F464021
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 563 | 315 | 545 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_101212286|Ga0070678_1012122861 |
| Length | 99 |
| Sequence | MPQRTVVVASRVGLHARPAMLFTQAVATSGIPVTIARPGGEPVDAGSILFVMSLGVPHGEEVTLAADGVGAEGVLDDLVALLATDLDAEDAPASSGGAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 3 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 4 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 5 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 6 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 7 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 8 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 9 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 10 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 11 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 12 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 13 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 14 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 162 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 186 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 187 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 188 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 189 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 190 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 191 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 194 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 283 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 312 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 313 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 314 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 315 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.03 |
| Metatranscriptomes | 1.78 |
| Isolates | 3.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.09 |
| Nodule | 0 |
| Rhizoplane | 14.39 |
| Rhizosphere | 73.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1064211 | 3300002070 | Bacteria | 591 |
| 2 | Ga0007423J48922_101310 | 3300003285 | Bacteria | 1560 |
| 3 | rootH1_10128615 | 3300003316 | Bacteria | 1038 |
| 4 | rootH2_10020571 | 3300003320 | Bacteria | 4790 |
| 5 | rootH2_10197868 | 3300003320 | Bacteria | 1288 |
| 6 | rootL2_10224527 | 3300003322 | Bacteria | 1387 |
| 7 | Ga0006562J51391_1013352 | 3300003578 | Bacteria | 1563 |
| 8 | Ga0070676_10021692 | 3300005328 | Bacteria | 3596 |
| 9 | Ga0070676_10547907 | 3300005328 | Bacteria | 827 |
| 10 | Ga0070670_100459446 | 3300005331 | Bacteria | 1129 |
| 11 | Ga0070670_100697905 | 3300005331 | Bacteria | 912 |
| 12 | Ga0070670_102091382 | 3300005331 | Bacteria | 522 |
| 13 | Ga0070677_10001852 | 3300005333 | Bacteria | 6687 |
| 14 | Ga0070677_10147791 | 3300005333 | Bacteria | 1091 |
| 15 | Ga0070666_10032554 | 3300005335 | Bacteria | 3444 |
| 16 | Ga0070680_101021565 | 3300005336 | Bacteria | 714 |
| 17 | Ga0070682_100748526 | 3300005337 | Unclassified | 789 |
| 18 | Ga0070682_100753093 | 3300005337 | Bacteria | 787 |
| 19 | Ga0070687_101321414 | 3300005343 | Bacteria | 536 |
| 20 | Ga0070668_100031497 | 3300005347 | Bacteria | 4035 |
| 21 | Ga0070668_100727700 | 3300005347 | Bacteria | 877 |
| 22 | Ga0070669_100014380 | 3300005353 | Bacteria | 5632 |
| 23 | Ga0070675_100579618 | 3300005354 | Bacteria | 1016 |
| 24 | Ga0070675_101386288 | 3300005354 | Bacteria | 648 |
| 25 | Ga0070671_100033741 | 3300005355 | Bacteria | 4235 |
| 26 | Ga0070674_100142812 | 3300005356 | Bacteria | 1798 |
| 27 | Ga0070674_100624009 | 3300005356 | Bacteria | 914 |
| 28 | Ga0070674_101097040 | 3300005356 | Bacteria | 703 |
| 29 | Ga0070674_101358603 | 3300005356 | Bacteria | 635 |
| 30 | Ga0070673_100037250 | 3300005364 | Bacteria | 3704 |
| 31 | Ga0070659_100778811 | 3300005366 | Bacteria | 831 |
| 32 | Ga0070667_100285354 | 3300005367 | Bacteria | 1483 |
| 33 | Ga0070709_10631588 | 3300005434 | Bacteria | 827 |
| 34 | Ga0070714_100019901 | 3300005435 | Bacteria | 5476 |
| 35 | Ga0070714_100047254 | 3300005435 | Bacteria | 3656 |
| 36 | Ga0070714_100221296 | 3300005435 | Bacteria | 1740 |
| 37 | Ga0070713_100099763 | 3300005436 | Bacteria | 2513 |
| 38 | Ga0070710_10000488 | 3300005437 | Bacteria | 18637 |
| 39 | Ga0070710_10239328 | 3300005437 | Bacteria | 1162 |
| 40 | Ga0070711_100071802 | 3300005439 | Bacteria | 2441 |
| 41 | Ga0070694_101507830 | 3300005444 | Bacteria | 569 |
| 42 | Ga0070663_100005873 | 3300005455 | Bacteria | 7338 |
| 43 | Ga0070663_100100437 | 3300005455 | Bacteria | 2158 |
| 44 | Ga0070663_100229589 | 3300005455 | Bacteria | 1461 |
| 45 | Ga0070663_101194801 | 3300005455 | Bacteria | 668 |
| 46 | Ga0070678_100057391 | 3300005456 | Bacteria | 2852 |
| 47 | Ga0070678_100093681 | 3300005456 | Bacteria | 2310 |
| 48 | Ga0070678_101212286 | 3300005456 | Bacteria | 700 |
| 49 | Ga0070678_101710889 | 3300005456 | Bacteria | 592 |
| 50 | Ga0070681_12005962 | 3300005458 | Bacteria | 507 |
| 51 | Ga0068867_100795767 | 3300005459 | Bacteria | 843 |
| 52 | Ga0070684_102027669 | 3300005535 | Unclassified | 543 |
| 53 | Ga0070697_100776208 | 3300005536 | Unclassified | 847 |
| 54 | Ga0068853_100106550 | 3300005539 | Bacteria | 2485 |
| 55 | Ga0070672_101088797 | 3300005543 | Bacteria | 710 |
| 56 | Ga0070693_101611554 | 3300005547 | Bacteria | 510 |
| 57 | Ga0070665_100096666 | 3300005548 | Bacteria | 2958 |
| 58 | Ga0070665_100655757 | 3300005548 | Bacteria | 1062 |
| 59 | Ga0070665_100661226 | 3300005548 | Bacteria | 1058 |
| 60 | Ga0070665_101949970 | 3300005548 | Unclassified | 593 |
| 61 | Ga0068855_100014360 | 3300005563 | Bacteria | 9536 |
| 62 | Ga0070664_101096989 | 3300005564 | Bacteria | 749 |
| 63 | Ga0068854_100008723 | 3300005578 | Bacteria | 6526 |
| 64 | Ga0068854_100798859 | 3300005578 | Bacteria | 822 |
| 65 | Ga0068856_100164625 | 3300005614 | Bacteria | 2229 |
| 66 | Ga0068856_100914650 | 3300005614 | Unclassified | 896 |
| 67 | Ga0068856_101962233 | 3300005614 | Bacteria | 596 |
| 68 | Ga0070702_100228459 | 3300005615 | Bacteria | 1249 |
| 69 | Ga0068852_100383398 | 3300005616 | Bacteria | 1379 |
| 70 | Ga0068852_101136672 | 3300005616 | Bacteria | 802 |
| 71 | Ga0068864_100873975 | 3300005618 | Bacteria | 887 |
| 72 | Ga0068864_100956659 | 3300005618 | Archaea | 848 |
| 73 | Ga0068864_101965956 | 3300005618 | Bacteria | 591 |
| 74 | Ga0068851_10074414 | 3300005834 | Bacteria | 1763 |
| 75 | Ga0068851_10741495 | 3300005834 | Bacteria | 607 |
| 76 | Ga0068870_10435544 | 3300005840 | Unclassified | 861 |
| 77 | Ga0068863_102367389 | 3300005841 | Bacteria | 541 |
| 78 | Ga0068858_101470105 | 3300005842 | Bacteria | 672 |
| 79 | Ga0068860_101452639 | 3300005843 | Bacteria | 707 |
| 80 | Ga0081539_10000904 | 3300005985 | Bacteria | 56318 |
| 81 | Ga0075365_10014815 | 3300006038 | Bacteria | 4698 |
| 82 | Ga0075365_10169808 | 3300006038 | Bacteria | 1522 |
| 83 | Ga0075365_10267560 | 3300006038 | Bacteria | 1202 |
| 84 | Ga0075364_10014520 | 3300006051 | Bacteria | 4868 |
| 85 | Ga0075364_10336205 | 3300006051 | Bacteria | 1029 |
| 86 | Ga0075364_10735929 | 3300006051 | Bacteria | 673 |
| 87 | Ga0070712_100214737 | 3300006175 | Bacteria | 1519 |
| 88 | Ga0070712_101461223 | 3300006175 | Bacteria | 597 |
| 89 | Ga0075367_10334963 | 3300006178 | Bacteria | 954 |
| 90 | Ga0075369_10006349 | 3300006186 | Bacteria | 4466 |
| 91 | Ga0097621_100841766 | 3300006237 | Bacteria | 852 |
| 92 | Ga0068871_101535109 | 3300006358 | Bacteria | 630 |
| 93 | Ga0068865_100840650 | 3300006881 | Bacteria | 795 |
| 94 | Ga0105251_10014182 | 3300009011 | Bacteria | 4421 |
| 95 | Ga0105244_10073228 | 3300009036 | Bacteria | 1705 |
| 96 | Ga0105250_10057020 | 3300009092 | Bacteria | 1567 |
| 97 | Ga0105240_10045269 | 3300009093 | Bacteria | 5583 |
| 98 | Ga0105245_10129116 | 3300009098 | Bacteria | 2369 |
| 99 | Ga0105245_10656852 | 3300009098 | Bacteria | 1079 |
| 100 | Ga0105245_10945921 | 3300009098 | Bacteria | 904 |
| 101 | Ga0105245_11492590 | 3300009098 | Bacteria | 727 |
| 102 | Ga0105245_11557889 | 3300009098 | Bacteria | 712 |
| 103 | Ga0105247_10183130 | 3300009101 | Bacteria | 1399 |
| 104 | Ga0105247_10928893 | 3300009101 | Bacteria | 674 |
| 105 | Ga0114129_10358527 | 3300009147 | Bacteria | 1930 |
| 106 | Ga0105243_10175674 | 3300009148 | Bacteria | 1859 |
| 107 | Ga0105243_10695624 | 3300009148 | Bacteria | 990 |
| 108 | Ga0105241_10003908 | 3300009174 | Bacteria | 11040 |
| 109 | Ga0105241_10058352 | 3300009174 | Bacteria | 2964 |
| 110 | Ga0105241_10606872 | 3300009174 | Bacteria | 989 |
| 111 | Ga0105241_11339257 | 3300009174 | Bacteria | 683 |
| 112 | Ga0105242_10075285 | 3300009176 | Bacteria | 2810 |
| 113 | Ga0105242_12211634 | 3300009176 | Bacteria | 595 |
| 114 | Ga0105248_10043912 | 3300009177 | Bacteria | 5013 |
| 115 | Ga0105237_10039832 | 3300009545 | Bacteria | 4741 |
| 116 | Ga0105238_10012997 | 3300009551 | Bacteria | 8404 |
| 117 | Ga0105238_10016585 | 3300009551 | Bacteria | 7458 |
| 118 | Ga0105249_10402529 | 3300009553 | Bacteria | 1399 |
| 119 | Ga0105028_125212 | 3300009993 | Bacteria | 656 |
| 120 | Ga0105239_10033587 | 3300010375 | Bacteria | 5632 |
| 121 | Ga0105239_10651195 | 3300010375 | Bacteria | 1203 |
| 122 | Ga0105239_10785927 | 3300010375 | Bacteria | 1090 |
| 123 | Ga0105239_12061179 | 3300010375 | Bacteria | 663 |
| 124 | Ga0105246_10111711 | 3300011119 | Bacteria | 2009 |
| 125 | Ga0105246_10351352 | 3300011119 | Bacteria | 1208 |
| 126 | Ga0105246_10725211 | 3300011119 | Bacteria | 874 |
| 127 | Ga0105246_10780910 | 3300011119 | Bacteria | 845 |
