F464049

General Info

Members Datasets Scaffolds Average Seq Length
563 240 1126 174

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000248|Ga0157369_1000024852
Length 202
Sequence LSKQSLSICIPQSAIRIADNPNLKGHTMARQPGTYATFDTSEGQIVCRLFEKEAPKTVKNFIDLAEGKRDWQDHVSGKKGPGPLYSGTIFHRVIPNFMIQGGDPSGTGMGGPGYKFEDETKGSPHKFDKAGKLAMANAGPNTNGSQFFITVAATDWLTGNHTIFGEVVEGQDVVDKITKLPRGAQDRPKKDIVLNSVKIEKT

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.84
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10000248 3300013105 Bacteria 74496
2 Ga0058863_11760255 3300004799 Bacteria 832
3 Ga0065715_10023042 3300005293 Bacteria 1880
4 Ga0070658_10052670 3300005327 Bacteria 3301
5 Ga0070658_10213561 3300005327 Bacteria 1630
6 Ga0070683_100041067 3300005329 Bacteria 4254
7 Ga0070683_100044167 3300005329 Bacteria 4109
8 Ga0070683_100124525 3300005329 Bacteria 2436
9 Ga0070683_100142571 3300005329 Bacteria 2270
10 Ga0070683_100664148 3300005329 Bacteria 998
11 Ga0070690_100986583 3300005330 Bacteria 663
12 Ga0070677_10217253 3300005333 Bacteria 932
13 Ga0068869_100003590 3300005334 Bacteria 9518
14 Ga0068869_100223214 3300005334 Bacteria 1494
15 Ga0070666_10313863 3300005335 Bacteria 1117
16 Ga0070680_100128165 3300005336 Bacteria 2121
17 Ga0070680_101208146 3300005336 Bacteria 654
18 Ga0068868_100072804 3300005338 Bacteria 2742
19 Ga0068868_100452295 3300005338 Bacteria 1117
20 Ga0068868_100968659 3300005338 Bacteria 777
21 Ga0070660_100013843 3300005339 Bacteria 5802
22 Ga0070660_100081752 3300005339 Bacteria 2536
23 Ga0070687_100074260 3300005343 Unclassified 1835
24 Ga0070661_100033066 3300005344 Bacteria 3745
25 Ga0070661_100121768 3300005344 Bacteria 1955
26 Ga0070661_100655736 3300005344 Unclassified 852
27 Ga0070671_100134777 3300005355 Bacteria 2082
28 Ga0070673_100462759 3300005364 Bacteria 1142
29 Ga0070659_100211219 3300005366 Bacteria 1599
30 Ga0070659_100637659 3300005366 Unclassified 918
31 Ga0070667_100541729 3300005367 Bacteria 1069
32 Ga0070667_100707334 3300005367 Bacteria 932
33 Ga0070709_10003110 3300005434 Bacteria 8906
34 Ga0070709_10004804 3300005434 Bacteria 7301
35 Ga0070709_10715669 3300005434 Bacteria 780
36 Ga0070714_100001256 3300005435 Bacteria 18317
37 Ga0070714_100012151 3300005435 Bacteria 6860
38 Ga0070714_100051603 3300005435 Bacteria 3507
39 Ga0070714_100053026 3300005435 Bacteria 3460
40 Ga0070714_100136287 3300005435 Bacteria 2199
41 Ga0070714_100264310 3300005435 Unclassified 1594
42 Ga0070714_100395861 3300005435 Bacteria 1305
43 Ga0070714_100707075 3300005435 Bacteria 972
44 Ga0070714_101098546 3300005435 Bacteria 775
45 Ga0070713_100000561 3300005436 Bacteria 23535
46 Ga0070713_100003423 3300005436 Bacteria 10477
47 Ga0070713_100006965 3300005436 Bacteria 7892
48 Ga0070713_100194076 3300005436 Bacteria 1831
49 Ga0070713_100232070 3300005436 Bacteria 1678
50 Ga0070713_100369943 3300005436 Bacteria 1333
51 Ga0070713_100382192 3300005436 Bacteria 1312
52 Ga0070713_100475369 3300005436 Bacteria 1177
53 Ga0070713_101459654 3300005436 Bacteria 664
54 Ga0070710_10092133 3300005437 Bacteria 1789
55 Ga0070710_10155662 3300005437 Bacteria 1413
56 Ga0070710_10171162 3300005437 Bacteria 1353
57 Ga0070710_10320596 3300005437 Bacteria 1017
58 Ga0070711_100015990 3300005439 Bacteria 4756
59 Ga0070711_100050824 3300005439 Bacteria 2844
60 Ga0070711_100274139 3300005439 Bacteria 1332
61 Ga0070708_100023076 3300005445 Bacteria 5284
62 Ga0070708_100118735 3300005445 Bacteria 2437
63 Ga0070708_100217505 3300005445 Bacteria 1791
64 Ga0070708_100341472 3300005445 Bacteria 1411
65 Ga0070708_100586325 3300005445 Bacteria 1051
66 Ga0070663_100264861 3300005455 Bacteria 1364
67 Ga0070678_100336646 3300005456 Bacteria 1293
68 Ga0070681_10009675 3300005458 Bacteria 9483
69 Ga0070681_10034238 3300005458 Bacteria 5101
70 Ga0070681_10519452 3300005458 Bacteria 1104
71 Ga0070685_10631073 3300005466 Unclassified 774
72 Ga0070685_10751522 3300005466 Bacteria 715
73 Ga0070706_100007211 3300005467 Bacteria 10448
74 Ga0070706_100009023 3300005467 Bacteria 9285
75 Ga0070706_100063107 3300005467 Bacteria 3424
76 Ga0070706_100500873 3300005467 Bacteria 1130
77 Ga0070707_100008857 3300005468 Bacteria 9329
78 Ga0070707_100135932 3300005468 Bacteria 2391
79 Ga0070707_100227823 3300005468 Bacteria 1815
80 Ga0070707_100745583 3300005468 Bacteria 943
81 Ga0070698_100004977 3300005471 Bacteria 14557
82 Ga0070698_100118463 3300005471 Bacteria 2609
83 Ga0070699_100001625 3300005518 Bacteria 20496
84 Ga0070699_100063586 3300005518 Bacteria 3200
85 Ga0070699_100281766 3300005518 Bacteria 1489
86 Ga0070699_100748162 3300005518 Bacteria 894
87 Ga0070679_100037623 3300005530 Bacteria 4808
88 Ga0070679_100103655 3300005530 Bacteria 2831
89 Ga0070679_100170881 3300005530 Bacteria 2147
90 Ga0070679_100845831 3300005530 Bacteria 858
91 Ga0070684_100005011 3300005535 Bacteria 10119
92 Ga0070684_100074079 3300005535 Bacteria 3001
93 Ga0070684_100085594 3300005535 Bacteria 2796
94 Ga0070684_100148999 3300005535 Bacteria 2119
95 Ga0070684_100287124 3300005535 Bacteria 1508
96 Ga0070697_100000145 3300005536 Bacteria 57445
97 Ga0070697_100001728 3300005536 Bacteria 16681
98 Ga0070697_100539721 3300005536 Bacteria 1022
99 Ga0068853_100133607 3300005539 Bacteria 2223
100 Ga0068853_100491666 3300005539 Bacteria 1157
101 Ga0070695_100109964 3300005545 Bacteria 1869
