131063 Ga0105239_101310632 261
334 3300010375 Ga0105239_10173542 Ga0105239_101735422 261
335 3300013104 Ga0157370_10000078 Ga0157370_1000007811 261
336 3300013105 Ga0157369_10160205 Ga0157369_101602051 261
337 3300013105 Ga0157369_10343524 Ga0157369_103435242 261
338 3300014497 Ga0182008_10022455 Ga0182008_100224552 261
339 3300015262 Ga0182007_10000467 Ga0182007_1000046714 261
340 3300015265 Ga0182005_1001411 Ga0182005_10014113 261
341 3300021384 Ga0213876_10018319 Ga0213876_100183193 261
342 3300024227 Ga0228598_1024823 Ga0228598_10248231 261
343 3300025206 Ga0209435_100023 Ga0209435_100023179 261
344 3300025230 Ga0209563_106137 Ga0209563_1061372 261
345 3300025233 Ga0209437_100040 Ga0209437_10004058 261
346 3300025245 Ga0207425_1002531 Ga0207425_10025317 261
347 3300025246 Ga0209646_1000080 Ga0209646_1000080179 261
348 3300025250 Ga0209026_1000025 Ga0209026_100002519 261
349 3300025250 Ga0209026_1000076 Ga0209026_1000076179 261
350 3300025253 Ga0209677_100158 Ga0209677_10015819 261
351 3300025254 Ga0209148_1000057 Ga0209148_100005743 261
352 3300025256 Ga0209759_1000059 Ga0209759_1000059179 261
353 3300025256 Ga0209759_1000197 Ga0209759_100019714 261
354 3300025258 Ga0209129_1001934 Ga0209129_10019347 261
355 3300025261 Ga0209233_1000010 Ga0209233_1000010408 261
356 3300025261 Ga0209233_1000051 Ga0209233_100005159 261
357 3300025261 Ga0209233_1000161 Ga0209233_100016190 261
358 3300025261 Ga0209233_1012006 Ga0209233_10120062 261
359 3300025272 Ga0209455_1000131 Ga0209455_10001313 261
360 3300025273 Ga0209673_1000255 Ga0209673_100025546 261
361 3300025273 Ga0209673_1000799 Ga0209673_10007995 261
362 3300025273 Ga0209673_1001248 Ga0209673_10012486 261
363 3300025273 Ga0209673_1039737 Ga0209673_10397372 261
364 3300025294 Ga0209025_1001451 Ga0209025_100145114 261
365 3300025294 Ga0209025_1012049 Ga0209025_10120495 261
366 3300025295 Ga0209564_1000215 Ga0209564_100021566 261
367 3300025295 Ga0209564_1000571 Ga0209564_100057136 261
368 3300025295 Ga0209564_1017563 Ga0209564_10175632 261
369 3300025297 Ga0209758_1000440 Ga0209758_100044020 261
370 3300025297 Ga0209758_1019676 Ga0209758_10196761 261
371 3300025297 Ga0209758_1034129 Ga0209758_10341292 261
372 3300025298 Ga0209050_1006206 Ga0209050_10062064 261
373 3300025299 Ga0209256_1000155 Ga0209256_100015550 261
374 3300025299 Ga0209256_1000520 Ga0209256_100052036 261
375 3300025299 Ga0209256_1028461 Ga0209256_10284612 261
376 3300025302 Ga0207426_1000556 Ga0207426_100055610 261
377 3300025303 Ga0209051_1000027 Ga0209051_1000027348 261
378 3300025303 Ga0209051_1001550 Ga0209051_10015508 261
379 3300025904 Ga0207647_10060757 Ga0207647_100607572 261
380 3300025909 Ga0207705_10001844 Ga0207705_100018443 261
381 3300025909 Ga0207705_10099944 Ga0207705_100999442 261
382 3300025911 Ga0207654_10179105 Ga0207654_101791052 261
383 3300025912 Ga0207707_10105841 Ga0207707_101058412 261
384 3300025913 Ga0207695_10000097 Ga0207695_10000097168 261
385 3300025913 Ga0207695_10052304 Ga0207695_100523042 261
386 3300025913 Ga0207695_10084830 Ga0207695_100848303 261
387 3300025913 Ga0207695_10170441 Ga0207695_101704412 261
388 3300025914 Ga0207671_10000023 Ga0207671_10000023250 261
389 3300025919 Ga0207657_10017407 Ga0207657_100174075 261
390 3300025924 Ga0207694_10051918 Ga0207694_100519182 261
391 3300025935 Ga0207709_10091259 Ga0207709_100912592 261
392 3300025949 Ga0207667_10013667 Ga0207667_100136677 261
393 3300025949 Ga0207667_10119337 Ga0207667_101193372 261
394 3300026067 Ga0207678_10030102 Ga0207678_100301023 261
395 3300026078 Ga0207702_10475344 Ga0207702_104753441 261