| 128 | Ga0105246_10782143 | 3300011119 | Bacteria | 845 |
| 129 | Ga0157373_10002429 | 3300013100 | Bacteria | 14177 |
| 130 | Ga0157371_10039986 | 3300013102 | Bacteria | 3351 |
| 131 | Ga0157371_10194729 | 3300013102 | Bacteria | 1452 |
| 132 | Ga0157370_10001553 | 3300013104 | Bacteria | 28453 |
| 133 | Ga0157370_10422079 | 3300013104 | Bacteria | 1227 |
| 134 | Ga0157369_10026122 | 3300013105 | Bacteria | 6479 |
| 135 | Ga0157369_10716938 | 3300013105 | Bacteria | 1030 |
| 136 | Ga0157369_12221445 | 3300013105 | Bacteria | 556 |
| 137 | Ga0157374_11446022 | 3300013296 | Bacteria | 710 |
| 138 | Ga0163162_10152310 | 3300013306 | Bacteria | 2430 |
| 139 | Ga0163162_11139102 | 3300013306 | Bacteria | 884 |
| 140 | Ga0163162_11304463 | 3300013306 | Unclassified | 825 |
| 141 | Ga0163162_11732832 | 3300013306 | Bacteria | 714 |
| 142 | Ga0163162_12313665 | 3300013306 | Bacteria | 617 |
| 143 | Ga0163162_13396826 | 3300013306 | Bacteria | 508 |
| 144 | Ga0157375_10065716 | 3300013308 | Bacteria | 3617 |
| 145 | Ga0157375_10708744 | 3300013308 | Bacteria | 1160 |
| 146 | Ga0157375_10781878 | 3300013308 | Bacteria | 1104 |
| 147 | Ga0157375_11177794 | 3300013308 | Bacteria | 899 |
| 148 | Ga0157375_11526845 | 3300013308 | Bacteria | 789 |
| 149 | Ga0157375_11586277 | 3300013308 | Bacteria | 774 |
| 150 | Ga0163163_10207030 | 3300014325 | Bacteria | 2010 |
| 151 | Ga0163163_10393166 | 3300014325 | Bacteria | 1444 |
| 152 | Ga0163163_10831646 | 3300014325 | Bacteria | 987 |
| 153 | Ga0163163_11434369 | 3300014325 | Bacteria | 752 |
| 154 | Ga0157380_10294065 | 3300014326 | Bacteria | 1493 |
| 155 | Ga0157380_10989620 | 3300014326 | Bacteria | 874 |
| 156 | Ga0157380_12098743 | 3300014326 | Bacteria | 628 |
| 157 | Ga0157380_12284024 | 3300014326 | Bacteria | 605 |
| 158 | Ga0157377_10241650 | 3300014745 | Bacteria | 1166 |
| 159 | Ga0157377_11105324 | 3300014745 | Bacteria | 607 |
| 160 | Ga0157379_10764292 | 3300014968 | Bacteria | 910 |
| 161 | Ga0157376_10598063 | 3300014969 | Bacteria | 1097 |
| 162 | Ga0157376_11278154 | 3300014969 | Bacteria | 763 |
| 163 | Ga0157376_11474479 | 3300014969 | Bacteria | 713 |
| 164 | Ga0157376_11655312 | 3300014969 | Bacteria | 675 |
| 165 | Ga0157376_11842035 | 3300014969 | Bacteria | 642 |
| 166 | Ga0157376_12045770 | 3300014969 | Unclassified | 611 |
| 167 | Ga0163161_11011915 | 3300017792 | Bacteria | 710 |
| 168 | Ga0163161_11708019 | 3300017792 | Bacteria | 558 |
| 169 | Ga0197907_10301419 | 3300020069 | Bacteria | 628 |
| 170 | Ga0197907_10902729 | 3300020069 | Unclassified | 858 |
| 171 | Ga0206349_1667466 | 3300020075 | Bacteria | 830 |
| 172 | Ga0206354_11278698 | 3300020081 | Bacteria | 797 |
| 173 | Ga0206353_10933170 | 3300020082 | Bacteria | 505 |
| 174 | Ga0224712_10004814 | 3300022467 | Bacteria | 3686 |
| 175 | Ga0224712_10065986 | 3300022467 | Bacteria | 1456 |
| 176 | Ga0207697_10000589 | 3300025315 | Bacteria | 20692 |
| 177 | Ga0207655_1010969 | 3300025728 | Bacteria | 5443 |
| 178 | Ga0207655_1160524 | 3300025728 | Bacteria | 703 |
| 179 | Ga0207713_1027753 | 3300025735 | Bacteria | 2566 |
| 180 | Ga0207682_10003529 | 3300025893 | Bacteria | 6767 |
| 181 | Ga0207682_10025021 | 3300025893 | Bacteria | 2366 |
| 182 | Ga0207692_10000267 | 3300025898 | Bacteria | 17819 |
| 183 | Ga0207692_10612402 | 3300025898 | Bacteria | 701 |
| 184 | Ga0207642_10575991 | 3300025899 | Unclassified | 698 |
| 185 | Ga0207710_10738742 | 3300025900 | Bacteria | 517 |
| 186 | Ga0207688_10020257 | 3300025901 | Bacteria | 3631 |
| 187 | Ga0207688_10990015 | 3300025901 | Bacteria | 532 |
| 188 | Ga0207680_10453589 | 3300025903 | Bacteria | 910 |
| 189 | Ga0207680_11003995 | 3300025903 | Bacteria | 598 |
| 190 | Ga0207647_10015074 | 3300025904 | Bacteria | 5312 |
| 191 | Ga0207647_10487922 | 3300025904 | Bacteria | 688 |
| 192 | Ga0207699_10262740 | 3300025906 | Bacteria | 1194 |
| 193 | Ga0207645_10081976 | 3300025907 | Bacteria | 2068 |
| 194 | Ga0207643_10771973 | 3300025908 | Unclassified | 622 |
| 195 | Ga0207654_10014151 | 3300025911 | Bacteria | 4117 |
| 196 | Ga0207654_10826127 | 3300025911 | Bacteria | 670 |
| 197 | Ga0207707_10575648 | 3300025912 | Bacteria | 955 |
| 198 | Ga0207695_10015018 | 3300025913 | Bacteria | 9137 |
| 199 | Ga0207671_10005109 | 3300025914 | Bacteria | 12236 |
| 200 | Ga0207671_11163081 | 3300025914 | Bacteria | 604 |
| 201 | Ga0207693_10149798 | 3300025915 | Bacteria | 1835 |
| 202 | Ga0207663_10168855 | 3300025916 | Bacteria | 1552 |
| 203 | Ga0207660_11080861 | 3300025917 | Bacteria | 654 |
| 204 | Ga0207662_10197649 | 3300025918 | Bacteria | 1300 |
| 205 | Ga0207657_10130366 | 3300025919 | Bacteria | 2061 |
| 206 | Ga0207652_10020785 | 3300025921 | Bacteria | 5410 |
| 207 | Ga0207652_11384217 | 3300025921 | Bacteria | 607 |
| 208 | Ga0207681_10102622 | 3300025923 | Bacteria | 2065 |
| 209 | Ga0207694_10004186 | 3300025924 | Bacteria | 11320 |
| 210 | Ga0207650_10025618 | 3300025925 | Bacteria | 4202 |
| 211 | Ga0207650_10508087 | 3300025925 | Bacteria | 1008 |
| 212 | Ga0207650_10752589 | 3300025925 | Bacteria | 825 |
| 213 | Ga0207659_10390474 | 3300025926 | Bacteria | 1162 |
| 214 | Ga0207687_10440897 | 3300025927 | Bacteria | 1078 |
| 215 | Ga0207687_10905968 | 3300025927 | Bacteria | 755 |
| 216 | Ga0207687_11576946 | 3300025927 | Bacteria | 564 |
| 217 | Ga0207700_10777054 | 3300025928 | Bacteria | 856 |
| 218 | Ga0207664_10021621 | 3300025929 | Bacteria | 4789 |
| 219 | Ga0207664_10562328 | 3300025929 | Bacteria | 1023 |
| 220 | Ga0207644_10016049 | 3300025931 | Bacteria | 5035 |
| 221 | Ga0207690_11644329 | 3300025932 | Bacteria | 537 |
| 222 | Ga0207686_11558112 | 3300025934 | Bacteria | 545 |
| 223 | Ga0207709_10185437 | 3300025935 | Bacteria | 1473 |
| 224 | Ga0207669_10126726 | 3300025937 | Bacteria | 1746 |
| 225 | Ga0207669_10464682 | 3300025937 | Bacteria | 1005 |
| 226 | Ga0207669_11101663 | 3300025937 | Bacteria | 670 |
| 227 | Ga0207669_11401234 | 3300025937 | Bacteria | 595 |
| 228 | Ga0207691_10000237 | 3300025940 | Bacteria | 53889 |
| 229 | Ga0207691_10806495 | 3300025940 | Bacteria | 789 |
| 230 | Ga0207711_10193393 | 3300025941 | Bacteria | 1854 |
| 231 | Ga0207667_10041259 | 3300025949 | Bacteria | 4909 |
| 232 | Ga0207667_10866385 | 3300025949 | Bacteria | 897 |
| 233 | Ga0207651_10015376 | 3300025960 | Bacteria | 4446 |
| 234 | Ga0207651_10671308 | 3300025960 | Bacteria | 911 |
| 235 | Ga0207712_10339997 | 3300025961 | Bacteria | 1244 |
| 236 | Ga0207668_10836894 | 3300025972 | Bacteria | 816 |
| 237 | Ga0207668_12148526 | 3300025972 | Bacteria | 502 |
| 238 | Ga0207640_10005123 | 3300025981 | Bacteria | 7128 |
| 239 | Ga0207640_11135082 | 3300025981 | Bacteria | 693 |
| 240 | Ga0207658_10093201 | 3300025986 | Bacteria | 2341 |
| 241 | Ga0207677_12116268 | 3300026023 | Bacteria | 523 |
| 242 | Ga0207639_10094320 | 3300026041 | Bacteria | 2402 |
| 243 | Ga0207639_10621897 | 3300026041 | Bacteria | 997 |
| 244 | Ga0207678_10000171 | 3300026067 | Bacteria | 54729 |
| 245 | Ga0207678_10026937 | 3300026067 | Bacteria | 5014 |
| 246 | Ga0207678_10422462 | 3300026067 | Bacteria | 1156 |
| 247 | Ga0207678_10792577 | 3300026067 | Bacteria | 836 |
| 248 | Ga0207678_10966692 | 3300026067 | Bacteria | 753 |
| 249 | Ga0207678_11420043 | 3300026067 | Bacteria | 613 |
| 250 | Ga0207702_10039065 | 3300026078 | Bacteria | 3976 |
| 251 | Ga0207676_11582973 | 3300026095 | Archaea | 653 |
| 252 | Ga0207676_12469689 | 3300026095 | Bacteria | 516 |
| 253 | Ga0207683_10001134 | 3300026121 | Bacteria | 24222 |
| 254 | Ga0207683_10079024 | 3300026121 | Bacteria | 2916 |
| 255 | Ga0207683_10359503 | 3300026121 | Bacteria | 1337 |
| 256 | Ga0207683_10406543 | 3300026121 | Bacteria | 1253 |
| 257 | Ga0207683_11549240 | 3300026121 | Bacteria | 612 |
| 258 | Ga0207683_11789462 | 3300026121 | Bacteria | 563 |
| 259 | Ga0207698_10349583 | 3300026142 | Bacteria | 1396 |
| 260 | Ga0207698_10906914 | 3300026142 | Bacteria | 889 |
| 261 | Ga0268266_10091683 | 3300028379 | Bacteria | 2665 |
| 262 | Ga0268266_10629166 | 3300028379 | Bacteria | 1032 |
| 263 | Ga0268266_10731039 | 3300028379 | Bacteria | 955 |
| 264 | Ga0268266_11431231 | 3300028379 | Unclassified | 667 |
| 265 | Ga0268264_10758746 | 3300028381 | Bacteria | 967 |
| 266 | Ga0307511_10001407 | 3300030521 | Bacteria | 25401 |
| 267 | Ga0314311_1035664 | 3300030733 | Bacteria | 501 |
| 268 | Ga0316178_1029189 | 3300030735 | Bacteria | 928 |
| 269 | Ga0307513_10062578 | 3300031456 | Bacteria | 3932 |
| 270 | Ga0307408_100778177 | 3300031548 | Bacteria | 867 |
| 271 | Ga0307516_10859783 | 3300031730 | Bacteria | 571 |
| 272 | Ga0307405_10645615 | 3300031731 | Bacteria | 870 |
| 273 | Ga0307518_10012292 | 3300031838 | Bacteria | 6120 |
| 274 | Ga0307410_10902300 | 3300031852 | Bacteria | 757 |
| 275 | Ga0307406_12019596 | 3300031901 | Bacteria | 516 |
| 276 | Ga0307406_12039030 | 3300031901 | Bacteria | 513 |
| 277 | Ga0307412_11469274 | 3300031911 | Bacteria | 619 |
| 278 | Ga0307412_11919829 | 3300031911 | Bacteria | 547 |
| 279 | Ga0307409_100424863 | 3300031995 | Bacteria | 1276 |
| 280 | Ga0307409_100658583 | 3300031995 | Bacteria | 1042 |
| 281 | Ga0307409_101582149 | 3300031995 | Bacteria | 683 |
| 282 | Ga0307416_100043846 | 3300032002 | Bacteria | 3507 |
| 283 | Ga0307411_10993493 | 3300032005 | Bacteria | 751 |
| 284 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 285 | Ga0307510_10024593 | 3300033180 | Bacteria | 6956 |
| 286 | Ga0395901_2168028 | 3300038443 | Bacteria | 500 |