102 Ga0070695_100181055 3300005545 Bacteria 1493
103 Ga0070695_100655016 3300005545 Bacteria 829
104 Ga0070695_100705510 3300005545 Bacteria 801
105 Ga0070696_100556965 3300005546 Unclassified 919
106 Ga0070693_100030451 3300005547 Bacteria 2950
107 Ga0070693_100402711 3300005547 Bacteria 949
108 Ga0070704_100821867 3300005549 Bacteria 831
109 Ga0068855_100001957 3300005563 Bacteria 25569
110 Ga0068855_100016701 3300005563 Bacteria 8827
111 Ga0068855_100109727 3300005563 Bacteria 3168
112 Ga0068855_100256147 3300005563 Bacteria 1951
113 Ga0068855_101008255 3300005563 Bacteria 874
114 Ga0068855_101266266 3300005563 Bacteria 764
115 Ga0070664_100056564 3300005564 Bacteria 3333
116 Ga0070664_100282504 3300005564 Bacteria 1497
117 Ga0070664_101772964 3300005564 Bacteria 585
118 Ga0068857_100001479 3300005577 Bacteria 18696
119 Ga0068857_100171493 3300005577 Bacteria 1972
120 Ga0068854_100007558 3300005578 Bacteria 6948
121 Ga0068854_100014538 3300005578 Bacteria 5192
122 Ga0068854_100034605 3300005578 Bacteria 3530
123 Ga0068854_100041415 3300005578 Bacteria 3254
124 Ga0068854_101474524 3300005578 Bacteria 617
125 Ga0068856_100002269 3300005614 Bacteria 19838
126 Ga0068856_100004334 3300005614 Bacteria 14150
127 Ga0068856_100075564 3300005614 Bacteria 3337
128 Ga0068856_100076832 3300005614 Bacteria 3308
129 Ga0068856_100183604 3300005614 Bacteria 2105
130 Ga0068856_100233363 3300005614 Bacteria 1855
131 Ga0068856_100304661 3300005614 Bacteria 1611
132 Ga0068856_100345122 3300005614 Bacteria 1507
133 Ga0068856_100439639 3300005614 Bacteria 1325
134 Ga0070702_100193166 3300005615 Unclassified 1341
135 Ga0068852_100148767 3300005616 Bacteria 2175
136 Ga0068852_100170184 3300005616 Bacteria 2041
137 Ga0068852_100180806 3300005616 Bacteria 1983
138 Ga0068852_100183502 3300005616 Bacteria 1969
139 Ga0068864_100007060 3300005618 Bacteria 9222
140 Ga0068864_100100058 3300005618 Bacteria 2569
141 Ga0068866_10060626 3300005718 Unclassified 1962
142 Ga0068866_10091952 3300005718 Bacteria 1654
143 Ga0068851_10002574 3300005834 Bacteria 7980
144 Ga0068851_10065600 3300005834 Bacteria 1869
145 Ga0068870_10063990 3300005840 Bacteria 1985
146 Ga0068863_100099970 3300005841 Bacteria 2756
147 Ga0068858_100004940 3300005842 Bacteria 13064
148 Ga0068858_100057600 3300005842 Bacteria 3591
149 Ga0068858_100091600 3300005842 Bacteria 2830
150 Ga0068858_100189314 3300005842 Bacteria 1944
151 Ga0068858_100640560 3300005842 Bacteria 1032
152 Ga0068860_100068668 3300005843 Bacteria 3368
153 Ga0068862_100110109 3300005844 Bacteria 2417
154 Ga0070717_10014604 3300006028 Bacteria 6047
155 Ga0070717_10034560 3300006028 Bacteria 4087
156 Ga0070717_10122066 3300006028 Bacteria 2233
157 Ga0070717_10187238 3300006028 Bacteria 1807
158 Ga0070717_10385599 3300006028 Bacteria 1257
159 Ga0070717_10571232 3300006028 Bacteria 1025
160 Ga0070717_11045725 3300006028 Bacteria 744
161 Ga0075364_10639439 3300006051 Bacteria 727
162 Ga0070716_100001403 3300006173 Bacteria 10679
163 Ga0070716_100182815 3300006173 Bacteria 1378
164 Ga0070716_100185412 3300006173 Bacteria 1370
165 Ga0070716_100190027 3300006173 Bacteria 1356
166 Ga0070712_100002903 3300006175 Bacteria 10625
167 Ga0070712_100031245 3300006175 Bacteria 3585
168 Ga0070712_100121046 3300006175 Bacteria 1969
169 Ga0070712_100182307 3300006175 Unclassified 1637
170 Ga0070712_100234831 3300006175 Bacteria 1458
171 Ga0070712_100961830 3300006175 Bacteria 738
172 Ga0070712_101401488 3300006175 Bacteria 610
173 Ga0097621_100011526 3300006237 Bacteria 6514
174 Ga0097621_100020441 3300006237 Bacteria 5102
175 Ga0097621_100053947 3300006237 Bacteria 3277
176 Ga0097621_100208487 3300006237 Bacteria 1699
177 Ga0097621_100339171 3300006237 Bacteria 1334
178 Ga0097621_100402432 3300006237 Bacteria 1226
179 Ga0068871_100000307 3300006358 Bacteria 34112
180 Ga0068871_100000339 3300006358 Bacteria 32397
181 Ga0068871_100379024 3300006358 Bacteria 1256
182 Ga0075428_100032787 3300006844 Bacteria 5736
183 Ga0075430_100360252 3300006846 Bacteria 1201
184 Ga0075431_100220497 3300006847 Bacteria 1935
185 Ga0075434_100200928 3300006871 Bacteria 2013
186 Ga0075434_100318789 3300006871 Bacteria 1575
187 Ga0075434_101182740 3300006871 Bacteria 777
188 Ga0075429_100053455 3300006880 Bacteria 3514
189 Ga0075429_100247864 3300006880 Bacteria 1560
190 Ga0068865_100419410 3300006881 Bacteria 1100
191 Ga0075436_100005040 3300006914 Bacteria 9083
192 Ga0075436_100034148 3300006914 Bacteria 3507
193 Ga0075436_100088630 3300006914 Bacteria 2149
194 Ga0075436_100143793 3300006914 Bacteria 1677
195 Ga0075435_100003987 3300007076 Bacteria 10091
196 Ga0075435_100217413 3300007076 Bacteria 1622
197 Ga0075435_100499857 3300007076 Bacteria 1051
198 Ga0105240_10008591 3300009093 Bacteria 14599
199 Ga0105240_10019287 3300009093 Bacteria 9115
200 Ga0105240_10025122 3300009093 Bacteria 7836
201 Ga0105240_10049516 3300009093 Bacteria 5302
202 Ga0105240_10057142 3300009093 Bacteria 4878
203 Ga0105240_10197102 3300009093 Bacteria 2363
204 Ga0105240_10554107 3300009093 Bacteria 1272
205 Ga0105240_10574038 3300009093 Bacteria 1245
206 Ga0105240_10996832 3300009093 Bacteria 896
207 Ga0111539_10280216 3300009094 Bacteria 1940
208 Ga0111539_11118300 3300009094 Unclassified 915
209 Ga0105245_10002176 3300009098 Bacteria 17754