396 3300026078 Ga0207702_10596233 Ga0207702_105962332 261
397 3300026078 Ga0207702_10764551 Ga0207702_107645512 261
398 3300026142 Ga0207698_10144402 Ga0207698_101444022 261
399 3300028379 Ga0268266_10089382 Ga0268266_100893822 261
400 3300028379 Ga0268266_10132159 Ga0268266_101321592 261
401 3300028577 Ga0265318_10026475 Ga0265318_100264752 261
402 3300031235 Ga0265330_10079288 Ga0265330_100792882 261
403 3300031241 Ga0265325_10002923 Ga0265325_100029232 261
404 3300031242 Ga0265329_10024826 Ga0265329_100248262 261
405 3300031242 Ga0265329_10064427 Ga0265329_100644272 261
406 3300031247 Ga0265340_10105251 Ga0265340_101052512 261
407 3300031249 Ga0265339_10009987 Ga0265339_100099875 261
408 3300031249 Ga0265339_10023797 Ga0265339_100237975 261
409 3300031249 Ga0265339_10141320 Ga0265339_101413201 261
410 3300031250 Ga0265331_10075060 Ga0265331_100750602 261
411 3300031344 Ga0265316_10025051 Ga0265316_100250512 261
412 3300031344 Ga0265316_10308159 Ga0265316_103081591 261
413 3300031456 Ga0307513_10093869 Ga0307513_100938692 261
414 3300031595 Ga0265313_10031162 Ga0265313_100311623 261
415 3300031595 Ga0265313_10052042 Ga0265313_100520422 261
416 3300031595 Ga0265313_10053938 Ga0265313_100539382 261
417 3300031711 Ga0265314_10012378 Ga0265314_100123783 261
418 3300031711 Ga0265314_10099963 Ga0265314_100999632 261
419 3300031711 Ga0265314_10143588 Ga0265314_101435882 261
420 3300031712 Ga0265342_10011936 Ga0265342_100119362 261
421 3300031712 Ga0265342_10014599 Ga0265342_100145996 261
422 3300031995 Ga0307409_100139886 Ga0307409_1001398862 261
423 3300033180 Ga0307510_10308079 Ga0307510_103080791 261
424 3300035692 Ga0373935_0439893 Ga0373935_0439893_47_838 261
425 3300035695 Ga0373927_0000326 Ga0373927_0000326_19705_20490 261
426 3300036459 Ga0372808_004764 Ga0372808_004764_904_1689 261
427 3300037068 Ga0373925_0003284 Ga0373925_0003284_8434_9219 261
428 3300037418 Ga0395900_0481097 Ga0395900_0481097_68_859 261
429 3300037471 Ga0395905_0007034 Ga0395905_0007034_635_1420 261
430 3300037471 Ga0395905_0008344 Ga0395905_0008344_7323_8108 261
431 3300037471 Ga0395905_0319440 Ga0395905_0319440_111_902 261
432 3300037471 Ga0395905_0629385 Ga0395905_0629385_169_960 261
433 3300038443 Ga0395901_0014030 Ga0395901_0014030_1562_2347 261
434 3300038443 Ga0395901_0239858 Ga0395901_0239858_463_1254 261
435 3300039437 Ga0436365_0174155 Ga0436365_0174155_1895_2680 261
436 3300039447 Ga0436361_0599682 Ga0436361_0599682_633_1475 261
437 3300041492 Ga0451835_1186635 Ga0451835_1186635_221_1006 261
438 3300041494 Ga0451837_1058106 Ga0451837_1058106_644_1429 261
439 3300041496 Ga0451839_0551580 Ga0451839_0551580_83_868 261
440 3300041501 Ga0451845_0893095 Ga0451845_0893095_417_1202 261
441 3300041503 Ga0451847_0485079 Ga0451847_0485079_392_1177 261
442 3300041505 Ga0451849_0226360 Ga0451849_0226360_417_1202 261
443 3300041505 Ga0451849_0557144 Ga0451849_0557144_17_802 261
444 3300041509 Ga0451843_0992941 Ga0451843_0992941_33_818 261
445 3300041511 Ga0451855_1138494 Ga0451855_1138494_261_1046 261
446 3300041511 Ga0451855_2054512 Ga0451855_2054512_2277_3062 261
447 3300046454 Ga0495592_0265897 Ga0495592_0265897_252_1037 261
448 3300046460 Ga0495638_0003314 Ga0495638_0003314_4375_5166 261
449 3300046460 Ga0495638_0014548 Ga0495638_0014548_4314_5099 261
450 3300046462 Ga0495651_0059033 Ga0495651_0059033_1921_2712 261
451 3300046471 Ga0495650_0018213 Ga0495650_0018213_814_1599 261
452 3300046474 Ga0495605_0058317 Ga0495605_0058317_311_1096 261
453 3300046476 Ga0495662_0017955 Ga0495662_0017955_1756_2541 261
454 3300046507 Ga0495606_0002718 Ga0495606_0002718_16538_17323 261