| 287 | Ga0451787_053604 | 3300041441 | Bacteria | 665 |
| 288 | Ga0451789_0451907 | 3300041443 | Bacteria | 564 |
| 289 | Ga0451789_0688429 | 3300041443 | Bacteria | 552 |
| 290 | Ga0451791_1258843 | 3300041451 | Bacteria | 7268 |
| 291 | Ga0451791_1932489 | 3300041451 | Bacteria | 1038 |
| 292 | Ga0451793_0080236 | 3300041452 | Bacteria | 751 |
| 293 | Ga0451793_0830341 | 3300041452 | Bacteria | 7160 |
| 294 | Ga0451793_1723565 | 3300041452 | Bacteria | 632 |
| 295 | Ga0451797_0391903 | 3300041453 | Bacteria | 1119 |
| 296 | Ga0451797_0803356 | 3300041453 | Bacteria | 4085 |
| 297 | Ga0451797_1541060 | 3300041453 | Bacteria | 522 |
| 298 | Ga0451802_0989911 | 3300041460 | Bacteria | 577 |
| 299 | Ga0451806_430110 | 3300041462 | Bacteria | 1495 |
| 300 | Ga0451807_0220929 | 3300041486 | Bacteria | 563 |
| 301 | Ga0451833_0551454 | 3300041491 | Bacteria | 1634 |
| 302 | Ga0451835_0166726 | 3300041492 | Bacteria | 993 |
| 303 | Ga0451837_1848794 | 3300041494 | Bacteria | 669 |
| 304 | Ga0451839_1303485 | 3300041496 | Bacteria | 1371 |
| 305 | Ga0451841_1438909 | 3300041498 | Bacteria | 3181 |
| 306 | Ga0451847_0546697 | 3300041503 | Bacteria | 1192 |
| 307 | Ga0451843_1298049 | 3300041509 | Bacteria | 1997 |
| 308 | Ga0451853_0297658 | 3300041512 | Bacteria | 4268 |
| 309 | Ga0439433_0180478 | 3300041999 | Bacteria | 552 |
| 310 | Ga0439449_0017257 | 3300042007 | Bacteria | 2710 |
| 311 | Ga0466969_0015566 | 3300044656 | Bacteria | 3984 |
| 312 | Ga0466969_0018954 | 3300044656 | Bacteria | 3581 |
| 313 | Ga0466969_0033764 | 3300044656 | Bacteria | 2596 |
| 314 | Ga0466969_0050256 | 3300044656 | Bacteria | 2055 |
| 315 | Ga0466969_0154149 | 3300044656 | Bacteria | 1057 |
| 316 | Ga0466969_0180599 | 3300044656 | Bacteria | 966 |
| 317 | Ga0466972_0071861 | 3300044658 | Bacteria | 1650 |
| 318 | Ga0466972_0649552 | 3300044658 | Unclassified | 500 |
| 319 | Ga0466965_0000005 | 3300044683 | Bacteria | 185168 |
| 320 | Ga0466966_0006655 | 3300044684 | Bacteria | 7656 |
| 321 | Ga0466966_0017949 | 3300044684 | Bacteria | 4672 |
| 322 | Ga0466961_0003356 | 3300044693 | Bacteria | 9993 |
| 323 | Ga0466961_0073324 | 3300044693 | Bacteria | 2171 |
| 324 | Ga0466961_0126880 | 3300044693 | Bacteria | 1600 |
| 325 | Ga0466961_0259900 | 3300044693 | Bacteria | 1065 |
| 326 | Ga0466961_0334972 | 3300044693 | Bacteria | 922 |
| 327 | Ga0466963_0296862 | 3300044694 | Bacteria | 1136 |
| 328 | Ga0466971_0012806 | 3300044719 | Bacteria | 3676 |
| 329 | Ga0466971_0227732 | 3300044719 | Bacteria | 884 |
| 330 | Ga0466971_0681191 | 3300044719 | Bacteria | 516 |
| 331 | Ga0466970_0016352 | 3300044765 | Bacteria | 3822 |
| 332 | Ga0466970_0067511 | 3300044765 | Bacteria | 1920 |
| 333 | Ga0466970_0067956 | 3300044765 | Bacteria | 1914 |
| 334 | Ga0466970_0196425 | 3300044765 | Bacteria | 1122 |
| 335 | Ga0466970_0283492 | 3300044765 | Bacteria | 932 |
| 336 | Ga0466970_0316275 | 3300044765 | Bacteria | 882 |
| 337 | Ga0466957_0095943 | 3300044842 | Bacteria | 1863 |
| 338 | Ga0466959_0002152 | 3300045049 | Bacteria | 12503 |
| 339 | Ga0466959_0016950 | 3300045049 | Bacteria | 5332 |
| 340 | Ga0466959_0300137 | 3300045049 | Bacteria | 1100 |
| 341 | Ga0466959_0459975 | 3300045049 | Bacteria | 862 |
| 342 | Ga0466959_0593254 | 3300045049 | Bacteria | 745 |
| 343 | Ga0466958_0165839 | 3300045836 | Bacteria | 1397 |
| 344 | Ga0466958_0890648 | 3300045836 | Bacteria | 580 |
| 345 | Ga0466967_0962879 | 3300045976 | Bacteria | 849 |
| 346 | Ga0495627_152795 | 3300046453 | Bacteria | 644 |
| 347 | Ga0495592_0024577 | 3300046454 | Bacteria | 4580 |
| 348 | Ga0495629_0228444 | 3300046459 | Bacteria | 1283 |
| 349 | Ga0495638_0536646 | 3300046460 | Bacteria | 584 |
| 350 | Ga0495641_0339110 | 3300046461 | Bacteria | 679 |
| 351 | Ga0495651_0123638 | 3300046462 | Bacteria | 1897 |
| 352 | Ga0495651_0509157 | 3300046462 | Bacteria | 770 |
| 353 | Ga0495653_0026926 | 3300046463 | Bacteria | 4605 |
| 354 | Ga0495582_0081134 | 3300046473 | Bacteria | 1801 |
| 355 | Ga0495582_0578746 | 3300046473 | Bacteria | 650 |
| 356 | Ga0495639_0694701 | 3300046475 | Unclassified | 525 |
| 357 | Ga0495662_0016851 | 3300046476 | Bacteria | 3536 |
| 358 | Ga0495662_0573810 | 3300046476 | Bacteria | 552 |
| 359 | Ga0495664_0053816 | 3300046477 | Bacteria | 2393 |
| 360 | Ga0495664_0773318 | 3300046477 | Bacteria | 565 |
| 361 | Ga0495664_0872000 | 3300046477 | Bacteria | 527 |
| 362 | Ga0495594_0180273 | 3300046499 | Bacteria | 1202 |
| 363 | Ga0495594_0256522 | 3300046499 | Bacteria | 996 |
| 364 | Ga0495594_0618828 | 3300046499 | Unclassified | 614 |
| 365 | Ga0495594_0890604 | 3300046499 | Bacteria | 500 |
| 366 | Ga0495607_0233681 | 3300046501 | Bacteria | 893 |
| 367 | Ga0495608_0775263 | 3300046511 | Unclassified | 567 |
| 368 | Ga0495628_0021119 | 3300046516 | Bacteria | 5361 |
| 369 | Ga0495631_0068846 | 3300046518 | Bacteria | 1531 |
| 370 | Ga0495644_0134564 | 3300046523 | Bacteria | 943 |
| 371 | Ga0495663_0082396 | 3300046525 | Bacteria | 1038 |
| 372 | Ga0495642_0202928 | 3300046528 | Bacteria | 864 |
| 373 | Ga0495642_0564015 | 3300046528 | Bacteria | 505 |
| 374 | Ga0495652_0005902 | 3300046529 | Bacteria | 11454 |
| 375 | Ga0495652_0102813 | 3300046529 | Bacteria | 2314 |
| 376 | Ga0495665_0054458 | 3300046531 | Bacteria | 2113 |
| 377 | Ga0495665_0496096 | 3300046531 | Bacteria | 615 |
| 378 | Ga0495640_0846273 | 3300046533 | Bacteria | 544 |
| 379 | Ga0495586_0014805 | 3300046535 | Bacteria | 4146 |
| 380 | Ga0495586_0032444 | 3300046535 | Bacteria | 2799 |
| 381 | Ga0495586_0294669 | 3300046535 | Bacteria | 929 |
| 382 | Ga0495587_0007088 | 3300046536 | Bacteria | 7269 |
| 383 | Ga0495645_0001343 | 3300046543 | Bacteria | 16622 |
| 384 | Ga0495645_0043689 | 3300046543 | Bacteria | 3269 |
| 385 | Ga0495622_0033450 | 3300046557 | Bacteria | 2399 |
| 386 | Ga0495633_0297237 | 3300046558 | Bacteria | 734 |
| 387 | Ga0495667_0000400 | 3300046559 | Bacteria | 27725 |
| 388 | Ga0495667_0574851 | 3300046559 | Bacteria | 703 |
| 389 | Ga0495656_0021813 | 3300046615 | Bacteria | 2498 |
| 390 | Ga0495656_0485267 | 3300046615 | Bacteria | 654 |
| 391 | Ga0495668_0035236 | 3300046616 | Bacteria | 2805 |
| 392 | Ga0495635_0040941 | 3300046663 | Bacteria | 3201 |
| 393 | Ga0495635_0441351 | 3300046663 | Bacteria | 861 |
| 394 | Ga0495659_0006908 | 3300046664 | Bacteria | 3592 |
| 395 | Ga0495661_0108037 | 3300046665 | Bacteria | 1555 |
| 396 | Ga0495588_0009386 | 3300046674 | Bacteria | 4520 |
| 397 | Ga0495657_0151595 | 3300046675 | Bacteria | 1439 |
| 398 | Ga0495657_0324982 | 3300046675 | Bacteria | 914 |
| 399 | Ga0495657_0844891 | 3300046675 | Bacteria | 522 |
| 400 | Ga0495623_0162121 | 3300046679 | Bacteria | 1313 |
| 401 | Ga0495623_0477681 | 3300046679 | Bacteria | 660 |
| 402 | Ga0495646_0445467 | 3300046680 | Bacteria | 669 |
| 403 | Ga0495647_0344301 | 3300046681 | Bacteria | 678 |
| 404 | Ga0495658_0490223 | 3300046683 | Bacteria | 786 |
| 405 | Ga0495658_0609242 | 3300046683 | Bacteria | 700 |
| 406 | Ga0495613_0216900 | 3300046689 | Bacteria | 1344 |
| 407 | Ga0495624_0084043 | 3300046690 | Bacteria | 1968 |
| 408 | Ga0495670_0008175 | 3300046691 | Bacteria | 5144 |
| 409 | Ga0495670_0061062 | 3300046691 | Bacteria | 1894 |
| 410 | Ga0495670_0158465 | 3300046691 | Bacteria | 1188 |
| 411 | Ga0495671_0569407 | 3300046692 | Bacteria | 539 |
| 412 | Ga0495600_0104835 | 3300046809 | Bacteria | 1842 |
| 413 | Ga0495600_0481427 | 3300046809 | Bacteria | 765 |
| 414 | Ga0495581_0017005 | 3300047315 | Bacteria | 4226 |
| 415 | Ga0495581_0138978 | 3300047315 | Bacteria | 1416 |
| 416 | Ga0495604_0007863 | 3300047317 | Bacteria | 8442 |
| 417 | Ga0495604_0755044 | 3300047317 | Unclassified | 615 |
| 418 | Ga0495636_0052488 | 3300047318 | Bacteria | 1710 |
| 419 | Ga0495680_0066879 | 3300047322 | Bacteria | 2749 |
| 420 | Ga0495680_0834731 | 3300047322 | Unclassified | 600 |
| 421 | Ga0495675_0020175 | 3300047444 | Bacteria | 4236 |
| 422 | Ga0495677_0087734 | 3300047445 | Bacteria | 1170 |
| 423 | Ga0495677_0378594 | 3300047445 | Bacteria | 559 |
| 424 | Ga0495685_001941 | 3300047447 | Bacteria | 6405 |
| 425 | Ga0495681_0075932 | 3300047470 | Bacteria | 1511 |
| 426 | Ga0495686_0523153 | 3300047472 | Bacteria | 622 |
| 427 | Ga0495593_0196185 | 3300047673 | Bacteria | 1015 |
| 428 | Ga0495593_0574586 | 3300047673 | Unclassified | 566 |
| 429 | Ga0495602_0348160 | 3300048088 | Bacteria | 1070 |
| 430 | Ga0495614_0400662 | 3300048089 | Bacteria | 645 |
| 431 | Ga0496100_0022120 | 3300048903 | Bacteria | 3842 |
| 432 | Ga0496100_0296497 | 3300048903 | Bacteria | 1209 |
| 433 | Ga0496100_0971619 | 3300048903 | Bacteria | 668 |
| 434 | Ga0496100_1072523 | 3300048903 | Bacteria | 634 |
| 435 | Ga0496100_1475808 | 3300048903 | Unclassified | 537 |
| 436 | Ga0496101_0035154 | 3300048904 | Bacteria | 3543 |
| 437 | Ga0496101_0479118 | 3300048904 | Bacteria | 982 |
| 438 | Ga0496101_1219326 | 3300048904 | Bacteria | 589 |
| 439 | Ga0496102_0077082 | 3300048905 | Bacteria | 3067 |
| 440 | Ga0496102_0084267 | 3300048905 | Bacteria | 2933 |
| 441 | Ga0496102_0087643 | 3300048905 | Bacteria | 2876 |
| 442 | Ga0496102_0114118 | 3300048905 | Bacteria | 2520 |
| 443 | Ga0496102_0153088 | 3300048905 | Bacteria | 2167 |
| 444 | Ga0496102_0452898 | 3300048905 | Bacteria | 1204 |
| 445 | Ga0496102_0724256 | 3300048905 | Unclassified | 918 |
| 446 | Ga0496103_0017773 | 3300048906 | Bacteria | 4259 |
| 447 | Ga0496103_0050477 | 3300048906 | Bacteria | 2573 |
| 448 | Ga0496103_0837591 | 3300048906 | Bacteria | 579 |