210 Ga0105245_10082073 3300009098 Unclassified 2948
211 Ga0114129_10055986 3300009147 Bacteria 5526
212 Ga0114129_10518278 3300009147 Bacteria 1555
213 Ga0105241_10000052 3300009174 Bacteria 94908
214 Ga0105241_10043271 3300009174 Bacteria 3411
215 Ga0105241_10045117 3300009174 Bacteria 3343
216 Ga0105241_10121097 3300009174 Bacteria 2107
217 Ga0105241_10328491 3300009174 Bacteria 1321
218 Ga0105241_10425804 3300009174 Bacteria 1169
219 Ga0105242_10011211 3300009176 Bacteria 6888
220 Ga0105242_11095012 3300009176 Bacteria 810
221 Ga0105248_10010903 3300009177 Bacteria 10029
222 Ga0105248_10013443 3300009177 Bacteria 9012
223 Ga0105248_10297618 3300009177 Bacteria 1817
224 Ga0105248_10730083 3300009177 Bacteria 1117
225 Ga0105237_10119543 3300009545 Bacteria 2629
226 Ga0105237_10158463 3300009545 Bacteria 2261
227 Ga0105237_10555077 3300009545 Bacteria 1155
228 Ga0105237_10606168 3300009545 Bacteria 1102
229 Ga0105238_10009357 3300009551 Bacteria 9813
230 Ga0105238_10024062 3300009551 Bacteria 6210
231 Ga0105238_10088247 3300009551 Bacteria 3088
232 Ga0105238_10135659 3300009551 Bacteria 2438
233 Ga0105238_10224053 3300009551 Bacteria 1857
234 Ga0105238_10503203 3300009551 Bacteria 1213
235 Ga0105238_10559157 3300009551 Eukaryota 1149
236 Ga0105249_11328025 3300009553 Bacteria 791
237 Ga0105239_10106363 3300010375 Bacteria 3108
238 Ga0105239_10123172 3300010375 Bacteria 2881
239 Ga0105239_10531590 3300010375 Bacteria 1338
240 Ga0105239_10538097 3300010375 Bacteria 1330
241 Ga0105239_10657279 3300010375 Unclassified 1197
242 Ga0105239_12281567 3300010375 Bacteria 630
243 Ga0105246_10369540 3300011119 Bacteria 1181
244 Ga0157373_10026248 3300013100 Bacteria 4210
245 Ga0157373_10074116 3300013100 Bacteria 2401
246 Ga0157371_10250539 3300013102 Bacteria 1275
247 Ga0157370_10006013 3300013104 Bacteria 13502
248 Ga0157370_10007683 3300013104 Bacteria 11700
249 Ga0157369_10006768 3300013105 Bacteria 13228
250 Ga0157369_10013029 3300013105 Bacteria 9418
251 Ga0157369_10026761 3300013105 Bacteria 6397
252 Ga0157369_10029182 3300013105 Bacteria 6098
253 Ga0157369_10049012 3300013105 Bacteria 4581
254 Ga0157369_10139818 3300013105 Bacteria 2563
255 Ga0157369_10174133 3300013105 Bacteria 2266
256 Ga0157374_10000154 3300013296 Bacteria 63162
257 Ga0157374_10022027 3300013296 Bacteria 5679
258 Ga0157374_10180694 3300013296 Bacteria 2061
259 Ga0157374_10209290 3300013296 Bacteria 1912
260 Ga0157378_10000150 3300013297 Bacteria 65230
261 Ga0157378_10000304 3300013297 Bacteria 47798
262 Ga0163162_10735141 3300013306 Bacteria 1107
263 Ga0163162_11310194 3300013306 Bacteria 823
264 Ga0157372_10000300 3300013307 Bacteria 54975
265 Ga0157372_10000997 3300013307 Bacteria 30906
266 Ga0157372_10009279 3300013307 Bacteria 10463
267 Ga0157372_10017656 3300013307 Bacteria 7657
268 Ga0157372_10019574 3300013307 Bacteria 7296
269 Ga0157372_10024713 3300013307 Bacteria 6530
270 Ga0157372_10032423 3300013307 Bacteria 5729
271 Ga0157372_10033385 3300013307 Bacteria 5652
272 Ga0157372_10119574 3300013307 Bacteria 3024
273 Ga0157372_10170881 3300013307 Bacteria 2515
274 Ga0157372_10309092 3300013307 Bacteria 1840
275 Ga0157372_10339677 3300013307 Bacteria 1749
276 Ga0157372_10686359 3300013307 Bacteria 1192
277 Ga0163163_10118556 3300014325 Bacteria 2679
278 Ga0163163_10165950 3300014325 Bacteria 2254
279 Ga0163163_10208796 3300014325 Bacteria 2001
280 Ga0157380_10007372 3300014326 Bacteria 7809
281 Ga0157380_10221955 3300014326 Bacteria 1691
282 Ga0182008_10070523 3300014497 Bacteria 1719
283 Ga0157377_10478559 3300014745 Bacteria 866
284 Ga0157376_10006505 3300014969 Bacteria 8260
285 Ga0157376_10086957 3300014969 Bacteria 2696
286 Ga0157376_10503378 3300014969 Bacteria 1191
287 Ga0182007_10006014 3300015262 Bacteria 5255
288 Ga0182005_1080866 3300015265 Bacteria 897
289 Ga0197907_10829533 3300020069 Bacteria 894
290 Ga0206350_11567381 3300020080 Bacteria 1179
291 Ga0224712_10095936 3300022467 Bacteria 1250
292 Ga0207656_10032142 3300025321 Bacteria 2178
293 Ga0207656_10183225 3300025321 Bacteria 1006
294 Ga0207692_10080219 3300025898 Bacteria 1743
295 Ga0207692_10141229 3300025898 Bacteria 1370
296 Ga0207692_10145261 3300025898 Bacteria 1353
297 Ga0207642_10001798 3300025899 Bacteria 6631
298 Ga0207642_10323696 3300025899 Bacteria 901
299 Ga0207680_10026904 3300025903 Bacteria 3194
300 Ga0207647_10027128 3300025904 Bacteria 3737
301 Ga0207685_10023264 3300025905 Unclassified 2107
302 Ga0207699_10004141 3300025906 Bacteria 6944
303 Ga0207699_10005666 3300025906 Bacteria 5998
304 Ga0207699_10060875 3300025906 Bacteria 2269
305 Ga0207699_10357543 3300025906 Bacteria 1032
306 Ga0207699_10809648 3300025906 Bacteria 689
307 Ga0207705_10030022 3300025909 Bacteria 3878
308 Ga0207705_10043479 3300025909 Bacteria 3227
309 Ga0207705_10249121 3300025909 Bacteria 1354
310 Ga0207705_10489834 3300025909 Bacteria 954
311 Ga0207684_10002114 3300025910 Bacteria 20371
312 Ga0207684_10085781 3300025910 Bacteria 2681
313 Ga0207684_10185562 3300025910 Bacteria 1793
314 Ga0207654_10000011 3300025911 Bacteria 245470
315 Ga0207654_10047004 3300025911 Bacteria 2464
316 Ga0207654_10311004 3300025911 Bacteria 1074
317 Ga0207654_10345879 3300025911 Bacteria 1023
318 Ga0207654_10771361 3300025911 Unclassified 693
319 Ga0207707_10001986 3300025912 Bacteria 18580