455 3300046507 Ga0495606_0116838 Ga0495606_0116838_136_933 261
456 3300046507 Ga0495606_0188243 Ga0495606_0188243_386_1171 261
457 3300046512 Ga0495610_0001800 Ga0495610_0001800_16691_17476 261
458 3300046514 Ga0495618_0055869 Ga0495618_0055869_228_1013 261
459 3300046515 Ga0495620_0000910 Ga0495620_0000910_14502_15287 261
460 3300046519 Ga0495632_0038251 Ga0495632_0038251_195_980 261
461 3300046519 Ga0495632_0085059 Ga0495632_0085059_678_1463 261
462 3300046520 Ga0495637_0094898 Ga0495637_0094898_62_847 261
463 3300046522 Ga0495643_0001649 Ga0495643_0001649_2884_3669 261
464 3300046530 Ga0495654_0140684 Ga0495654_0140684_50_835 261
465 3300046542 Ga0495597_0032476 Ga0495597_0032476_1216_2001 261
466 3300046557 Ga0495622_0033236 Ga0495622_0033236_162_947 261
467 3300046616 Ga0495668_0026193 Ga0495668_0026193_2170_2955 261
468 3300046616 Ga0495668_0051486 Ga0495668_0051486_1272_2063 261
469 3300046660 Ga0495625_0006422 Ga0495625_0006422_3857_4642 261
470 3300046660 Ga0495625_0009678 Ga0495625_0009678_5455_6240 261
471 3300046660 Ga0495625_0023411 Ga0495625_0023411_1710_2495 261
472 3300046675 Ga0495657_0033770 Ga0495657_0033770_2556_3341 261
473 3300046678 Ga0495599_0221362 Ga0495599_0221362_318_1109 261
474 3300046691 Ga0495670_0006115 Ga0495670_0006115_2335_3120 261
475 3300046694 Ga0495649_0228486 Ga0495649_0228486_73_858 261
476 3300046809 Ga0495600_0016406 Ga0495600_0016406_2591_3382 261
477 3300046810 Ga0495660_0003181 Ga0495660_0003181_8523_9308 261
478 3300047317 Ga0495604_0065631 Ga0495604_0065631_582_1367 261
479 3300047443 Ga0495687_050296 Ga0495687_050296_189_974 261
480 3300047443 Ga0495687_053964 Ga0495687_053964_597_1382 261
481 3300047472 Ga0495686_0002269 Ga0495686_0002269_1408_2193 261
482 3300047472 Ga0495686_0017070 Ga0495686_0017070_2989_3780 261
483 3300048090 Ga0495615_0018706 Ga0495615_0018706_382_1167 261
484 3300048091 Ga0495626_0033341 Ga0495626_0033341_581_1366 261
485 3300048903 Ga0496100_0000977 Ga0496100_0000977_3666_4451 261
486 3300048904 Ga0496101_0011521 Ga0496101_0011521_2800_3585 261
487 3300048904 Ga0496101_0042305 Ga0496101_0042305_1216_2001 261
488 3300048906 Ga0496103_0005345 Ga0496103_0005345_5231_6016 261
489 3300048908 Ga0496105_0269206 Ga0496105_0269206_180_965 261
490 3300048913 Ga0496110_0098688 Ga0496110_0098688_1257_2042 261
491 3300048915 Ga0496112_0032929 Ga0496112_0032929_126_917 261
492 3300048916 Ga0496113_0002340 Ga0496113_0002340_6035_6820 261
493 3300048918 Ga0496115_0567039 Ga0496115_0567039_96_887 261
494 3300048919 Ga0496116_0014046 Ga0496116_0014046_3899_4684 261
495 3300048920 Ga0496117_0002025 Ga0496117_0002025_6876_7661 261
496 3300048920 Ga0496117_0006347 Ga0496117_0006347_4348_5133 261
497 3300048921 Ga0496118_0003588 Ga0496118_0003588_366_1151 261
498 3300048922 Ga0496119_0007199 Ga0496119_0007199_6640_7425 261
499 3300048922 Ga0496119_0032489 Ga0496119_0032489_305_1096 261
500 3300048922 Ga0496119_0034051 Ga0496119_0034051_1424_2215 261
501 3300048923 Ga0496120_0001339 Ga0496120_0001339_24790_25575 261
502 3300048923 Ga0496120_0001658 Ga0496120_0001658_3220_4011 261
503 3300048923 Ga0496120_0054659 Ga0496120_0054659_1250_2041 261
504 3300048924 Ga0496121_0002053 Ga0496121_0002053_28437_29222 261
505 3300048924 Ga0496121_0092967 Ga0496121_0092967_300_1085 261
506 3300048925 Ga0496122_0005791 Ga0496122_0005791_10466_11251 261
507 3300048925 Ga0496122_0158119 Ga0496122_0158119_70_855 261
508 3300048926 Ga0496123_0003464 Ga0496123_0003464_2418_3203 261
509 3300048927 Ga0496124_0010484 Ga0496124_0010484_6862_7647 261
510 3300048927 Ga0496124_0119744 Ga0496124_0119744_38_823 261