| 449 | Ga0496103_1050451 | 3300048906 | Bacteria | 505 |
| 450 | Ga0496104_0052525 | 3300048907 | Bacteria | 3850 |
| 451 | Ga0496104_0319113 | 3300048907 | Bacteria | 1466 |
| 452 | Ga0496104_1373252 | 3300048907 | Bacteria | 610 |
| 453 | Ga0496105_0003086 | 3300048908 | Bacteria | 12249 |
| 454 | Ga0496105_0087328 | 3300048908 | Bacteria | 2576 |
| 455 | Ga0496106_0710831 | 3300048909 | Bacteria | 800 |
| 456 | Ga0496107_0161142 | 3300048910 | Bacteria | 1662 |
| 457 | Ga0496107_0912526 | 3300048910 | Bacteria | 640 |
| 458 | Ga0496108_0001930 | 3300048911 | Bacteria | 16611 |
| 459 | Ga0496108_0235591 | 3300048911 | Bacteria | 1592 |
| 460 | Ga0496108_0326237 | 3300048911 | Bacteria | 1338 |
| 461 | Ga0496108_0330988 | 3300048911 | Bacteria | 1328 |
| 462 | Ga0496108_0414683 | 3300048911 | Bacteria | 1176 |
| 463 | Ga0496108_0645757 | 3300048911 | Unclassified | 920 |
| 464 | Ga0496109_0005859 | 3300048912 | Bacteria | 10301 |
| 465 | Ga0496109_0020366 | 3300048912 | Bacteria | 5858 |
| 466 | Ga0496109_0307702 | 3300048912 | Bacteria | 1495 |
| 467 | Ga0496109_0925301 | 3300048912 | Bacteria | 810 |
| 468 | Ga0496109_1152906 | 3300048912 | Bacteria | 712 |
| 469 | Ga0496110_0004866 | 3300048913 | Bacteria | 10477 |
| 470 | Ga0496110_0054530 | 3300048913 | Bacteria | 3516 |
| 471 | Ga0496110_0078277 | 3300048913 | Bacteria | 2943 |
| 472 | Ga0496110_0100278 | 3300048913 | Bacteria | 2595 |
| 473 | Ga0496110_0233282 | 3300048913 | Unclassified | 1674 |
| 474 | Ga0496110_0443085 | 3300048913 | Bacteria | 1184 |
| 475 | Ga0496110_1625460 | 3300048913 | Bacteria | 556 |
| 476 | Ga0496111_0002209 | 3300048914 | Bacteria | 11673 |
| 477 | Ga0496111_0057359 | 3300048914 | Bacteria | 2819 |
| 478 | Ga0496111_0061448 | 3300048914 | Bacteria | 2723 |
| 479 | Ga0496111_0383250 | 3300048914 | Unclassified | 1040 |
| 480 | Ga0496111_0534256 | 3300048914 | Bacteria | 862 |
| 481 | Ga0496111_1058555 | 3300048914 | Bacteria | 579 |
| 482 | Ga0496111_1236015 | 3300048914 | Bacteria | 528 |
| 483 | Ga0496112_0379065 | 3300048915 | Bacteria | 1355 |
| 484 | Ga0496112_1575534 | 3300048915 | Unclassified | 570 |
| 485 | Ga0496113_0024578 | 3300048916 | Bacteria | 4284 |
| 486 | Ga0496113_0095752 | 3300048916 | Bacteria | 2294 |
| 487 | Ga0496114_0002155 | 3300048917 | Bacteria | 14988 |
| 488 | Ga0496114_0091253 | 3300048917 | Bacteria | 2587 |
| 489 | Ga0496114_0107321 | 3300048917 | Bacteria | 2389 |
| 490 | Ga0496114_0125230 | 3300048917 | Bacteria | 2214 |
| 491 | Ga0496114_0156396 | 3300048917 | Bacteria | 1979 |
| 492 | Ga0496114_0194471 | 3300048917 | Bacteria | 1775 |
| 493 | Ga0496114_0438315 | 3300048917 | Bacteria | 1157 |
| 494 | Ga0496114_0693447 | 3300048917 | Bacteria | 893 |
| 495 | Ga0496114_0766916 | 3300048917 | Bacteria | 842 |
| 496 | Ga0496114_1778751 | 3300048917 | Bacteria | 504 |
| 497 | Ga0496115_0617577 | 3300048918 | Bacteria | 860 |
| 498 | Ga0496117_0017993 | 3300048920 | Bacteria | 5880 |
| 499 | Ga0496118_0045487 | 3300048921 | Bacteria | 3426 |
| 500 | Ga0496118_0160081 | 3300048921 | Bacteria | 1393 |
| 501 | Ga0496118_0248334 | 3300048921 | Bacteria | 1013 |
| 502 | Ga0496119_0008509 | 3300048922 | Bacteria | 8998 |
| 503 | Ga0496119_0023086 | 3300048922 | Bacteria | 4427 |
| 504 | Ga0496120_0001144 | 3300048923 | Bacteria | 34063 |
| 505 | Ga0496122_0001463 | 3300048925 | Bacteria | 38046 |
| 506 | Ga0496124_0314190 | 3300048927 | Bacteria | 1125 |
| 507 | Ga0496124_0681840 | 3300048927 | Bacteria | 654 |
| 508 | Ga0496125_0000086 | 3300048928 | Bacteria | 216489 |
| 509 | Ga0496125_0331632 | 3300048928 | Bacteria | 917 |
| 510 | Ga0496126_0080934 | 3300048929 | Bacteria | 2873 |
| 511 | Ga0496126_0489218 | 3300048929 | Bacteria | 985 |
| 512 | Ga0496126_0752176 | 3300048929 | Bacteria | 752 |
| 513 | Ga0496126_1013674 | 3300048929 | Bacteria | 622 |
| 514 | Ga0501034_1411274 | 3300049571 | Bacteria | 571 |
| 515 | Ga0501041_0086701 | 3300049577 | Bacteria | 1932 |
| 516 | Ga0501068_0886420 | 3300049584 | Bacteria | 587 |
| 517 | Ga0501070_0696894 | 3300049586 | Bacteria | 803 |
| 518 | Ga0501076_0861181 | 3300049592 | Bacteria | 747 |
| 519 | Ga0501077_0671175 | 3300049593 | Bacteria | 666 |
| 520 | Ga0501079_0489366 | 3300049741 | Bacteria | 967 |
| 521 | Ga0501079_1426708 | 3300049741 | Unclassified | 545 |
| 522 | Ga0501045_0533086 | 3300049824 | Bacteria | 871 |
| 523 | nmdc:mga00v17_16593_c1 | 3300050491 | Bacteria | 4152 |
| 524 | nmdc:mga00v17_424860_c1 | 3300050491 | Bacteria | 863 |
| 525 | nmdc:mga00v17_560626_c1 | 3300050491 | Bacteria | 738 |
| 526 | nmdc:mga0yw44_297830_c1 | 3300050492 | Bacteria | 535 |
| 527 | nmdc:mga0yw44_35083_c1 | 3300050492 | Bacteria | 2945 |
| 528 | nmdc:mga0yw44_3772_c1 | 3300050492 | Bacteria | 6797 |
| 529 | nmdc:mga06z11_127902_c1 | 3300050494 | Bacteria | 1423 |
| 530 | nmdc:mga05p37_484144_c1 | 3300050507 | Bacteria | 1424 |
| 531 | nmdc:mga0sz30_928_c2 | 3300050516 | Bacteria | 9558 |
| 532 | Ga0495601_0044462 | 3300053077 | Bacteria | 2792 |
| 533 | Ga0495601_0127980 | 3300053077 | Bacteria | 1653 |
| 534 | Ga0495619_0807255 | 3300053085 | Bacteria | 634 |
| 535 | Ga0500556_0000215 | 3300053104 | Bacteria | 47104 |
| 536 | Ga0500562_017949 | 3300053108 | Bacteria | 1826 |
| 537 | Ga0500593_027366 | 3300053117 | Bacteria | 2544 |
| 538 | Ga0500655_000952 | 3300053133 | Bacteria | 5580 |
| 539 | Ga0500559_0000248 | 3300053136 | Bacteria | 42720 |
| 540 | Ga0500573_0111534 | 3300053140 | Bacteria | 1530 |
| 541 | Ga0500616_0025654 | 3300053153 | Bacteria | 3268 |
| 542 | Ga0501084_1641213 | 3300054114 | Bacteria | 537 |
| 543 | Ga0501084_1696731 | 3300054114 | Bacteria | 528 |
| 544 | Ga0587106_149039 | 3300059605 | Bacteria | 519 |
| 545 | Ga0466962_0009366 | 3300061719 | Bacteria | 4693 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_100008723 | Ga0068854_1000087235 | 74 |
| 2 | 3300025981 | Ga0207640_10005123 | Ga0207640_100051232 | 74 |
| 3 | 3300026041 | Ga0207639_10094320 | Ga0207639_100943205 | 74 |
| 4 | iso_pu_bacteria | 2585427649 | 2586062359 | 84 |
| 5 | iso_pu_bacteria | 2808606522 | 2809588468 | 84 |
| 6 | iso_pu_bacteria | 2884994152 | 2884996376 | 84 |
| 7 | iso_pu_bacteria | 2899359706 | 2899366826 | 84 |
| 8 | iso_pu_bacteria | 2915768154 | 2915770384 | 84 |
| 9 | iso_pu_bacteria | 8003314358 | 8003323955 | 84 |
| 10 | 3300003322 | rootL2_10224527 | rootL2_102245272 | 85 |
| 11 | 3300006038 | Ga0075365_10014815 | Ga0075365_100148154 | 85 |
| 12 | 3300006038 | Ga0075365_10169808 | Ga0075365_101698082 | 85 |
| 13 | 3300006038 | Ga0075365_10267560 | Ga0075365_102675602 | 85 |
| 14 | 3300006051 | Ga0075364_10014520 | Ga0075364_100145202 | 85 |
| 15 | 3300006051 | Ga0075364_10336205 | Ga0075364_103362052 | 85 |
| 16 | 3300006051 | Ga0075364_10735929 | Ga0075364_107359292 | 85 |
| 17 | 3300006186 | Ga0075369_10006349 | Ga0075369_100063492 | 85 |
| 18 | 3300041443 | Ga0451789_0688429 | Ga0451789_0688429_50_307 | 85 |
| 19 | 3300041486 | Ga0451807_0220929 | Ga0451807_0220929_106_363 | 85 |
| 20 | 3300048912 | Ga0496109_1152906 | Ga0496109_1152906_434_691 | 85 |
| 21 | 3300048929 | Ga0496126_0080934 | Ga0496126_0080934_811_1068 | 85 |
| 22 | 3300050491 | nmdc:mga00v17_16593_c1 | nmdc:mga00v17_16593_c1_865_1122 | 85 |
| 23 | 3300050491 | nmdc:mga00v17_424860_c1 | nmdc:mga00v17_424860_c1_501_758 | 85 |
| 24 | 3300050491 | nmdc:mga00v17_560626_c1 | nmdc:mga00v17_560626_c1_47_304 | 85 |
| 25 | 3300050492 | nmdc:mga0yw44_297830_c1 | nmdc:mga0yw44_297830_c1_174_431 | 85 |
| 26 | 3300050492 | nmdc:mga0yw44_35083_c1 | nmdc:mga0yw44_35083_c1_1331_1588 | 85 |
| 27 | 3300050492 | nmdc:mga0yw44_3772_c1 | nmdc:mga0yw44_3772_c1_4566_4823 | 85 |
| 28 | 3300050516 | nmdc:mga0sz30_928_c2 | nmdc:mga0sz30_928_c2_957_1214 | 85 |
| 29 | 3300053104 | Ga0500556_0000215 | Ga0500556_0000215_21872_22147 | 85 |
| 30 | 3300053108 | Ga0500562_017949 | Ga0500562_017949_695_952 | 85 |
| 31 | 3300053117 | Ga0500593_027366 | Ga0500593_027366_1951_2226 | 85 |
| 32 | 3300053133 | Ga0500655_000952 | Ga0500655_000952_2079_2354 | 85 |
| 33 | 3300053136 | Ga0500559_0000248 | Ga0500559_0000248_31549_31824 | 85 |
| 34 | 3300053153 | Ga0500616_0025654 | Ga0500616_0025654_371_628 | 85 |
| 35 | iso_pu_bacteria | 2558860280 | 2559424600 | 85 |
| 36 | iso_pu_bacteria | 2643221690 | 2644502908 | 85 |
| 37 | iso_pu_bacteria | 2751185734 | 2753073911 | 85 |
| 38 | iso_pu_bacteria | 2811994880 | 2812364430 | 85 |
| 39 | iso_pu_bacteria | 2844852863 | 2844854025 | 85 |
| 40 | iso_pu_bacteria | 2866612099 | 2866619189 | 85 |
| 41 | iso_pu_bacteria | 2870622029 | 2870623356 | 85 |
| 42 | iso_pu_bacteria | 2870721527 | 2870725822 | 85 |
| 43 | iso_pu_bacteria | 2964326757 | 2964329390 | 85 |
| 44 | iso_pu_bacteria | 8047710418 | 8047716818 | 85 |
| 45 | 3300049571 | Ga0501034_1411274 | Ga0501034_1411274_168_428 | 86 |
| 46 | 3300005614 | Ga0068856_101962233 | Ga0068856_1019622331 | 87 |
| 47 | 3300005985 | Ga0081539_10000904 | Ga0081539_1000090410 | 87 |
| 48 | 3300020069 | Ga0197907_10301419 | Ga0197907_103014192 | 87 |
| 49 | 3300025921 | Ga0207652_11384217 | Ga0207652_113842171 | 87 |
| 50 | 3300025949 | Ga0207667_10866385 | Ga0207667_108663851 | 87 |
| 51 | 3300044656 | Ga0466969_0180599 | Ga0466969_0180599_34_297 | 87 |
| 52 | 3300044693 | Ga0466961_0334972 | Ga0466961_0334972_85_348 | 87 |
| 53 | 3300045049 | Ga0466959_0459975 | Ga0466959_0459975_442_705 | 87 |
| 54 | 3300003320 | rootH2_10020571 | rootH2_100205712 | 88 |
| 55 | 3300003320 | rootH2_10197868 | rootH2_101978682 | 88 |