320 Ga0207707_10031615 3300025912 Bacteria 4632
321 Ga0207695_10032249 3300025913 Bacteria 5736
322 Ga0207695_10035120 3300025913 Bacteria 5441
323 Ga0207695_10043270 3300025913 Bacteria 4800
324 Ga0207695_10045564 3300025913 Bacteria 4654
325 Ga0207695_10094055 3300025913 Unclassified 3006
326 Ga0207695_11472545 3300025913 Bacteria 561
327 Ga0207671_10467806 3300025914 Bacteria 1005
328 Ga0207693_10001147 3300025915 Bacteria 23663
329 Ga0207693_10038670 3300025915 Bacteria 3756
330 Ga0207693_10052336 3300025915 Bacteria 3203
331 Ga0207693_10178940 3300025915 Bacteria 1669
332 Ga0207693_10297153 3300025915 Bacteria 1265
333 Ga0207693_10703130 3300025915 Bacteria 783
334 Ga0207663_10015113 3300025916 Bacteria 4251
335 Ga0207663_10170913 3300025916 Bacteria 1544
336 Ga0207663_10398284 3300025916 Bacteria 1052
337 Ga0207660_10369493 3300025917 Bacteria 1152
338 Ga0207662_10118711 3300025918 Unclassified 1657
339 Ga0207662_10131115 3300025918 Unclassified 1580
340 Ga0207657_10000197 3300025919 Bacteria 62537
341 Ga0207657_10013080 3300025919 Bacteria 8156
342 Ga0207649_10588485 3300025920 Unclassified 855
343 Ga0207652_10014706 3300025921 Bacteria 6342
344 Ga0207652_10138644 3300025921 Bacteria 2173
345 Ga0207652_10141593 3300025921 Bacteria 2151
346 Ga0207652_10277105 3300025921 Bacteria 1513
347 Ga0207652_10385502 3300025921 Bacteria 1265
348 Ga0207652_11061878 3300025921 Bacteria 710
349 Ga0207646_10005280 3300025922 Bacteria 13621
350 Ga0207646_10069986 3300025922 Bacteria 3134
351 Ga0207646_10544165 3300025922 Bacteria 1044
352 Ga0207646_10606447 3300025922 Bacteria 982
353 Ga0207646_10647779 3300025922 Bacteria 946
354 Ga0207694_10008091 3300025924 Bacteria 7948
355 Ga0207694_10009653 3300025924 Bacteria 7276
356 Ga0207694_10073436 3300025924 Bacteria 2676
357 Ga0207694_10270238 3300025924 Bacteria 1394
358 Ga0207694_10307972 3300025924 Bacteria 1305
359 Ga0207694_10519720 3300025924 Unclassified 997
360 Ga0207687_10070351 3300025927 Bacteria 2498
361 Ga0207687_10324639 3300025927 Unclassified 1247
362 Ga0207687_10336549 3300025927 Bacteria 1226
363 Ga0207700_10000650 3300025928 Bacteria 20313
364 Ga0207700_10017040 3300025928 Bacteria 4841
365 Ga0207700_10096067 3300025928 Bacteria 2352
366 Ga0207700_10227432 3300025928 Bacteria 1584
367 Ga0207700_10336239 3300025928 Bacteria 1312
368 Ga0207700_10590262 3300025928 Bacteria 988
369 Ga0207700_10874691 3300025928 Bacteria 804
370 Ga0207664_10012965 3300025929 Bacteria 5973
371 Ga0207664_10022896 3300025929 Bacteria 4673
372 Ga0207664_10153315 3300025929 Bacteria 1959
373 Ga0207664_10231318 3300025929 Unclassified 1607
374 Ga0207664_10412994 3300025929 Bacteria 1202
375 Ga0207644_10086418 3300025931 Bacteria 2329
376 Ga0207706_10096751 3300025933 Bacteria 2596
377 Ga0207686_10011425 3300025934 Bacteria 4862
378 Ga0207669_10101701 3300025937 Bacteria 1902
379 Ga0207665_10052713 3300025939 Bacteria 2741
380 Ga0207665_10184792 3300025939 Bacteria 1511
381 Ga0207711_10161154 3300025941 Bacteria 2030
382 Ga0207689_10001515 3300025942 Bacteria 22101
383 Ga0207689_10172961 3300025942 Bacteria 1781
384 Ga0207661_10199265 3300025944 Bacteria 1759
385 Ga0207661_10210480 3300025944 Bacteria 1713
386 Ga0207661_10491536 3300025944 Bacteria 1121
387 Ga0207679_10126953 3300025945 Bacteria 2040
388 Ga0207679_11167425 3300025945 Bacteria 706
389 Ga0207679_11321839 3300025945 Bacteria 661
390 Ga0207667_10000256 3300025949 Bacteria 74992
391 Ga0207667_10000811 3300025949 Bacteria 40517
392 Ga0207667_10019229 3300025949 Bacteria 7635
393 Ga0207667_10021293 3300025949 Bacteria 7186
394 Ga0207667_10681397 3300025949 Bacteria 1031
395 Ga0207667_10803690 3300025949 Bacteria 937
396 Ga0207667_11219837 3300025949 Bacteria 731
397 Ga0207651_10156959 3300025960 Bacteria 1779
398 Ga0207640_10031625 3300025981 Bacteria 3272
399 Ga0207640_10089179 3300025981 Bacteria 2131
400 Ga0207640_10202151 3300025981 Bacteria 1506
401 Ga0207658_10311026 3300025986 Bacteria 1361
402 Ga0207677_10022484 3300026023 Bacteria 3876
403 Ga0207677_10131606 3300026023 Bacteria 1900
404 Ga0207677_10498317 3300026023 Bacteria 1052
405 Ga0207703_10025243 3300026035 Bacteria 4674
406 Ga0207703_10066459 3300026035 Bacteria 2966
407 Ga0207639_10533201 3300026041 Bacteria 1076
408 Ga0207639_10548288 3300026041 Bacteria 1061
409 Ga0207678_10143247 3300026067 Bacteria 2040
410 Ga0207702_10003463 3300026078 Bacteria 14386
411 Ga0207702_10018636 3300026078 Bacteria 5743
412 Ga0207702_10037024 3300026078 Bacteria 4082
413 Ga0207702_10056413 3300026078 Bacteria 3335
414 Ga0207702_10063092 3300026078 Bacteria 3168
415 Ga0207702_10137858 3300026078 Bacteria 2204
416 Ga0207702_10146734 3300026078 Bacteria 2142
417 Ga0207702_10704614 3300026078 Bacteria 995
418 Ga0207702_10811390 3300026078 Bacteria 925
419 Ga0207702_11684322 3300026078 Bacteria 627
420 Ga0207641_10022718 3300026088 Bacteria 5164
421 Ga0207641_10573247 3300026088 Bacteria 1103
422 Ga0207648_10030759 3300026089 Bacteria 4751
423 Ga0207676_10152594 3300026095 Bacteria 1991
424 Ga0207676_10458757 3300026095 Bacteria 1203
425 Ga0207674_10004026 3300026116 Bacteria 17845
426 Ga0207674_10169286 3300026116 Bacteria 2138
427 Ga0207674_10198877 3300026116 Bacteria 1954
428 Ga0207675_100389349 3300026118 Bacteria 1372
429 Ga0207683_10679633 3300026121 Bacteria 954
430 Ga0207698_10024979 3300026142 Bacteria 4200