511 3300048928 Ga0496125_0007198 Ga0496125_0007198_10146_10931 261
512 3300048929 Ga0496126_0006466 Ga0496126_0006466_7614_8399 261
513 3300048929 Ga0496126_0036962 Ga0496126_0036962_3229_4014 261
514 3300048929 Ga0496126_0090750 Ga0496126_0090750_1706_2491 261
515 3300048929 Ga0496126_0123503 Ga0496126_0123503_757_1548 261
516 3300049571 Ga0501034_0058877 Ga0501034_0058877_2493_3284 261
517 3300049571 Ga0501034_0363331 Ga0501034_0363331_125_916 261
518 3300049571 Ga0501034_0574095 Ga0501034_0574095_203_988 261
519 3300049573 Ga0501037_0327163 Ga0501037_0327163_49_840 261
520 3300049579 Ga0501043_0118005 Ga0501043_0118005_848_1633 261
521 3300049581 Ga0501047_0361552 Ga0501047_0361552_96_884 261
522 3300049584 Ga0501068_0041511 Ga0501068_0041511_247_1038 261
523 3300049586 Ga0501070_0092354 Ga0501070_0092354_1111_1896 261
524 3300049586 Ga0501070_0105795 Ga0501070_0105795_517_1308 261
525 3300049589 Ga0501073_0119650 Ga0501073_0119650_243_1028 261
526 3300049742 Ga0501080_0207081 Ga0501080_0207081_996_1787 261
527 3300049822 Ga0501035_0091637 Ga0501035_0091637_416_1201 261
528 3300049823 Ga0501044_0464593 Ga0501044_0464593_255_1040 261
529 3300050489 nmdc:mga03683_66953_c1 nmdc:mga03683_66953_c1_555_1340 261
530 3300050492 nmdc:mga0yw44_12738_c1 nmdc:mga0yw44_12738_c1_2924_3709 261
531 3300050492 nmdc:mga0yw44_134703_c1 nmdc:mga0yw44_134703_c1_145_936 261
532 3300050492 nmdc:mga0yw44_167637_c1 nmdc:mga0yw44_167637_c1_164_949 261
533 3300050492 nmdc:mga0yw44_31176_c1 nmdc:mga0yw44_31176_c1_2236_3027 261
534 3300050493 nmdc:mga0k408_24929_c1 nmdc:mga0k408_24929_c1_2327_3112 261
535 3300050494 nmdc:mga06z11_11680_c1 nmdc:mga06z11_11680_c1_288_1073 261
536 3300050494 nmdc:mga06z11_148999_c1 nmdc:mga06z11_148999_c1_101_892 261
537 3300050494 nmdc:mga06z11_36247_c1 nmdc:mga06z11_36247_c1_1291_2076 261
538 3300050496 nmdc:mga07m45_13901_c1 nmdc:mga07m45_13901_c1_500_1285 261
539 3300050516 nmdc:mga0sz30_1086_c2 nmdc:mga0sz30_1086_c2_3050_3835 261
540 3300050516 nmdc:mga0sz30_117079_c1 nmdc:mga0sz30_117079_c1_127_918 261
541 3300050516 nmdc:mga0sz30_67682_c1 nmdc:mga0sz30_67682_c1_383_1168 261
542 3300053077 Ga0495601_0268635 Ga0495601_0268635_207_992 261
543 3300053079 Ga0500610_0048797 Ga0500610_0048797_106_891 261
544 3300053085 Ga0495619_0057678 Ga0495619_0057678_1166_1951 261
545 3300053086 Ga0500578_0020310 Ga0500578_0020310_626_1411 261
546 3300053109 Ga0500569_000094 Ga0500569_000094_2685_3470 261
547 3300053119 Ga0500595_033824 Ga0500595_033824_415_1200 261
548 3300053122 Ga0500608_019990 Ga0500608_019990_1552_2337 261
549 3300053125 Ga0500618_003242 Ga0500618_003242_471_1256 261
550 3300053134 Ga0500658_0000080 Ga0500658_0000080_4298_5083 261
551 3300053136 Ga0500559_0002401 Ga0500559_0002401_6927_7712 261
552 3300053148 Ga0500590_049586 Ga0500590_049586_1048_1833 261
553 3300053153 Ga0500616_0023887 Ga0500616_0023887_2374_3159 261
554 3300053153 Ga0500616_0077699 Ga0500616_0077699_438_1223 261
555 3300053155 Ga0500620_000018 Ga0500620_000018_30636_31421 261
556 3300053156 Ga0500622_0003223 Ga0500622_0003223_4483_5271 261
557 3300053158 Ga0500627_0120060 Ga0500627_0120060_320_1111 261
558 3300053177 Ga0500636_0096625 Ga0500636_0096625_351_1136 261
559 3300053177 Ga0500636_0189511 Ga0500636_0189511_252_1037 261
560 3300053727 Ga0500611_004654 Ga0500611_004654_46_831 261
561 3300053735 Ga0500596_005464 Ga0500596_005464_157_942 261
562 iso_pu_bacteria 2585427526 2585529935 261
563 iso_pu_bacteria 2933586486 2933588027 261
564 iso_pu_bacteria 639633055 639645247 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