| 56 | 3300005331 | Ga0070670_100459446 | Ga0070670_1004594462 | 88 |
| 57 | 3300005336 | Ga0070680_101021565 | Ga0070680_1010215651 | 88 |
| 58 | 3300005434 | Ga0070709_10631588 | Ga0070709_106315882 | 88 |
| 59 | 3300005435 | Ga0070714_100019901 | Ga0070714_1000199015 | 88 |
| 60 | 3300005435 | Ga0070714_100047254 | Ga0070714_1000472542 | 88 |
| 61 | 3300005435 | Ga0070714_100221296 | Ga0070714_1002212964 | 88 |
| 62 | 3300005436 | Ga0070713_100099763 | Ga0070713_1000997632 | 88 |
| 63 | 3300005437 | Ga0070710_10000488 | Ga0070710_1000048818 | 88 |
| 64 | 3300005437 | Ga0070710_10239328 | Ga0070710_102393281 | 88 |
| 65 | 3300005439 | Ga0070711_100071802 | Ga0070711_1000718023 | 88 |
| 66 | 3300005455 | Ga0070663_100005873 | Ga0070663_10000587310 | 88 |
| 67 | 3300005455 | Ga0070663_100100437 | Ga0070663_1001004374 | 88 |
| 68 | 3300005536 | Ga0070697_100776208 | Ga0070697_1007762082 | 88 |
| 69 | 3300005548 | Ga0070665_100655757 | Ga0070665_1006557571 | 88 |
| 70 | 3300005563 | Ga0068855_100014360 | Ga0068855_1000143604 | 88 |
| 71 | 3300005614 | Ga0068856_100164625 | Ga0068856_1001646252 | 88 |
| 72 | 3300005614 | Ga0068856_100914650 | Ga0068856_1009146502 | 88 |
| 73 | 3300005616 | Ga0068852_100383398 | Ga0068852_1003833982 | 88 |
| 74 | 3300005834 | Ga0068851_10741495 | Ga0068851_107414952 | 88 |
| 75 | 3300006175 | Ga0070712_100214737 | Ga0070712_1002147372 | 88 |
| 76 | 3300006175 | Ga0070712_101461223 | Ga0070712_1014612231 | 88 |
| 77 | 3300009093 | Ga0105240_10045269 | Ga0105240_100452697 | 88 |
| 78 | 3300009098 | Ga0105245_11557889 | Ga0105245_115578892 | 88 |
| 79 | 3300009174 | Ga0105241_10003908 | Ga0105241_100039087 | 88 |
| 80 | 3300009545 | Ga0105237_10039832 | Ga0105237_100398322 | 88 |
| 81 | 3300009551 | Ga0105238_10012997 | Ga0105238_100129975 | 88 |
| 82 | 3300010375 | Ga0105239_10033587 | Ga0105239_100335877 | 88 |
| 83 | 3300010375 | Ga0105239_10785927 | Ga0105239_107859272 | 88 |
| 84 | 3300014969 | Ga0157376_11278154 | Ga0157376_112781541 | 88 |
| 85 | 3300014969 | Ga0157376_11655312 | Ga0157376_116553122 | 88 |
| 86 | 3300020069 | Ga0197907_10902729 | Ga0197907_109027292 | 88 |
| 87 | 3300020081 | Ga0206354_11278698 | Ga0206354_112786982 | 88 |
| 88 | 3300020082 | Ga0206353_10933170 | Ga0206353_109331701 | 88 |
| 89 | 3300022467 | Ga0224712_10004814 | Ga0224712_100048145 | 88 |
| 90 | 3300022467 | Ga0224712_10065986 | Ga0224712_100659862 | 88 |
| 91 | 3300025898 | Ga0207692_10000267 | Ga0207692_1000026717 | 88 |
| 92 | 3300025898 | Ga0207692_10612402 | Ga0207692_106124022 | 88 |
| 93 | 3300025904 | Ga0207647_10015074 | Ga0207647_100150744 | 88 |
| 94 | 3300025906 | Ga0207699_10262740 | Ga0207699_102627402 | 88 |
| 95 | 3300025911 | Ga0207654_10014151 | Ga0207654_100141512 | 88 |
| 96 | 3300025913 | Ga0207695_10015018 | Ga0207695_100150187 | 88 |
| 97 | 3300025914 | Ga0207671_10005109 | Ga0207671_100051097 | 88 |
| 98 | 3300025915 | Ga0207693_10149798 | Ga0207693_101497982 | 88 |
| 99 | 3300025916 | Ga0207663_10168855 | Ga0207663_101688552 | 88 |
| 100 | 3300025917 | Ga0207660_11080861 | Ga0207660_110808612 | 88 |
| 101 | 3300025919 | Ga0207657_10130366 | Ga0207657_101303662 | 88 |
| 102 | 3300025921 | Ga0207652_10020785 | Ga0207652_100207853 | 88 |
| 103 | 3300025924 | Ga0207694_10004186 | Ga0207694_100041866 | 88 |
| 104 | 3300025928 | Ga0207700_10777054 | Ga0207700_107770542 | 88 |
| 105 | 3300025929 | Ga0207664_10021621 | Ga0207664_100216215 | 88 |
| 106 | 3300025929 | Ga0207664_10562328 | Ga0207664_105623282 | 88 |
| 107 | 3300025949 | Ga0207667_10041259 | Ga0207667_100412594 | 88 |
| 108 | 3300026067 | Ga0207678_10000171 | Ga0207678_1000017110 | 88 |
| 109 | 3300026067 | Ga0207678_10026937 | Ga0207678_100269377 | 88 |
| 110 | 3300026067 | Ga0207678_11420043 | Ga0207678_114200432 | 88 |
| 111 | 3300026078 | Ga0207702_10039065 | Ga0207702_100390653 | 88 |
| 112 | 3300026142 | Ga0207698_10349583 | Ga0207698_103495833 | 88 |
| 113 | 3300028379 | Ga0268266_10731039 | Ga0268266_107310392 | 88 |
| 114 | 3300030521 | Ga0307511_10001407 | Ga0307511_1000140729 | 88 |
| 115 | 3300030733 | Ga0314311_1035664 | Ga0314311_10356642 | 88 |
| 116 | 3300030735 | Ga0316178_1029189 | Ga0316178_10291892 | 88 |
| 117 | 3300031730 | Ga0307516_10859783 | Ga0307516_108597831 | 88 |
| 118 | 3300031731 | Ga0307405_10645615 | Ga0307405_106456152 | 88 |
| 119 | 3300031838 | Ga0307518_10012292 | Ga0307518_100122925 | 88 |
| 120 | 3300031852 | Ga0307410_10902300 | Ga0307410_109023002 | 88 |
| 121 | 3300031901 | Ga0307406_12019596 | Ga0307406_120195962 | 88 |
| 122 | 3300031901 | Ga0307406_12039030 | Ga0307406_120390302 | 88 |
| 123 | 3300031995 | Ga0307409_101582149 | Ga0307409_1015821492 | 88 |
| 124 | 3300032002 | Ga0307416_100043846 | Ga0307416_1000438462 | 88 |
| 125 | 3300032005 | Ga0307411_10993493 | Ga0307411_109934932 | 88 |
| 126 | 3300033179 | Ga0307507_10000013 | Ga0307507_10000013117 | 88 |
| 127 | 3300033180 | Ga0307510_10024593 | Ga0307510_100245932 | 88 |
| 128 | 3300038443 | Ga0395901_2168028 | Ga0395901_2168028_196_462 | 88 |
| 129 | 3300041460 | Ga0451802_0989911 | Ga0451802_0989911_199_465 | 88 |
| 130 | 3300044656 | Ga0466969_0033764 | Ga0466969_0033764_273_539 | 88 |
| 131 | 3300044656 | Ga0466969_0050256 | Ga0466969_0050256_1752_2021 | 88 |
| 132 | 3300044656 | Ga0466969_0154149 | Ga0466969_0154149_154_420 | 88 |
| 133 | 3300044658 | Ga0466972_0071861 | Ga0466972_0071861_19_285 | 88 |
| 134 | 3300044684 | Ga0466966_0017949 | Ga0466966_0017949_4179_4445 | 88 |
| 135 | 3300044693 | Ga0466961_0073324 | Ga0466961_0073324_1141_1410 | 88 |
| 136 | 3300044693 | Ga0466961_0126880 | Ga0466961_0126880_542_808 | 88 |
| 137 | 3300044694 | Ga0466963_0296862 | Ga0466963_0296862_107_373 | 88 |
| 138 | 3300044719 | Ga0466971_0012806 | Ga0466971_0012806_19_285 | 88 |
| 139 | 3300044719 | Ga0466971_0227732 | Ga0466971_0227732_237_503 | 88 |
| 140 | 3300044719 | Ga0466971_0681191 | Ga0466971_0681191_170_439 | 88 |
| 141 | 3300044765 | Ga0466970_0016352 | Ga0466970_0016352_371_640 | 88 |
| 142 | 3300044765 | Ga0466970_0067511 | Ga0466970_0067511_1431_1697 | 88 |
| 143 | 3300044765 | Ga0466970_0196425 | Ga0466970_0196425_683_961 | 88 |
| 144 | 3300044765 | Ga0466970_0283492 | Ga0466970_0283492_281_547 | 88 |
| 145 | 3300044765 | Ga0466970_0316275 | Ga0466970_0316275_442_708 | 88 |
| 146 | 3300044842 | Ga0466957_0095943 | Ga0466957_0095943_158_424 | 88 |
| 147 | 3300045049 | Ga0466959_0002152 | Ga0466959_0002152_12130_12396 | 88 |
| 148 | 3300045049 | Ga0466959_0016950 | Ga0466959_0016950_4147_4413 | 88 |
| 149 | 3300045049 | Ga0466959_0300137 | Ga0466959_0300137_277_546 | 88 |
| 150 | 3300045836 | Ga0466958_0165839 | Ga0466958_0165839_128_394 | 88 |
| 151 | 3300045836 | Ga0466958_0890648 | Ga0466958_0890648_191_457 | 88 |
| 152 | 3300045976 | Ga0466967_0962879 | Ga0466967_0962879_259_525 | 88 |
| 153 | 3300046454 | Ga0495592_0024577 | Ga0495592_0024577_2991_3260 | 88 |
| 154 | 3300046462 | Ga0495651_0123638 | Ga0495651_0123638_338_607 | 88 |
| 155 | 3300046516 | Ga0495628_0021119 | Ga0495628_0021119_763_1032 | 88 |
| 156 | 3300046529 | Ga0495652_0005902 | Ga0495652_0005902_4004_4273 | 88 |
| 157 | 3300046529 | Ga0495652_0102813 | Ga0495652_0102813_1895_2164 | 88 |
| 158 | 3300046543 | Ga0495645_0043689 | Ga0495645_0043689_377_646 | 88 |
| 159 | 3300046557 | Ga0495622_0033450 | Ga0495622_0033450_827_1096 | 88 |
| 160 | 3300046679 | Ga0495623_0162121 | Ga0495623_0162121_1018_1287 | 88 |
| 161 | 3300046680 | Ga0495646_0445467 | Ga0495646_0445467_253_522 | 88 |
| 162 | 3300047317 | Ga0495604_0007863 | Ga0495604_0007863_4886_5155 | 88 |
| 163 | 3300048911 | Ga0496108_0330988 | Ga0496108_0330988_988_1254 | 88 |
| 164 | 3300048913 | Ga0496110_1625460 | Ga0496110_1625460_171_437 | 88 |
| 165 | 3300048917 | Ga0496114_0002155 | Ga0496114_0002155_9859_10125 | 88 |
| 166 | 3300048917 | Ga0496114_1778751 | Ga0496114_1778751_140_406 | 88 |
| 167 | 3300048929 | Ga0496126_0489218 | Ga0496126_0489218_644_910 | 88 |
| 168 | 3300048929 | Ga0496126_1013674 | Ga0496126_1013674_188_454 | 88 |
| 169 | 3300049584 | Ga0501068_0886420 | Ga0501068_0886420_107_373 | 88 |
| 170 | 3300049741 | Ga0501079_1426708 | Ga0501079_1426708_139_417 | 88 |
| 171 | 3300053077 | Ga0495601_0044462 | Ga0495601_0044462_259_528 | 88 |
| 172 | 3300053077 | Ga0495601_0127980 | Ga0495601_0127980_882_1151 | 88 |
| 173 | 3300053085 | Ga0495619_0807255 | Ga0495619_0807255_106_375 | 88 |
| 174 | 3300053140 | Ga0500573_0111534 | Ga0500573_0111534_107_376 | 88 |
| 175 | 3300054114 | Ga0501084_1641213 | Ga0501084_1641213_150_464 | 88 |
| 176 | 3300054114 | Ga0501084_1696731 | Ga0501084_1696731_236_502 | 88 |
| 177 | 3300061719 | Ga0466962_0009366 | Ga0466962_0009366_2297_2563 | 88 |
| 178 | iso_pu_bacteria | 8004021418 | 8004022976 | 88 |
| 179 | iso_pu_bacteria | 8004025490 | 8004027185 | 88 |
| 180 | 3300003285 | Ga0007423J48922_101310 | Ga0007423J48922_1013102 | 89 |
| 181 | 3300003316 | rootH1_10128615 | rootH1_101286152 | 89 |
| 182 | 3300005337 | Ga0070682_100748526 | Ga0070682_1007485262 | 89 |
| 183 | 3300005337 | Ga0070682_100753093 | Ga0070682_1007530932 | 89 |
| 184 | 3300005343 | Ga0070687_101321414 | Ga0070687_1013214141 | 89 |
| 185 | 3300005347 | Ga0070668_100727700 | Ga0070668_1007277002 | 89 |
| 186 | 3300005354 | Ga0070675_101386288 | Ga0070675_1013862882 | 89 |
| 187 | 3300005356 | Ga0070674_101097040 | Ga0070674_1010970402 | 89 |
| 188 | 3300005356 | Ga0070674_101358603 | Ga0070674_1013586031 | 89 |
| 189 | 3300005366 | Ga0070659_100778811 | Ga0070659_1007788112 | 89 |