431 Ga0207698_10058211 3300026142 Bacteria 2994
432 Ga0207698_10129208 3300026142 Bacteria 2156
433 Ga0207698_10427628 3300026142 Bacteria 1272
434 Ga0207428_10000729 3300027907 Bacteria 37940
435 Ga0268265_10126313 3300028380 Bacteria 2117
436 Ga0265338_10010004 3300028800 Bacteria 11213
437 Ga0265332_10026266 3300031238 Bacteria 2554
438 Ga0265328_10027309 3300031239 Bacteria 2140
439 Ga0265340_10025269 3300031247 Bacteria 3010
440 Ga0265339_10006686 3300031249 Bacteria 7537
441 Ga0265339_10058157 3300031249 Bacteria 2089
442 Ga0265339_10183574 3300031249 Bacteria 1040
443 Ga0265316_10004401 3300031344 Bacteria 14029
444 Ga0265316_10023588 3300031344 Bacteria 5167
445 Ga0265316_10063187 3300031344 Bacteria 2872
446 Ga0265316_10335322 3300031344 Bacteria 1097
447 Ga0265316_10457447 3300031344 Bacteria 915
448 Ga0307408_100011185 3300031548 Bacteria 5928
449 Ga0307408_100955320 3300031548 Bacteria 787
450 Ga0265314_10007310 3300031711 Bacteria 9593
451 Ga0265314_10185373 3300031711 Bacteria 1243
452 Ga0307405_10007949 3300031731 Bacteria 5347
453 Ga0307413_10370910 3300031824 Bacteria 1112
454 Ga0307413_10463288 3300031824 Bacteria 1009
455 Ga0307410_10002296 3300031852 Bacteria 9182
456 Ga0307406_10015960 3300031901 Bacteria 4355
457 Ga0307407_10344506 3300031903 Bacteria 1053
458 Ga0307412_10035507 3300031911 Bacteria 3186
459 Ga0307409_100039932 3300031995 Bacteria 3488
460 Ga0307409_100042750 3300031995 Bacteria 3396
461 Ga0307416_100100356 3300032002 Bacteria 2517
462 Ga0307416_100554448 3300032002 Bacteria 1223
463 Ga0307416_101054101 3300032002 Bacteria 917
464 Ga0307414_10042092 3300032004 Bacteria 3101
465 Ga0307411_10009396 3300032005 Bacteria 5137
466 Ga0307415_101305563 3300032126 Bacteria 687
467 Ga0316583_10137355 3300032133 Bacteria 852
468 Ga0373943_0328304 3300035170 Bacteria 873
469 Ga0373924_0209887 3300035410 Bacteria 860
470 Ga0373937_0025926 3300036401 Bacteria 5295
471 Ga0373925_0563606 3300037068 Bacteria 937
472 Ga0436361_0570038 3300039447 Bacteria 627
473 Ga0436362_0161998 3300039453 Bacteria 1185
474 Ga0439443_017840 3300042003 Bacteria 1095
475 Ga0450923_017639 3300042125 Bacteria 1358
476 Ga0439435_0091827 3300042436 Bacteria 923
477 Ga0439444_0003896 3300042437 Bacteria 2136
478 Ga0451577_0000531 3300042876 Bacteria 63238
479 Ga0451577_0053755 3300042876 Bacteria 3595
480 Ga0451577_0108498 3300042876 Bacteria 2482
481 Ga0453683_0116047 3300044673 Bacteria 1684
482 Ga0453683_0153659 3300044673 Bacteria 1455
483 Ga0466963_0045901 3300044694 Bacteria 2879
484 Ga0466963_0147076 3300044694 Bacteria 1635
485 Ga0453684_0000324 3300044712 Bacteria 201431
486 Ga0466971_0070859 3300044719 Bacteria 1583
487 Ga0466959_0130094 3300045049 Bacteria 1784
488 Ga0466959_0371951 3300045049 Bacteria 973
489 Ga0451576_0021212 3300045051 Bacteria 7062
490 Ga0451576_0033685 3300045051 Bacteria 5444
491 Ga0451576_0145465 3300045051 Bacteria 2471
492 Ga0466958_0022113 3300045836 Bacteria 3722
493 Ga0466967_0001591 3300045976 Bacteria 13359
494 Ga0466967_0371021 3300045976 Bacteria 1388
495 Ga0466967_1452953 3300045976 Bacteria 683
496 Ga0495629_0472364 3300046459 Bacteria 848
497 Ga0495580_0006771 3300046472 Bacteria 9291
498 Ga0495594_0266368 3300046499 Bacteria 976
499 Ga0495644_0197969 3300046523 Bacteria 774
500 Ga0495621_0006597 3300046539 Bacteria 3397
501 Ga0495645_0080238 3300046543 Bacteria 2343
502 Ga0495656_0023391 3300046615 Bacteria 2432
503 Ga0495625_0113032 3300046660 Bacteria 1855
504 Ga0495669_0081681 3300046684 Bacteria 1484
505 Ga0495649_0301947 3300046694 Bacteria 815
506 Ga0495674_0182167 3300047319 Bacteria 1749
507 Ga0495615_0059596 3300048090 Bacteria 1004
508 Ga0496100_0163374 3300048903 Bacteria 1598
509 Ga0496101_0169550 3300048904 Bacteria 1677
510 Ga0496102_0083967 3300048905 Bacteria 2939
511 Ga0496104_0244559 3300048907 Bacteria 1707
512 Ga0496104_0421922 3300048907 Bacteria 1246
513 Ga0496105_0147599 3300048908 Bacteria 1934
514 Ga0496106_0305646 3300048909 Bacteria 1276
515 Ga0496108_0092946 3300048911 Bacteria 2565
516 Ga0496109_0445974 3300048912 Bacteria 1222
517 Ga0496110_0556835 3300048913 Unclassified 1042
518 Ga0496110_0643912 3300048913 Bacteria 959
519 Ga0496111_0036656 3300048914 Bacteria 3507
520 Ga0496111_0104626 3300048914 Bacteria 2082
521 Ga0496111_0235764 3300048914 Bacteria 1359
522 Ga0496112_0133583 3300048915 Bacteria 2452
523 Ga0496112_0337931 3300048915 Bacteria 1449
524 Ga0496125_0390023 3300048928 Bacteria 818
525 Ga0496126_0031870 3300048929 Bacteria 4973
526 Ga0501297_005766 3300049520 Bacteria 1304
527 Ga0501031_0153587 3300049568 Bacteria 1505
528 Ga0501036_0318747 3300049572 Bacteria 1299
529 Ga0501040_0120964 3300049576 Bacteria 1837
530 Ga0501042_0222963 3300049578 Bacteria 1360
531 Ga0501069_0251452 3300049585 Bacteria 1031
532 Ga0501069_0593238 3300049585 Bacteria 665
533 Ga0501071_0308313 3300049587 Bacteria 1201
534 Ga0501072_0063136 3300049588 Bacteria 2922
535 Ga0501073_0067071 3300049589 Bacteria 2501
536 Ga0501076_0225963 3300049592 Bacteria 1530
537 Ga0501076_0553402 3300049592 Bacteria 949
538 Ga0501077_0248815 3300049593 Bacteria 1130
539 Ga0501035_0000205 3300049822 Bacteria 72074
540 Ga0501045_0840667 3300049824 Bacteria 675
541 nmdc:mga05p37_190175_c1 3300050507 Bacteria 2493
542 nmdc:mga09592_165494_c1 3300050508 Bacteria 1911