131

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

126

254

0.92

PF00106

adh_short

short chain dehydrogenase

5

127

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

7

136

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pcv-assembly1.cif.gz_A the structure of bdca (yjgi) from e. coli 0.8396 2 245
4pcv-assembly1.cif.gz_A the structure of bdca (yjgi) from e. coli 0.8227 2 245
2dkn-assembly1.cif.gz_A crystal structure of the 3-alpha-hydroxysteroid dehydrogenase from pseudomonas sp. b-0831 complexed with nadh 0.8143 5 256
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.8124 2 252
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8078 2 249
ID Description Score Start End Superfamily
af_Q4D6Y2_461_606_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 2 34 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 2 38 3.40.50.720
6b4oA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9123 5 34 3.50.50.60
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.905 5 36 3.50.50.60
2dknB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8458 5 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527X7A8-F1-model_v4 SDR family oxidoreductase 0.978 1 194 GO:0016491
AF-A0A366F059-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9772 1 261 GO:0016491
AF-A0A527X7A8-F1-model_v4 SDR family oxidoreductase 0.9731 1 194 GO:0016491
AF-A0A531MAI2-F1-model_v4 SDR family oxidoreductase 0.973 74 261 GO:0016491
AF-W4S467-F1-model_v4 3-alpha-hydroxysteroid dehydrogenase (EC 1.1.1.50) 0.9688 2 98 GO:0047042

Feature Viewer

pLDDT pTM Quality
91.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map