| 190 | 3300005455 | Ga0070663_100229589 | Ga0070663_1002295891 | 89 |
| 191 | 3300005456 | Ga0070678_100093681 | Ga0070678_1000936812 | 89 |
| 192 | 3300005456 | Ga0070678_101212286 | Ga0070678_1012122861 | 89 |
| 193 | 3300005456 | Ga0070678_101710889 | Ga0070678_1017108891 | 89 |
| 194 | 3300005458 | Ga0070681_12005962 | Ga0070681_120059622 | 89 |
| 195 | 3300005459 | Ga0068867_100795767 | Ga0068867_1007957671 | 89 |
| 196 | 3300005535 | Ga0070684_102027669 | Ga0070684_1020276691 | 89 |
| 197 | 3300005539 | Ga0068853_100106550 | Ga0068853_1001065502 | 89 |
| 198 | 3300005543 | Ga0070672_101088797 | Ga0070672_1010887972 | 89 |
| 199 | 3300005547 | Ga0070693_101611554 | Ga0070693_1016115542 | 89 |
| 200 | 3300005548 | Ga0070665_100661226 | Ga0070665_1006612262 | 89 |
| 201 | 3300005548 | Ga0070665_101949970 | Ga0070665_1019499701 | 89 |
| 202 | 3300005564 | Ga0070664_101096989 | Ga0070664_1010969892 | 89 |
| 203 | 3300005578 | Ga0068854_100798859 | Ga0068854_1007988592 | 89 |
| 204 | 3300005616 | Ga0068852_101136672 | Ga0068852_1011366722 | 89 |
| 205 | 3300005618 | Ga0068864_100873975 | Ga0068864_1008739751 | 89 |
| 206 | 3300005618 | Ga0068864_100956659 | Ga0068864_1009566592 | 89 |
| 207 | 3300005618 | Ga0068864_101965956 | Ga0068864_1019659562 | 89 |
| 208 | 3300005840 | Ga0068870_10435544 | Ga0068870_104355442 | 89 |
| 209 | 3300005842 | Ga0068858_101470105 | Ga0068858_1014701051 | 89 |
| 210 | 3300005843 | Ga0068860_101452639 | Ga0068860_1014526392 | 89 |
| 211 | 3300006237 | Ga0097621_100841766 | Ga0097621_1008417662 | 89 |
| 212 | 3300006358 | Ga0068871_101535109 | Ga0068871_1015351091 | 89 |
| 213 | 3300006881 | Ga0068865_100840650 | Ga0068865_1008406502 | 89 |
| 214 | 3300009098 | Ga0105245_10656852 | Ga0105245_106568522 | 89 |
| 215 | 3300009098 | Ga0105245_10945921 | Ga0105245_109459212 | 89 |
| 216 | 3300009098 | Ga0105245_11492590 | Ga0105245_114925902 | 89 |
| 217 | 3300009101 | Ga0105247_10928893 | Ga0105247_109288932 | 89 |
| 218 | 3300009147 | Ga0114129_10358527 | Ga0114129_103585272 | 89 |
| 219 | 3300009148 | Ga0105243_10695624 | Ga0105243_106956241 | 89 |
| 220 | 3300009174 | Ga0105241_10606872 | Ga0105241_106068722 | 89 |
| 221 | 3300009174 | Ga0105241_11339257 | Ga0105241_113392572 | 89 |
| 222 | 3300009176 | Ga0105242_12211634 | Ga0105242_122116341 | 89 |
| 223 | 3300009551 | Ga0105238_10016585 | Ga0105238_100165859 | 89 |
| 224 | 3300009993 | Ga0105028_125212 | Ga0105028_1252122 | 89 |
| 225 | 3300010375 | Ga0105239_10651195 | Ga0105239_106511952 | 89 |
| 226 | 3300011119 | Ga0105246_10351352 | Ga0105246_103513522 | 89 |
| 227 | 3300011119 | Ga0105246_10780910 | Ga0105246_107809102 | 89 |
| 228 | 3300013104 | Ga0157370_10422079 | Ga0157370_104220792 | 89 |
| 229 | 3300013105 | Ga0157369_10716938 | Ga0157369_107169382 | 89 |
| 230 | 3300013105 | Ga0157369_12221445 | Ga0157369_122214451 | 89 |
| 231 | 3300013296 | Ga0157374_11446022 | Ga0157374_114460221 | 89 |
| 232 | 3300013306 | Ga0163162_11304463 | Ga0163162_113044632 | 89 |
| 233 | 3300013306 | Ga0163162_11732832 | Ga0163162_117328322 | 89 |
| 234 | 3300013306 | Ga0163162_13396826 | Ga0163162_133968261 | 89 |
| 235 | 3300013308 | Ga0157375_10708744 | Ga0157375_107087442 | 89 |
| 236 | 3300013308 | Ga0157375_10781878 | Ga0157375_107818782 | 89 |
| 237 | 3300013308 | Ga0157375_11177794 | Ga0157375_111777941 | 89 |
| 238 | 3300014325 | Ga0163163_10207030 | Ga0163163_102070302 | 89 |
| 239 | 3300014325 | Ga0163163_10393166 | Ga0163163_103931663 | 89 |
| 240 | 3300014325 | Ga0163163_10831646 | Ga0163163_108316462 | 89 |
| 241 | 3300014325 | Ga0163163_11434369 | Ga0163163_114343691 | 89 |
| 242 | 3300014326 | Ga0157380_10294065 | Ga0157380_102940652 | 89 |
| 243 | 3300014326 | Ga0157380_10989620 | Ga0157380_109896201 | 89 |
| 244 | 3300014326 | Ga0157380_12098743 | Ga0157380_120987431 | 89 |
| 245 | 3300014326 | Ga0157380_12284024 | Ga0157380_122840241 | 89 |
| 246 | 3300014745 | Ga0157377_10241650 | Ga0157377_102416501 | 89 |
| 247 | 3300014968 | Ga0157379_10764292 | Ga0157379_107642921 | 89 |
| 248 | 3300014969 | Ga0157376_10598063 | Ga0157376_105980632 | 89 |
| 249 | 3300014969 | Ga0157376_11474479 | Ga0157376_114744791 | 89 |
| 250 | 3300014969 | Ga0157376_12045770 | Ga0157376_120457701 | 89 |
| 251 | 3300017792 | Ga0163161_11708019 | Ga0163161_117080191 | 89 |
| 252 | 3300020075 | Ga0206349_1667466 | Ga0206349_16674662 | 89 |
| 253 | 3300025899 | Ga0207642_10575991 | Ga0207642_105759911 | 89 |
| 254 | 3300025901 | Ga0207688_10020257 | Ga0207688_100202573 | 89 |
| 255 | 3300025901 | Ga0207688_10990015 | Ga0207688_109900152 | 89 |
| 256 | 3300025903 | Ga0207680_11003995 | Ga0207680_110039952 | 89 |
| 257 | 3300025904 | Ga0207647_10487922 | Ga0207647_104879222 | 89 |
| 258 | 3300025908 | Ga0207643_10771973 | Ga0207643_107719732 | 89 |
| 259 | 3300025912 | Ga0207707_10575648 | Ga0207707_105756482 | 89 |
| 260 | 3300025918 | Ga0207662_10197649 | Ga0207662_101976492 | 89 |
| 261 | 3300025927 | Ga0207687_10440897 | Ga0207687_104408972 | 89 |
| 262 | 3300025927 | Ga0207687_11576946 | Ga0207687_115769461 | 89 |
| 263 | 3300025932 | Ga0207690_11644329 | Ga0207690_116443292 | 89 |
| 264 | 3300025935 | Ga0207709_10185437 | Ga0207709_101854372 | 89 |
| 265 | 3300025937 | Ga0207669_10126726 | Ga0207669_101267262 | 89 |
| 266 | 3300025937 | Ga0207669_11101663 | Ga0207669_111016632 | 89 |
| 267 | 3300025937 | Ga0207669_11401234 | Ga0207669_114012341 | 89 |
| 268 | 3300025940 | Ga0207691_10806495 | Ga0207691_108064952 | 89 |
| 269 | 3300025960 | Ga0207651_10671308 | Ga0207651_106713082 | 89 |
| 270 | 3300025972 | Ga0207668_10836894 | Ga0207668_108368941 | 89 |
| 271 | 3300025972 | Ga0207668_12148526 | Ga0207668_121485261 | 89 |
| 272 | 3300025981 | Ga0207640_11135082 | Ga0207640_111350822 | 89 |
| 273 | 3300026023 | Ga0207677_12116268 | Ga0207677_121162681 | 89 |
| 274 | 3300026041 | Ga0207639_10621897 | Ga0207639_106218972 | 89 |
| 275 | 3300026067 | Ga0207678_10422462 | Ga0207678_104224621 | 89 |
| 276 | 3300026067 | Ga0207678_10792577 | Ga0207678_107925771 | 89 |
| 277 | 3300026095 | Ga0207676_11582973 | Ga0207676_115829731 | 89 |
| 278 | 3300026095 | Ga0207676_12469689 | Ga0207676_124696891 | 89 |
| 279 | 3300026121 | Ga0207683_10079024 | Ga0207683_100790241 | 89 |
| 280 | 3300026121 | Ga0207683_10359503 | Ga0207683_103595032 | 89 |
| 281 | 3300026121 | Ga0207683_11789462 | Ga0207683_117894621 | 89 |
| 282 | 3300026142 | Ga0207698_10906914 | Ga0207698_109069142 | 89 |
| 283 | 3300028379 | Ga0268266_10629166 | Ga0268266_106291662 | 89 |
| 284 | 3300028379 | Ga0268266_11431231 | Ga0268266_114312311 | 89 |
| 285 | 3300028381 | Ga0268264_10758746 | Ga0268264_107587462 | 89 |
| 286 | 3300031456 | Ga0307513_10062578 | Ga0307513_100625782 | 89 |
| 287 | 3300031548 | Ga0307408_100778177 | Ga0307408_1007781772 | 89 |
| 288 | 3300031911 | Ga0307412_11469274 | Ga0307412_114692742 | 89 |
| 289 | 3300031995 | Ga0307409_100658583 | Ga0307409_1006585832 | 89 |
| 290 | 3300041441 | Ga0451787_053604 | Ga0451787_053604_286_555 | 89 |
| 291 | 3300041443 | Ga0451789_0451907 | Ga0451789_0451907_14_283 | 89 |
| 292 | 3300041451 | Ga0451791_1258843 | Ga0451791_1258843_1852_2121 | 89 |
| 293 | 3300041451 | Ga0451791_1932489 | Ga0451791_1932489_259_537 | 89 |
| 294 | 3300041452 | Ga0451793_0080236 | Ga0451793_0080236_382_651 | 89 |
| 295 | 3300041452 | Ga0451793_0830341 | Ga0451793_0830341_668_937 | 89 |
| 296 | 3300041452 | Ga0451793_1723565 | Ga0451793_1723565_22_300 | 89 |
| 297 | 3300041453 | Ga0451797_0391903 | Ga0451797_0391903_346_615 | 89 |
| 298 | 3300041453 | Ga0451797_0803356 | Ga0451797_0803356_1510_1779 | 89 |
| 299 | 3300041453 | Ga0451797_1541060 | Ga0451797_1541060_114_392 | 89 |
| 300 | 3300041462 | Ga0451806_430110 | Ga0451806_430110_81_350 | 89 |
| 301 | 3300041491 | Ga0451833_0551454 | Ga0451833_0551454_903_1172 | 89 |
| 302 | 3300041492 | Ga0451835_0166726 | Ga0451835_0166726_419_688 | 89 |
| 303 | 3300041494 | Ga0451837_1848794 | Ga0451837_1848794_75_344 | 89 |
| 304 | 3300041496 | Ga0451839_1303485 | Ga0451839_1303485_207_476 | 89 |
| 305 | 3300041498 | Ga0451841_1438909 | Ga0451841_1438909_2094_2363 | 89 |
| 306 | 3300041503 | Ga0451847_0546697 | Ga0451847_0546697_580_849 | 89 |
| 307 | 3300041509 | Ga0451843_1298049 | Ga0451843_1298049_1329_1598 | 89 |
| 308 | 3300041512 | Ga0451853_0297658 | Ga0451853_0297658_3207_3476 | 89 |
| 309 | 3300041999 | Ga0439433_0180478 | Ga0439433_0180478_123_401 | 89 |
| 310 | 3300042007 | Ga0439449_0017257 | Ga0439449_0017257_2246_2515 | 89 |
| 311 | 3300044656 | Ga0466969_0018954 | Ga0466969_0018954_2880_3149 | 89 |
| 312 | 3300044683 | Ga0466965_0000005 | Ga0466965_0000005_131563_131832 | 89 |
| 313 | 3300046461 | Ga0495641_0339110 | Ga0495641_0339110_141_410 | 89 |
| 314 | 3300046462 | Ga0495651_0509157 | Ga0495651_0509157_68_337 | 89 |
| 315 | 3300046475 | Ga0495639_0694701 | Ga0495639_0694701_117_386 | 89 |
| 316 | 3300046476 | Ga0495662_0573810 | Ga0495662_0573810_175_444 | 89 |
| 317 | 3300046477 | Ga0495664_0773318 | Ga0495664_0773318_281_550 | 89 |
| 318 | 3300046477 | Ga0495664_0872000 | Ga0495664_0872000_100_369 | 89 |
| 319 | 3300046499 | Ga0495594_0618828 | Ga0495594_0618828_19_288 | 89 |
| 320 | 3300046499 | Ga0495594_0890604 | Ga0495594_0890604_185_454 | 89 |
| 321 | 3300046511 | Ga0495608_0775263 | Ga0495608_0775263_68_337 | 89 |
| 322 | 3300046523 | Ga0495644_0134564 | Ga0495644_0134564_52_321 | 89 |
| 323 | 3300046531 | Ga0495665_0496096 | Ga0495665_0496096_132_401 | 89 |
| 324 | 3300046533 | Ga0495640_0846273 | Ga0495640_0846273_79_348 | 89 |