543 nmdc:mga0qj67_62961_c1 3300050509 Bacteria 2948
544 nmdc:mga06r32_1440892_c1 3300050510 Bacteria 630
545 nmdc:mga06r32_207981_c1 3300050510 Bacteria 1945
546 nmdc:mga08y16_10731_c1 3300050511 Bacteria 9613
547 nmdc:mga08y16_196791_c1 3300050511 Bacteria 2089
548 nmdc:mga08y16_196929_c1 3300050511 Bacteria 2088
549 nmdc:mga08y16_202550_c1 3300050511 Bacteria 2057
550 nmdc:mga08y16_458450_c1 3300050511 Bacteria 1299
551 nmdc:mga0n895_14990_c1 3300050512 Bacteria 7060
552 nmdc:mga0n895_367278_c1 3300050512 Bacteria 1457
553 nmdc:mga0n895_469486_c1 3300050512 Bacteria 1269
554 nmdc:mga0rr50_43296_c1 3300050513 Bacteria 3293
555 nmdc:mga08x19_28623_c1 3300050514 Bacteria 3491
556 nmdc:mga08x19_65666_c1 3300050514 Bacteria 2357
557 nmdc:mga08x19_73116_c1 3300050514 Bacteria 2237
558 nmdc:mga08x19_97100_c1 3300050514 Bacteria 1950
559 Ga0495601_0069811 3300053077 Bacteria 2241
560 Ga0500646_0083208 3300053090 Bacteria 980
561 Ga0501084_0066289 3300054114 Bacteria 3021
562 Ga0587073_0126715 3300059492 Bacteria 696
563 Ga0530510_1276429 3300061734 Bacteria 563
564 Ga0157369_10000248
565 Ga0058863_11760255
566 Ga0065715_10023042
567 Ga0070658_10052670
568 Ga0070658_10213561
569 Ga0070683_100041067
570 Ga0070683_100044167
571 Ga0070683_100124525
572 Ga0070683_100142571
573 Ga0070683_100664148
574 Ga0070690_100986583
575 Ga0070677_10217253
576 Ga0068869_100003590
577 Ga0068869_100223214
578 Ga0070666_10313863
579 Ga0070680_100128165
580 Ga0070680_101208146
581 Ga0068868_100072804
582 Ga0068868_100452295
583 Ga0068868_100968659
584 Ga0070660_100013843
585 Ga0070660_100081752
586 Ga0070687_100074260
587 Ga0070661_100033066
588 Ga0070661_100121768
589 Ga0070661_100655736
590 Ga0070671_100134777
591 Ga0070673_100462759
592 Ga0070659_100211219
593 Ga0070659_100637659
594 Ga0070667_100541729
595 Ga0070667_100707334
596 Ga0070709_10003110
597 Ga0070709_10004804
598 Ga0070709_10715669
599 Ga0070714_100001256
600 Ga0070714_100012151
601 Ga0070714_100051603
602 Ga0070714_100053026
603 Ga0070714_100136287
604 Ga0070714_100264310
605 Ga0070714_100395861
606 Ga0070714_100707075
607 Ga0070714_101098546
608 Ga0070713_100000561
609 Ga0070713_100003423
610 Ga0070713_100006965
611 Ga0070713_100194076
612 Ga0070713_100232070
613 Ga0070713_100369943
614 Ga0070713_100382192
615 Ga0070713_100475369
616 Ga0070713_101459654
617 Ga0070710_10092133
618 Ga0070710_10155662
619 Ga0070710_10171162
620 Ga0070710_10320596
621 Ga0070711_100015990
622 Ga0070711_100050824
623 Ga0070711_100274139
624 Ga0070708_100023076
625 Ga0070708_100118735
626 Ga0070708_100217505
627 Ga0070708_100341472
628 Ga0070708_100586325
629 Ga0070663_100264861
630 Ga0070678_100336646
631 Ga0070681_10009675
632 Ga0070681_10034238
633 Ga0070681_10519452
634 Ga0070685_10631073
635 Ga0070685_10751522
636 Ga0070706_100007211
637 Ga0070706_100009023
638 Ga0070706_100063107
639 Ga0070706_100500873
640 Ga0070707_100008857
641 Ga0070707_100135932
642 Ga0070707_100227823
643 Ga0070707_100745583
644 Ga0070698_100004977
645 Ga0070698_100118463
646 Ga0070699_100001625
647 Ga0070699_100063586
648 Ga0070699_100281766
649 Ga0070699_100748162
650 Ga0070679_100037623
651 Ga0070679_100103655
652 Ga0070679_100170881
653 Ga0070679_100845831
654 Ga0070684_100005011
655 Ga0070684_100074079
656 Ga0070684_100085594
657 Ga0070684_100148999
658 Ga0070684_100287124
659 Ga0070697_100000145
660 Ga0070697_100001728
661 Ga0070697_100539721
662 Ga0068853_100133607
663 Ga0068853_100491666
664 Ga0070695_100109964
665 Ga0070695_100181055
666 Ga0070695_100655016
667 Ga0070695_100705510
668 Ga0070696_100556965
669 Ga0070693_100030451
670 Ga0070693_100402711
671 Ga0070704_100821867
672 Ga0068855_100001957
673 Ga0068855_100016701
674 Ga0068855_100109727
675 Ga0068855_100256147
676 Ga0068855_101008255
677 Ga0068855_101266266
678 Ga0070664_100056564
679 Ga0070664_100282504
680 Ga0070664_101772964
681 Ga0068857_100001479
682 Ga0068857_100171493
683 Ga0068854_100007558
684 Ga0068854_100014538
685 Ga0068854_100034605
686 Ga0068854_100041415
687 Ga0068854_101474524
688 Ga0068856_100002269
689 Ga0068856_100004334
690 Ga0068856_100075564
691 Ga0068856_100076832
692 Ga0068856_100183604
693 Ga0068856_100233363
694 Ga0068856_100304661
695 Ga0068856_100345122
696 Ga0068856_100439639
697 Ga0070702_100193166
698 Ga0068852_100148767
699 Ga0068852_100170184
700 Ga0068852_100180806
701 Ga0068852_100183502
702 Ga0068864_100007060
703 Ga0068864_100100058
704 Ga0068866_10060626
705 Ga0068866_10091952
706 Ga0068851_10002574
707 Ga0068851_10065600
708 Ga0068870_10063990
709 Ga0068863_100099970
710 Ga0068858_100004940
711 Ga0068858_100057600
712 Ga0068858_100091600
713 Ga0068858_100189314
714 Ga0068858_100640560
715 Ga0068860_100068668
716 Ga0068862_100110109
717 Ga0070717_10014604
718 Ga0070717_10034560
719 Ga0070717_10122066
720 Ga0070717_10187238
721 Ga0070717_10385599
722 Ga0070717_10571232
723 Ga0070717_11045725
724 Ga0075364_10639439
725 Ga0070716_100001403
726 Ga0070716_100182815
727 Ga0070716_100185412
728 Ga0070716_100190027
729 Ga0070712_100002903
730 Ga0070712_100031245
731 Ga0070712_100121046
732 Ga0070712_100182307
733 Ga0070712_100234831
734 Ga0070712_100961830
735 Ga0070712_101401488
736 Ga0097621_100011526
737 Ga0097621_100020441
738 Ga0097621_100053947
739 Ga0097621_100208487
740 Ga0097621_100339171
741 Ga0097621_100402432
742 Ga0068871_100000307
743 Ga0068871_100000339
744 Ga0068871_100379024
745 Ga0075428_100032787
746 Ga0075430_100360252
747 Ga0075431_100220497
748 Ga0075434_100200928
749 Ga0075434_100318789
750 Ga0075434_101182740
751 Ga0075429_100053455
752 Ga0075429_100247864
753 Ga0068865_100419410
754 Ga0075436_100005040
755 Ga0075436_100034148
756 Ga0075436_100088630
757 Ga0075436_100143793
758 Ga0075435_100003987
759 Ga0075435_100217413
760 Ga0075435_100499857
761 Ga0105240_10008591
762 Ga0105240_10019287
763 Ga0105240_10025122
764 Ga0105240_10049516
765 Ga0105240_10057142
766 Ga0105240_10197102
767 Ga0105240_10554107
768 Ga0105240_10574038
769 Ga0105240_10996832
770 Ga0111539_10280216
771 Ga0111539_11118300
772 Ga0105245_10002176
773 Ga0105245_10082073
774 Ga0114129_10055986
775 Ga0114129_10518278
776 Ga0105241_10000052
777 Ga0105241_10043271
778 Ga0105241_10045117
779 Ga0105241_10121097
780 Ga0105241_10328491
781 Ga0105241_10425804
782 Ga0105242_10011211
783 Ga0105242_11095012
784 Ga0105248_10010903
785 Ga0105248_10013443
786 Ga0105248_10297618
787 Ga0105248_10730083
788 Ga0105237_10119543
789 Ga0105237_10158463
790 Ga0105237_10555077
791 Ga0105237_10606168
792 Ga0105238_10009357
793 Ga0105238_10024062
794 Ga0105238_10088247
795 Ga0105238_10135659
796 Ga0105238_10224053
797 Ga0105238_10503203
798 Ga0105238_10559157
799 Ga0105249_11328025
800 Ga0105239_10106363
801 Ga0105239_10123172
802 Ga0105239_10531590
803 Ga0105239_10538097
804 Ga0105239_10657279
805 Ga0105239_12281567
806 Ga0105246_10369540
807 Ga0157373_10026248
808 Ga0157373_10074116
809 Ga0157371_10250539
810 Ga0157370_10006013
811 Ga0157370_10007683
812 Ga0157369_10006768
813 Ga0157369_10013029
814 Ga0157369_10026761
815 Ga0157369_10029182
816 Ga0157369_10049012
817 Ga0157369_10139818
818 Ga0157369_10174133
819 Ga0157374_10000154
820 Ga0157374_10022027
821 Ga0157374_10180694
822 Ga0157374_10209290
823 Ga0157378_10000150
824 Ga0157378_10000304
825 Ga0163162_10735141
826 Ga0163162_11310194
827 Ga0157372_10000300
828 Ga0157372_10000997
829 Ga0157372_10009279
830 Ga0157372_10017656
831 Ga0157372_10019574
832 Ga0157372_10024713
833 Ga0157372_10032423
834 Ga0157372_10033385
835 Ga0157372_10119574
836 Ga0157372_10170881
837 Ga0157372_10309092
838 Ga0157372_10339677
839 Ga0157372_10686359
840 Ga0163163_10118556
841 Ga0163163_10165950
842 Ga0163163_10208796
843 Ga0157380_10007372
844 Ga0157380_10221955
845 Ga0182008_10070523
846 Ga0157377_10478559
847 Ga0157376_10006505
848 Ga0157376_10086957
849 Ga0157376_10503378
850 Ga0182007_10006014
851 Ga0182005_1080866
852 Ga0197907_10829533
853 Ga0206350_11567381
854 Ga0224712_10095936
855 Ga0207656_10032142
856 Ga0207656_10183225
857 Ga0207692_10080219
858 Ga0207692_10141229
859 Ga0207692_10145261
860 Ga0207642_10001798
861 Ga0207642_10323696
862 Ga0207680_10026904
863 Ga0207647_10027128
864 Ga0207685_10023264
865 Ga0207699_10004141
866 Ga0207699_10005666
867 Ga0207699_10060875
868 Ga0207699_10357543
869 Ga0207699_10809648
870 Ga0207705_10030022
871 Ga0207705_10043479
872 Ga0207705_10249121
873 Ga0207705_10489834
874 Ga0207684_10002114
875 Ga0207684_10085781
876 Ga0207684_10185562
877 Ga0207654_10000011
878 Ga0207654_10047004
879 Ga0207654_10311004
880 Ga0207654_10345879
881 Ga0207654_10771361
882 Ga0207707_10001986
883 Ga0207707_10031615
884 Ga0207695_10032249
885 Ga0207695_10035120
886 Ga0207695_10043270
887 Ga0207695_10045564
888 Ga0207695_10094055
889 Ga0207695_11472545
890 Ga0207671_10467806
891 Ga0207693_10001147
892 Ga0207693_10038670
893 Ga0207693_10052336
894 Ga0207693_10178940
895 Ga0207693_10297153
896 Ga0207693_10703130
897 Ga0207663_10015113
898 Ga0207663_10170913
899 Ga0207663_10398284
900 Ga0207660_10369493
901 Ga0207662_10118711
902 Ga0207662_10131115
903 Ga0207657_10000197
904 Ga0207657_10013080
905 Ga0207649_10588485
906 Ga0207652_10014706
907 Ga0207652_10138644
908 Ga0207652_10141593
909 Ga0207652_10277105
910 Ga0207652_10385502
911 Ga0207652_11061878
912 Ga0207646_10005280
913 Ga0207646_10069986
914 Ga0207646_10544165
915 Ga0207646_10606447
916 Ga0207646_10647779
917 Ga0207694_10008091
918 Ga0207694_10009653
919 Ga0207694_10073436
920 Ga0207694_10270238
921 Ga0207694_10307972
922 Ga0207694_10519720
923 Ga0207687_10070351
924 Ga0207687_10324639
925 Ga0207687_10336549
926 Ga0207700_10000650
927 Ga0207700_10017040
928 Ga0207700_10096067
929 Ga0207700_10227432
930 Ga0207700_10336239
931 Ga0207700_10590262
932 Ga0207700_10874691
933 Ga0207664_10012965
934 Ga0207664_10022896
935 Ga0207664_10153315
936 Ga0207664_10231318
937 Ga0207664_10412994
938 Ga0207644_10086418
939 Ga0207706_10096751
940 Ga0207686_10011425
941 Ga0207669_10101701
942 Ga0207665_10052713
943 Ga0207665_10184792
944 Ga0207711_10161154
945 Ga0207689_10001515
946 Ga0207689_10172961
947 Ga0207661_10199265
948 Ga0207661_10210480
949 Ga0207661_10491536
950 Ga0207679_10126953
951 Ga0207679_11167425
952 Ga0207679_11321839
953 Ga0207667_10000256
954 Ga0207667_10000811
955 Ga0207667_10019229
956 Ga0207667_10021293
957 Ga0207667_10681397
958 Ga0207667_10803690
959 Ga0207667_11219837
960 Ga0207651_10156959
961 Ga0207640_10031625
962 Ga0207640_10089179
963 Ga0207640_10202151
964 Ga0207658_10311026
965 Ga0207677_10022484
966 Ga0207677_10131606
967 Ga0207677_10498317
968 Ga0207703_10025243
969 Ga0207703_10066459
970 Ga0207639_10533201