| 325 | 3300046559 | Ga0495667_0574851 | Ga0495667_0574851_372_641 | 89 |
| 326 | 3300046615 | Ga0495656_0485267 | Ga0495656_0485267_246_515 | 89 |
| 327 | 3300046663 | Ga0495635_0441351 | Ga0495635_0441351_574_843 | 89 |
| 328 | 3300046675 | Ga0495657_0324982 | Ga0495657_0324982_385_654 | 89 |
| 329 | 3300046675 | Ga0495657_0844891 | Ga0495657_0844891_118_387 | 89 |
| 330 | 3300046681 | Ga0495647_0344301 | Ga0495647_0344301_203_472 | 89 |
| 331 | 3300046683 | Ga0495658_0490223 | Ga0495658_0490223_341_610 | 89 |
| 332 | 3300046683 | Ga0495658_0609242 | Ga0495658_0609242_136_405 | 89 |
| 333 | 3300046690 | Ga0495624_0084043 | Ga0495624_0084043_1590_1859 | 89 |
| 334 | 3300046809 | Ga0495600_0481427 | Ga0495600_0481427_12_281 | 89 |
| 335 | 3300047317 | Ga0495604_0755044 | Ga0495604_0755044_199_468 | 89 |
| 336 | 3300047322 | Ga0495680_0834731 | Ga0495680_0834731_212_481 | 89 |
| 337 | 3300047472 | Ga0495686_0523153 | Ga0495686_0523153_330_599 | 89 |
| 338 | 3300047673 | Ga0495593_0574586 | Ga0495593_0574586_75_344 | 89 |
| 339 | 3300048088 | Ga0495602_0348160 | Ga0495602_0348160_48_317 | 89 |
| 340 | 3300048089 | Ga0495614_0400662 | Ga0495614_0400662_68_337 | 89 |
| 341 | 3300048903 | Ga0496100_0971619 | Ga0496100_0971619_377_646 | 89 |
| 342 | 3300048903 | Ga0496100_1475808 | Ga0496100_1475808_159_428 | 89 |
| 343 | 3300048905 | Ga0496102_0087643 | Ga0496102_0087643_88_357 | 89 |
| 344 | 3300048905 | Ga0496102_0452898 | Ga0496102_0452898_846_1115 | 89 |
| 345 | 3300048905 | Ga0496102_0724256 | Ga0496102_0724256_539_817 | 89 |
| 346 | 3300048906 | Ga0496103_0837591 | Ga0496103_0837591_198_467 | 89 |
| 347 | 3300048907 | Ga0496104_0052525 | Ga0496104_0052525_1342_1611 | 89 |
| 348 | 3300048907 | Ga0496104_1373252 | Ga0496104_1373252_259_537 | 89 |
| 349 | 3300048908 | Ga0496105_0003086 | Ga0496105_0003086_2370_2639 | 89 |
| 350 | 3300048910 | Ga0496107_0912526 | Ga0496107_0912526_320_589 | 89 |
| 351 | 3300048911 | Ga0496108_0001930 | Ga0496108_0001930_7348_7617 | 89 |
| 352 | 3300048911 | Ga0496108_0414683 | Ga0496108_0414683_418_687 | 89 |
| 353 | 3300048911 | Ga0496108_0645757 | Ga0496108_0645757_193_462 | 89 |
| 354 | 3300048912 | Ga0496109_0005859 | Ga0496109_0005859_8225_8494 | 89 |
| 355 | 3300048912 | Ga0496109_0307702 | Ga0496109_0307702_624_893 | 89 |
| 356 | 3300048912 | Ga0496109_0925301 | Ga0496109_0925301_495_773 | 89 |
| 357 | 3300048913 | Ga0496110_0004866 | Ga0496110_0004866_1984_2253 | 89 |
| 358 | 3300048913 | Ga0496110_0233282 | Ga0496110_0233282_19_288 | 89 |
| 359 | 3300048913 | Ga0496110_0443085 | Ga0496110_0443085_404_673 | 89 |
| 360 | 3300048914 | Ga0496111_0002209 | Ga0496111_0002209_11306_11575 | 89 |
| 361 | 3300048914 | Ga0496111_0383250 | Ga0496111_0383250_122_391 | 89 |
| 362 | 3300048914 | Ga0496111_0534256 | Ga0496111_0534256_160_438 | 89 |
| 363 | 3300048914 | Ga0496111_1236015 | Ga0496111_1236015_149_418 | 89 |
| 364 | 3300048915 | Ga0496112_1575534 | Ga0496112_1575534_100_369 | 89 |
| 365 | 3300048916 | Ga0496113_0024578 | Ga0496113_0024578_80_349 | 89 |
| 366 | 3300048917 | Ga0496114_0091253 | Ga0496114_0091253_600_869 | 89 |
| 367 | 3300048917 | Ga0496114_0156396 | Ga0496114_0156396_1634_1903 | 89 |
| 368 | 3300048917 | Ga0496114_0194471 | Ga0496114_0194471_17_286 | 89 |
| 369 | 3300048917 | Ga0496114_0438315 | Ga0496114_0438315_266_535 | 89 |
| 370 | 3300048917 | Ga0496114_0693447 | Ga0496114_0693447_115_384 | 89 |
| 371 | 3300048917 | Ga0496114_0766916 | Ga0496114_0766916_541_810 | 89 |
| 372 | 3300048918 | Ga0496115_0617577 | Ga0496115_0617577_459_728 | 89 |
| 373 | 3300048920 | Ga0496117_0017993 | Ga0496117_0017993_2008_2277 | 89 |
| 374 | 3300048921 | Ga0496118_0045487 | Ga0496118_0045487_231_500 | 89 |
| 375 | 3300048921 | Ga0496118_0160081 | Ga0496118_0160081_16_312 | 89 |
| 376 | 3300048921 | Ga0496118_0248334 | Ga0496118_0248334_39_311 | 89 |
| 377 | 3300048922 | Ga0496119_0008509 | Ga0496119_0008509_4681_4950 | 89 |
| 378 | 3300048922 | Ga0496119_0023086 | Ga0496119_0023086_2475_2771 | 89 |
| 379 | 3300048923 | Ga0496120_0001144 | Ga0496120_0001144_8555_8824 | 89 |
| 380 | 3300048925 | Ga0496122_0001463 | Ga0496122_0001463_31979_32275 | 89 |
| 381 | 3300048927 | Ga0496124_0681840 | Ga0496124_0681840_40_339 | 89 |
| 382 | 3300048928 | Ga0496125_0000086 | Ga0496125_0000086_41575_41871 | 89 |
| 383 | 3300048929 | Ga0496126_0752176 | Ga0496126_0752176_277_576 | 89 |
| 384 | 3300049577 | Ga0501041_0086701 | Ga0501041_0086701_30_299 | 89 |
| 385 | 3300049592 | Ga0501076_0861181 | Ga0501076_0861181_248_517 | 89 |
| 386 | 3300049741 | Ga0501079_0489366 | Ga0501079_0489366_253_522 | 89 |
| 387 | 3300049824 | Ga0501045_0533086 | Ga0501045_0533086_341_610 | 89 |
| 388 | 3300050507 | nmdc:mga05p37_484144_c1 | nmdc:mga05p37_484144_c1_823_1092 | 89 |
| 389 | 3300059605 | Ga0587106_149039 | Ga0587106_149039_159_437 | 89 |
| 390 | 3300044656 | Ga0466969_0015566 | Ga0466969_0015566_294_578 | 91 |
| 391 | 3300044658 | Ga0466972_0649552 | Ga0466972_0649552_77_355 | 91 |
| 392 | 3300044684 | Ga0466966_0006655 | Ga0466966_0006655_1097_1381 | 91 |
| 393 | 3300044693 | Ga0466961_0003356 | Ga0466961_0003356_6983_7267 | 91 |
| 394 | 3300044693 | Ga0466961_0259900 | Ga0466961_0259900_92_370 | 91 |
| 395 | 3300044765 | Ga0466970_0067956 | Ga0466970_0067956_52_336 | 91 |
| 396 | 3300045049 | Ga0466959_0593254 | Ga0466959_0593254_174_458 | 91 |
| 397 | 3300049586 | Ga0501070_0696894 | Ga0501070_0696894_281_559 | 91 |
| 398 | 3300003578 | Ga0006562J51391_1013352 | Ga0006562J51391_10133522 | 92 |
| 399 | 3300005328 | Ga0070676_10547907 | Ga0070676_105479072 | 92 |
| 400 | 3300005331 | Ga0070670_102091382 | Ga0070670_1020913822 | 92 |
| 401 | 3300005333 | Ga0070677_10147791 | Ga0070677_101477911 | 92 |
| 402 | 3300011119 | Ga0105246_10111711 | Ga0105246_101117112 | 92 |
| 403 | 3300013100 | Ga0157373_10002429 | Ga0157373_1000242910 | 92 |
| 404 | 3300013102 | Ga0157371_10194729 | Ga0157371_101947292 | 92 |
| 405 | 3300013104 | Ga0157370_10001553 | Ga0157370_1000155314 | 92 |
| 406 | 3300025893 | Ga0207682_10025021 | Ga0207682_100250212 | 92 |
| 407 | 3300025914 | Ga0207671_11163081 | Ga0207671_111630812 | 92 |
| 408 | 3300025925 | Ga0207650_10508087 | Ga0207650_105080871 | 92 |
| 409 | 3300026121 | Ga0207683_11549240 | Ga0207683_115492401 | 92 |
| 410 | 3300031911 | Ga0307412_11919829 | Ga0307412_119198292 | 92 |
| 411 | 3300031995 | Ga0307409_100424863 | Ga0307409_1004248631 | 92 |
| 412 | 3300049593 | Ga0501077_0671175 | Ga0501077_0671175_252_530 | 92 |
| 413 | 3300002070 | JGI24750J21931_1064211 | JGI24750J21931_10642112 | 93 |
| 414 | 3300005328 | Ga0070676_10021692 | Ga0070676_100216924 | 93 |
| 415 | 3300005331 | Ga0070670_100697905 | Ga0070670_1006979052 | 93 |
| 416 | 3300005333 | Ga0070677_10001852 | Ga0070677_100018524 | 93 |
| 417 | 3300005335 | Ga0070666_10032554 | Ga0070666_100325544 | 93 |
| 418 | 3300005347 | Ga0070668_100031497 | Ga0070668_1000314971 | 93 |
| 419 | 3300005353 | Ga0070669_100014380 | Ga0070669_1000143804 | 93 |
| 420 | 3300005354 | Ga0070675_100579618 | Ga0070675_1005796181 | 93 |
| 421 | 3300005355 | Ga0070671_100033741 | Ga0070671_1000337414 | 93 |
| 422 | 3300005356 | Ga0070674_100142812 | Ga0070674_1001428121 | 93 |
| 423 | 3300005356 | Ga0070674_100624009 | Ga0070674_1006240092 | 93 |
| 424 | 3300005364 | Ga0070673_100037250 | Ga0070673_1000372502 | 93 |
| 425 | 3300005367 | Ga0070667_100285354 | Ga0070667_1002853542 | 93 |
| 426 | 3300005444 | Ga0070694_101507830 | Ga0070694_1015078301 | 93 |
| 427 | 3300005455 | Ga0070663_101194801 | Ga0070663_1011948011 | 93 |
| 428 | 3300005456 | Ga0070678_100057391 | Ga0070678_1000573912 | 93 |
| 429 | 3300005548 | Ga0070665_100096666 | Ga0070665_1000966662 | 93 |
| 430 | 3300005615 | Ga0070702_100228459 | Ga0070702_1002284592 | 93 |
| 431 | 3300005834 | Ga0068851_10074414 | Ga0068851_100744142 | 93 |
| 432 | 3300005841 | Ga0068863_102367389 | Ga0068863_1023673891 | 93 |
| 433 | 3300006178 | Ga0075367_10334963 | Ga0075367_103349632 | 93 |
| 434 | 3300009011 | Ga0105251_10014182 | Ga0105251_100141823 | 93 |
| 435 | 3300009036 | Ga0105244_10073228 | Ga0105244_100732283 | 93 |
| 436 | 3300009092 | Ga0105250_10057020 | Ga0105250_100570202 | 93 |
| 437 | 3300009098 | Ga0105245_10129116 | Ga0105245_101291162 | 93 |
| 438 | 3300009101 | Ga0105247_10183130 | Ga0105247_101831301 | 93 |
| 439 | 3300009148 | Ga0105243_10175674 | Ga0105243_101756743 | 93 |
| 440 | 3300009174 | Ga0105241_10058352 | Ga0105241_100583524 | 93 |
| 441 | 3300009176 | Ga0105242_10075285 | Ga0105242_100752852 | 93 |
| 442 | 3300009177 | Ga0105248_10043912 | Ga0105248_100439122 | 93 |
| 443 | 3300009553 | Ga0105249_10402529 | Ga0105249_104025292 | 93 |
| 444 | 3300010375 | Ga0105239_12061179 | Ga0105239_120611791 | 93 |
| 445 | 3300011119 | Ga0105246_10725211 | Ga0105246_107252112 | 93 |
| 446 | 3300011119 | Ga0105246_10782143 | Ga0105246_107821432 | 93 |
| 447 | 3300013102 | Ga0157371_10039986 | Ga0157371_100399864 | 93 |
| 448 | 3300013105 | Ga0157369_10026122 | Ga0157369_100261224 | 93 |
| 449 | 3300013306 | Ga0163162_10152310 | Ga0163162_101523102 | 93 |
| 450 | 3300013306 | Ga0163162_11139102 | Ga0163162_111391022 | 93 |
| 451 | 3300013306 | Ga0163162_12313665 | Ga0163162_123136651 | 93 |
| 452 | 3300013308 | Ga0157375_10065716 | Ga0157375_100657164 | 93 |
| 453 | 3300013308 | Ga0157375_11526845 | Ga0157375_115268451 | 93 |
| 454 | 3300013308 | Ga0157375_11586277 | Ga0157375_115862772 | 93 |
| 455 | 3300014745 | Ga0157377_11105324 | Ga0157377_111053242 | 93 |