971 Ga0207639_10548288
972 Ga0207678_10143247
973 Ga0207702_10003463
974 Ga0207702_10018636
975 Ga0207702_10037024
976 Ga0207702_10056413
977 Ga0207702_10063092
978 Ga0207702_10137858
979 Ga0207702_10146734
980 Ga0207702_10704614
981 Ga0207702_10811390
982 Ga0207702_11684322
983 Ga0207641_10022718
984 Ga0207641_10573247
985 Ga0207648_10030759
986 Ga0207676_10152594
987 Ga0207676_10458757
988 Ga0207674_10004026
989 Ga0207674_10169286
990 Ga0207674_10198877
991 Ga0207675_100389349
992 Ga0207683_10679633
993 Ga0207698_10024979
994 Ga0207698_10058211
995 Ga0207698_10129208
996 Ga0207698_10427628
997 Ga0207428_10000729
998 Ga0268265_10126313
999 Ga0265338_10010004
1000 Ga0265332_10026266
1001 Ga0265328_10027309
1002 Ga0265340_10025269
1003 Ga0265339_10006686
1004 Ga0265339_10058157
1005 Ga0265339_10183574
1006 Ga0265316_10004401
1007 Ga0265316_10023588
1008 Ga0265316_10063187
1009 Ga0265316_10335322
1010 Ga0265316_10457447
1011 Ga0307408_100011185
1012 Ga0307408_100955320
1013 Ga0265314_10007310
1014 Ga0265314_10185373
1015 Ga0307405_10007949
1016 Ga0307413_10370910
1017 Ga0307413_10463288
1018 Ga0307410_10002296
1019 Ga0307406_10015960
1020 Ga0307407_10344506
1021 Ga0307412_10035507
1022 Ga0307409_100039932
1023 Ga0307409_100042750
1024 Ga0307416_100100356
1025 Ga0307416_100554448
1026 Ga0307416_101054101
1027 Ga0307414_10042092
1028 Ga0307411_10009396
1029 Ga0307415_101305563
1030 Ga0316583_10137355
1031 Ga0373943_0328304
1032 Ga0373924_0209887
1033 Ga0373937_0025926
1034 Ga0373925_0563606
1035 Ga0436361_0570038
1036 Ga0436362_0161998
1037 Ga0439443_017840
1038 Ga0450923_017639
1039 Ga0439435_0091827
1040 Ga0439444_0003896
1041 Ga0451577_0000531
1042 Ga0451577_0053755
1043 Ga0451577_0108498
1044 Ga0453683_0116047
1045 Ga0453683_0153659
1046 Ga0466963_0045901
1047 Ga0466963_0147076
1048 Ga0453684_0000324
1049 Ga0466971_0070859
1050 Ga0466959_0130094
1051 Ga0466959_0371951
1052 Ga0451576_0021212
1053 Ga0451576_0033685
1054 Ga0451576_0145465
1055 Ga0466958_0022113
1056 Ga0466967_0001591
1057 Ga0466967_0371021
1058 Ga0466967_1452953
1059 Ga0495629_0472364
1060 Ga0495580_0006771
1061 Ga0495594_0266368
1062 Ga0495644_0197969
1063 Ga0495621_0006597
1064 Ga0495645_0080238
1065 Ga0495656_0023391
1066 Ga0495625_0113032
1067 Ga0495669_0081681
1068 Ga0495649_0301947
1069 Ga0495674_0182167
1070 Ga0495615_0059596
1071 Ga0496100_0163374
1072 Ga0496101_0169550
1073 Ga0496102_0083967
1074 Ga0496104_0244559
1075 Ga0496104_0421922
1076 Ga0496105_0147599
1077 Ga0496106_0305646
1078 Ga0496108_0092946
1079 Ga0496109_0445974
1080 Ga0496110_0556835
1081 Ga0496110_0643912
1082 Ga0496111_0036656
1083 Ga0496111_0104626
1084 Ga0496111_0235764
1085 Ga0496112_0133583
1086 Ga0496112_0337931
1087 Ga0496125_0390023
1088 Ga0496126_0031870
1089 Ga0501297_005766
1090 Ga0501031_0153587
1091 Ga0501036_0318747
1092 Ga0501040_0120964
1093 Ga0501042_0222963
1094 Ga0501069_0251452
1095 Ga0501069_0593238
1096 Ga0501071_0308313
1097 Ga0501072_0063136
1098 Ga0501073_0067071
1099 Ga0501076_0225963
1100 Ga0501076_0553402
1101 Ga0501077_0248815
1102 Ga0501035_0000205
1103 Ga0501045_0840667
1104 nmdc:mga05p37_190175_c1
1105 nmdc:mga09592_165494_c1
1106 nmdc:mga0qj67_62961_c1
1107 nmdc:mga06r32_1440892_c1
1108 nmdc:mga06r32_207981_c1
1109 nmdc:mga08y16_10731_c1
1110 nmdc:mga08y16_196791_c1
1111 nmdc:mga08y16_196929_c1
1112 nmdc:mga08y16_202550_c1
1113 nmdc:mga08y16_458450_c1
1114 nmdc:mga0n895_14990_c1
1115 nmdc:mga0n895_367278_c1
1116 nmdc:mga0n895_469486_c1
1117 nmdc:mga0rr50_43296_c1
1118 nmdc:mga08x19_28623_c1
1119 nmdc:mga08x19_65666_c1
1120 nmdc:mga08x19_73116_c1
1121 nmdc:mga08x19_97100_c1
1122 Ga0495601_0069811
1123 Ga0500646_0083208
1124 Ga0501084_0066289
1125 Ga0587073_0126715
1126 Ga0530510_1276429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

35

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w74-assembly2.cif.gz_B x-ray structure of peptidyl-prolyl cis-trans isomerase a, ppia, rv0009, from mycobacterium tuberculosis. 0.9072 13 180
1zkc-assembly2.cif.gz_B crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b 0.9051 11 179
3jb9-assembly1.cif.gz_d cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.9019 13 180
2b71-assembly1.cif.gz_A plasmodium yoelii cyclophilin-like protein 0.8979 14 178
2fu0-assembly1.cif.gz_A plasmodium falciparum cyclophilin pfe0505w putative cyclosporin-binding domain 0.896 14 180
ID Description Score Start End Superfamily
1w74B00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9072 13 180 2.40.100.10
af_Q9FJX0_326_510_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8981 8 180 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8924 9 180 2.40.100.10
1w74B00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8867 13 180 2.40.100.10
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8861 14 180 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A250IPL1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.973 1 183 GO:0140839
GO:0140840
AF-A0A250IPL1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9678 1 183 GO:0140839
GO:0140840
AF-A0A3A8IQQ2-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9673 3 183 GO:0006457
GO:0140839
GO:0140840
AF-A0A4Y6C485-F1-model_v4 deleted 0.9637 1 183
AF-A0A2N2PFY8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9619 13 182 GO:0140839
GO:0140840

Map