| 456 | 3300014969 | Ga0157376_11842035 | Ga0157376_118420352 | 93 |
| 457 | 3300017792 | Ga0163161_11011915 | Ga0163161_110119151 | 93 |
| 458 | 3300025315 | Ga0207697_10000589 | Ga0207697_100005898 | 93 |
| 459 | 3300025728 | Ga0207655_1010969 | Ga0207655_10109692 | 93 |
| 460 | 3300025728 | Ga0207655_1160524 | Ga0207655_11605241 | 93 |
| 461 | 3300025735 | Ga0207713_1027753 | Ga0207713_10277532 | 93 |
| 462 | 3300025893 | Ga0207682_10003529 | Ga0207682_100035293 | 93 |
| 463 | 3300025900 | Ga0207710_10738742 | Ga0207710_107387422 | 93 |
| 464 | 3300025903 | Ga0207680_10453589 | Ga0207680_104535892 | 93 |
| 465 | 3300025907 | Ga0207645_10081976 | Ga0207645_100819762 | 93 |
| 466 | 3300025911 | Ga0207654_10826127 | Ga0207654_108261272 | 93 |
| 467 | 3300025923 | Ga0207681_10102622 | Ga0207681_101026223 | 93 |
| 468 | 3300025925 | Ga0207650_10025618 | Ga0207650_100256181 | 93 |
| 469 | 3300025925 | Ga0207650_10752589 | Ga0207650_107525891 | 93 |
| 470 | 3300025926 | Ga0207659_10390474 | Ga0207659_103904741 | 93 |
| 471 | 3300025927 | Ga0207687_10905968 | Ga0207687_109059682 | 93 |
| 472 | 3300025931 | Ga0207644_10016049 | Ga0207644_100160492 | 93 |
| 473 | 3300025934 | Ga0207686_11558112 | Ga0207686_115581121 | 93 |
| 474 | 3300025937 | Ga0207669_10464682 | Ga0207669_104646822 | 93 |
| 475 | 3300025940 | Ga0207691_10000237 | Ga0207691_1000023718 | 93 |
| 476 | 3300025941 | Ga0207711_10193393 | Ga0207711_101933932 | 93 |
| 477 | 3300025960 | Ga0207651_10015376 | Ga0207651_100153762 | 93 |
| 478 | 3300025961 | Ga0207712_10339997 | Ga0207712_103399972 | 93 |
| 479 | 3300025986 | Ga0207658_10093201 | Ga0207658_100932011 | 93 |
| 480 | 3300026067 | Ga0207678_10966692 | Ga0207678_109666921 | 93 |
| 481 | 3300026121 | Ga0207683_10001134 | Ga0207683_1000113419 | 93 |
| 482 | 3300026121 | Ga0207683_10406543 | Ga0207683_104065433 | 93 |
| 483 | 3300028379 | Ga0268266_10091683 | Ga0268266_100916832 | 93 |
| 484 | 3300046453 | Ga0495627_152795 | Ga0495627_152795_213_494 | 93 |
| 485 | 3300046459 | Ga0495629_0228444 | Ga0495629_0228444_117_398 | 93 |
| 486 | 3300046460 | Ga0495638_0536646 | Ga0495638_0536646_95_376 | 93 |
| 487 | 3300046463 | Ga0495653_0026926 | Ga0495653_0026926_4171_4452 | 93 |
| 488 | 3300046473 | Ga0495582_0081134 | Ga0495582_0081134_1421_1702 | 93 |
| 489 | 3300046473 | Ga0495582_0578746 | Ga0495582_0578746_332_613 | 93 |
| 490 | 3300046476 | Ga0495662_0016851 | Ga0495662_0016851_2123_2404 | 93 |
| 491 | 3300046477 | Ga0495664_0053816 | Ga0495664_0053816_1027_1308 | 93 |
| 492 | 3300046499 | Ga0495594_0180273 | Ga0495594_0180273_127_408 | 93 |
| 493 | 3300046499 | Ga0495594_0256522 | Ga0495594_0256522_480_761 | 93 |
| 494 | 3300046501 | Ga0495607_0233681 | Ga0495607_0233681_77_358 | 93 |
| 495 | 3300046518 | Ga0495631_0068846 | Ga0495631_0068846_1201_1482 | 93 |
| 496 | 3300046525 | Ga0495663_0082396 | Ga0495663_0082396_603_884 | 93 |
| 497 | 3300046528 | Ga0495642_0202928 | Ga0495642_0202928_521_802 | 93 |
| 498 | 3300046528 | Ga0495642_0564015 | Ga0495642_0564015_28_309 | 93 |
| 499 | 3300046531 | Ga0495665_0054458 | Ga0495665_0054458_897_1178 | 93 |
| 500 | 3300046535 | Ga0495586_0014805 | Ga0495586_0014805_2116_2397 | 93 |
| 501 | 3300046535 | Ga0495586_0032444 | Ga0495586_0032444_71_352 | 93 |
| 502 | 3300046535 | Ga0495586_0294669 | Ga0495586_0294669_614_895 | 93 |
| 503 | 3300046536 | Ga0495587_0007088 | Ga0495587_0007088_357_638 | 93 |
| 504 | 3300046543 | Ga0495645_0001343 | Ga0495645_0001343_2980_3261 | 93 |
| 505 | 3300046558 | Ga0495633_0297237 | Ga0495633_0297237_403_684 | 93 |
| 506 | 3300046559 | Ga0495667_0000400 | Ga0495667_0000400_4578_4859 | 93 |
| 507 | 3300046615 | Ga0495656_0021813 | Ga0495656_0021813_1544_1825 | 93 |
| 508 | 3300046616 | Ga0495668_0035236 | Ga0495668_0035236_1973_2254 | 93 |
| 509 | 3300046663 | Ga0495635_0040941 | Ga0495635_0040941_2840_3121 | 93 |
| 510 | 3300046664 | Ga0495659_0006908 | Ga0495659_0006908_1070_1351 | 93 |
| 511 | 3300046665 | Ga0495661_0108037 | Ga0495661_0108037_484_765 | 93 |
| 512 | 3300046674 | Ga0495588_0009386 | Ga0495588_0009386_4198_4479 | 93 |
| 513 | 3300046675 | Ga0495657_0151595 | Ga0495657_0151595_1060_1341 | 93 |
| 514 | 3300046679 | Ga0495623_0477681 | Ga0495623_0477681_337_618 | 93 |
| 515 | 3300046689 | Ga0495613_0216900 | Ga0495613_0216900_970_1251 | 93 |
| 516 | 3300046691 | Ga0495670_0008175 | Ga0495670_0008175_3337_3618 | 93 |
| 517 | 3300046691 | Ga0495670_0061062 | Ga0495670_0061062_1584_1865 | 93 |
| 518 | 3300046691 | Ga0495670_0158465 | Ga0495670_0158465_37_318 | 93 |
| 519 | 3300046692 | Ga0495671_0569407 | Ga0495671_0569407_213_494 | 93 |
| 520 | 3300046809 | Ga0495600_0104835 | Ga0495600_0104835_873_1154 | 93 |
| 521 | 3300047315 | Ga0495581_0017005 | Ga0495581_0017005_656_937 | 93 |
| 522 | 3300047315 | Ga0495581_0138978 | Ga0495581_0138978_200_481 | 93 |
| 523 | 3300047318 | Ga0495636_0052488 | Ga0495636_0052488_100_381 | 93 |
| 524 | 3300047322 | Ga0495680_0066879 | Ga0495680_0066879_165_446 | 93 |
| 525 | 3300047444 | Ga0495675_0020175 | Ga0495675_0020175_3515_3796 | 93 |
| 526 | 3300047445 | Ga0495677_0087734 | Ga0495677_0087734_822_1103 | 93 |
| 527 | 3300047445 | Ga0495677_0378594 | Ga0495677_0378594_23_304 | 93 |
| 528 | 3300047447 | Ga0495685_001941 | Ga0495685_001941_3633_3914 | 93 |
| 529 | 3300047470 | Ga0495681_0075932 | Ga0495681_0075932_954_1235 | 93 |
| 530 | 3300047673 | Ga0495593_0196185 | Ga0495593_0196185_321_602 | 93 |
| 531 | 3300048903 | Ga0496100_0022120 | Ga0496100_0022120_1390_1671 | 93 |
| 532 | 3300048903 | Ga0496100_0296497 | Ga0496100_0296497_859_1140 | 93 |
| 533 | 3300048903 | Ga0496100_1072523 | Ga0496100_1072523_305_586 | 93 |
| 534 | 3300048904 | Ga0496101_0035154 | Ga0496101_0035154_1389_1670 | 93 |
| 535 | 3300048904 | Ga0496101_0479118 | Ga0496101_0479118_470_751 | 93 |
| 536 | 3300048904 | Ga0496101_1219326 | Ga0496101_1219326_28_309 | 93 |
| 537 | 3300048905 | Ga0496102_0077082 | Ga0496102_0077082_823_1104 | 93 |
| 538 | 3300048905 | Ga0496102_0084267 | Ga0496102_0084267_60_341 | 93 |
| 539 | 3300048905 | Ga0496102_0114118 | Ga0496102_0114118_1200_1481 | 93 |
| 540 | 3300048905 | Ga0496102_0153088 | Ga0496102_0153088_476_757 | 93 |
| 541 | 3300048906 | Ga0496103_0017773 | Ga0496103_0017773_2662_2943 | 93 |
| 542 | 3300048906 | Ga0496103_0050477 | Ga0496103_0050477_1531_1812 | 93 |
| 543 | 3300048906 | Ga0496103_1050451 | Ga0496103_1050451_134_415 | 93 |
| 544 | 3300048907 | Ga0496104_0319113 | Ga0496104_0319113_248_529 | 93 |
| 545 | 3300048908 | Ga0496105_0087328 | Ga0496105_0087328_1519_1800 | 93 |
| 546 | 3300048909 | Ga0496106_0710831 | Ga0496106_0710831_104_385 | 93 |
| 547 | 3300048910 | Ga0496107_0161142 | Ga0496107_0161142_1042_1323 | 93 |
| 548 | 3300048911 | Ga0496108_0235591 | Ga0496108_0235591_311_592 | 93 |
| 549 | 3300048911 | Ga0496108_0326237 | Ga0496108_0326237_1001_1282 | 93 |
| 550 | 3300048912 | Ga0496109_0020366 | Ga0496109_0020366_2093_2374 | 93 |
| 551 | 3300048913 | Ga0496110_0054530 | Ga0496110_0054530_2362_2643 | 93 |
| 552 | 3300048913 | Ga0496110_0078277 | Ga0496110_0078277_1001_1282 | 93 |
| 553 | 3300048913 | Ga0496110_0100278 | Ga0496110_0100278_460_741 | 93 |
| 554 | 3300048914 | Ga0496111_0057359 | Ga0496111_0057359_405_686 | 93 |
| 555 | 3300048914 | Ga0496111_0061448 | Ga0496111_0061448_2224_2505 | 93 |
| 556 | 3300048914 | Ga0496111_1058555 | Ga0496111_1058555_66_347 | 93 |
| 557 | 3300048915 | Ga0496112_0379065 | Ga0496112_0379065_213_494 | 93 |
| 558 | 3300048916 | Ga0496113_0095752 | Ga0496113_0095752_1243_1524 | 93 |
| 559 | 3300048917 | Ga0496114_0107321 | Ga0496114_0107321_1521_1802 | 93 |
| 560 | 3300048917 | Ga0496114_0125230 | Ga0496114_0125230_22_303 | 93 |
| 561 | 3300048927 | Ga0496124_0314190 | Ga0496124_0314190_292_573 | 93 |
| 562 | 3300048928 | Ga0496125_0331632 | Ga0496125_0331632_570_851 | 93 |
| 563 | 3300050494 | nmdc:mga06z11_127902_c1 | nmdc:mga06z11_127902_c1_48_329 | 93 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ccd-assembly1.cif.gz_A | 1.0 a structure of post-succinimide his15asp hpr | 0.9403 | 1 | 86 |
| 3ihs-assembly2.cif.gz_B | crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames | 0.938 | 2 | 86 |
| 1opd-assembly1.cif.gz_A | histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) | 0.9328 | 1 | 87 |
| 5ya0-assembly1.cif.gz_C | crystal structure of lsrk and hpr complex | 0.9291 | 1 | 86 |
| 1cm3-assembly1.cif.gz_A | his15asp hpr from e. coli | 0.9273 | 1 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ccdB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9401 | 1 | 86 | 3.30.1340.10 |
| af_P37349_156_242_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9209 | 2 | 87 | 3.30.1340.10 |
| af_P69811_287_371_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.92 | 4 | 86 | 3.30.1340.10 |
| 3ihsB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.904 | 2 | 86 | 3.30.1340.10 |
| 1pchA00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.889 | 2 | 85 | 3.30.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A345VA70-F1-model_v4 | HPr family phosphocarrier protein | 1.003 | 1 | 93 |
GO:0005737
GO:0009401 |
| AF-A0A4R7KS02-F1-model_v4 | deleted | 1 | 1 | 92 |
|
| AF-A0A176UDN9-F1-model_v4 | deleted | 1 | 1 | 92 |
|
| AF-A0A0V8HSN3-F1-model_v4 | Phosphotransferase | 0.9965 | 1 | 93 |
GO:0005737
GO:0009401 GO:0016740 |
| AF-A0A024H7M4-F1-model_v4 | Phosphocarrier protein HPr (EC 2.7.11.-) | 0.9946 | 12 | 93 |
GO:0005737
GO:0009401 GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar