F464021

General Info

Members Datasets Scaffolds Average Seq Length
563 315 545 90

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101212286|Ga0070678_1012122861
Length 99
Sequence MPQRTVVVASRVGLHARPAMLFTQAVATSGIPVTIARPGGEPVDAGSILFVMSLGVPHGEEVTLAADGVGAEGVLDDLVALLATDLDAEDAPASSGGAS

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
5 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
6 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
7 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
8 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
9 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
10 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
11 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
12 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
13 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
14 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
162 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
186 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
191 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
305 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
313 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
314 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
315 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 1.78
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 14.39
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1064211 3300002070 Bacteria 591
2 Ga0007423J48922_101310 3300003285 Bacteria 1560
3 rootH1_10128615 3300003316 Bacteria 1038
4 rootH2_10020571 3300003320 Bacteria 4790
5 rootH2_10197868 3300003320 Bacteria 1288
6 rootL2_10224527 3300003322 Bacteria 1387
7 Ga0006562J51391_1013352 3300003578 Bacteria 1563
8 Ga0070676_10021692 3300005328 Bacteria 3596
9 Ga0070676_10547907 3300005328 Bacteria 827
10 Ga0070670_100459446 3300005331 Bacteria 1129
11 Ga0070670_100697905 3300005331 Bacteria 912
12 Ga0070670_102091382 3300005331 Bacteria 522
13 Ga0070677_10001852 3300005333 Bacteria 6687
14 Ga0070677_10147791 3300005333 Bacteria 1091
15 Ga0070666_10032554 3300005335 Bacteria 3444
16 Ga0070680_101021565 3300005336 Bacteria 714
17 Ga0070682_100748526 3300005337 Unclassified 789
18 Ga0070682_100753093 3300005337 Bacteria 787
19 Ga0070687_101321414 3300005343 Bacteria 536
20 Ga0070668_100031497 3300005347 Bacteria 4035
21 Ga0070668_100727700 3300005347 Bacteria 877
22 Ga0070669_100014380 3300005353 Bacteria 5632
23 Ga0070675_100579618 3300005354 Bacteria 1016
24 Ga0070675_101386288 3300005354 Bacteria 648
25 Ga0070671_100033741 3300005355 Bacteria 4235
26 Ga0070674_100142812 3300005356 Bacteria 1798
27 Ga0070674_100624009 3300005356 Bacteria 914
28 Ga0070674_101097040 3300005356 Bacteria 703
29 Ga0070674_101358603 3300005356 Bacteria 635
30 Ga0070673_100037250 3300005364 Bacteria 3704
31 Ga0070659_100778811 3300005366 Bacteria 831
32 Ga0070667_100285354 3300005367 Bacteria 1483
33 Ga0070709_10631588 3300005434 Bacteria 827
34 Ga0070714_100019901 3300005435 Bacteria 5476
35 Ga0070714_100047254 3300005435 Bacteria 3656
36 Ga0070714_100221296 3300005435 Bacteria 1740
37 Ga0070713_100099763 3300005436 Bacteria 2513
38 Ga0070710_10000488 3300005437 Bacteria 18637
39 Ga0070710_10239328 3300005437 Bacteria 1162
40 Ga0070711_100071802 3300005439 Bacteria 2441
41 Ga0070694_101507830 3300005444 Bacteria 569
42 Ga0070663_100005873 3300005455 Bacteria 7338
43 Ga0070663_100100437 3300005455 Bacteria 2158
44 Ga0070663_100229589 3300005455 Bacteria 1461
45 Ga0070663_101194801 3300005455 Bacteria 668
46 Ga0070678_100057391 3300005456 Bacteria 2852
47 Ga0070678_100093681 3300005456 Bacteria 2310
48 Ga0070678_101212286 3300005456 Bacteria 700
49 Ga0070678_101710889 3300005456 Bacteria 592
50 Ga0070681_12005962 3300005458 Bacteria 507
51 Ga0068867_100795767 3300005459 Bacteria 843
52 Ga0070684_102027669 3300005535 Unclassified 543
53 Ga0070697_100776208 3300005536 Unclassified 847
54 Ga0068853_100106550 3300005539 Bacteria 2485
55 Ga0070672_101088797 3300005543 Bacteria 710
56 Ga0070693_101611554 3300005547 Bacteria 510
57 Ga0070665_100096666 3300005548 Bacteria 2958
58 Ga0070665_100655757 3300005548 Bacteria 1062
59 Ga0070665_100661226 3300005548 Bacteria 1058
60 Ga0070665_101949970 3300005548 Unclassified 593
61 Ga0068855_100014360 3300005563 Bacteria 9536
62 Ga0070664_101096989 3300005564 Bacteria 749
63 Ga0068854_100008723 3300005578 Bacteria 6526
64 Ga0068854_100798859 3300005578 Bacteria 822
65 Ga0068856_100164625 3300005614 Bacteria 2229
66 Ga0068856_100914650 3300005614 Unclassified 896
67 Ga0068856_101962233 3300005614 Bacteria 596
68 Ga0070702_100228459 3300005615 Bacteria 1249
69 Ga0068852_100383398 3300005616 Bacteria 1379
70 Ga0068852_101136672 3300005616 Bacteria 802
71 Ga0068864_100873975 3300005618 Bacteria 887
72 Ga0068864_100956659 3300005618 Archaea 848
73 Ga0068864_101965956 3300005618 Bacteria 591
74 Ga0068851_10074414 3300005834 Bacteria 1763
75 Ga0068851_10741495 3300005834 Bacteria 607
76 Ga0068870_10435544 3300005840 Unclassified 861
77 Ga0068863_102367389 3300005841 Bacteria 541
78 Ga0068858_101470105 3300005842 Bacteria 672
79 Ga0068860_101452639 3300005843 Bacteria 707
80 Ga0081539_10000904 3300005985 Bacteria 56318
81 Ga0075365_10014815 3300006038 Bacteria 4698
82 Ga0075365_10169808 3300006038 Bacteria 1522
83 Ga0075365_10267560 3300006038 Bacteria 1202
84 Ga0075364_10014520 3300006051 Bacteria 4868
85 Ga0075364_10336205 3300006051 Bacteria 1029
86 Ga0075364_10735929 3300006051 Bacteria 673
87 Ga0070712_100214737 3300006175 Bacteria 1519
88 Ga0070712_101461223 3300006175 Bacteria 597
89 Ga0075367_10334963 3300006178 Bacteria 954
90 Ga0075369_10006349 3300006186 Bacteria 4466
91 Ga0097621_100841766 3300006237 Bacteria 852
92 Ga0068871_101535109 3300006358 Bacteria 630
93 Ga0068865_100840650 3300006881 Bacteria 795
94 Ga0105251_10014182 3300009011 Bacteria 4421
95 Ga0105244_10073228 3300009036 Bacteria 1705
96 Ga0105250_10057020 3300009092 Bacteria 1567
97 Ga0105240_10045269 3300009093 Bacteria 5583
98 Ga0105245_10129116 3300009098 Bacteria 2369
99 Ga0105245_10656852 3300009098 Bacteria 1079
100 Ga0105245_10945921 3300009098 Bacteria 904
101 Ga0105245_11492590 3300009098 Bacteria 727
102 Ga0105245_11557889 3300009098 Bacteria 712
103 Ga0105247_10183130 3300009101 Bacteria 1399
104 Ga0105247_10928893 3300009101 Bacteria 674
105 Ga0114129_10358527 3300009147 Bacteria 1930
106 Ga0105243_10175674 3300009148 Bacteria 1859
107 Ga0105243_10695624 3300009148 Bacteria 990
108 Ga0105241_10003908 3300009174 Bacteria 11040
109 Ga0105241_10058352 3300009174 Bacteria 2964
110 Ga0105241_10606872 3300009174 Bacteria 989
111 Ga0105241_11339257 3300009174 Bacteria 683
112 Ga0105242_10075285 3300009176 Bacteria 2810
113 Ga0105242_12211634 3300009176 Bacteria 595
114 Ga0105248_10043912 3300009177 Bacteria 5013
115 Ga0105237_10039832 3300009545 Bacteria 4741
116 Ga0105238_10012997 3300009551 Bacteria 8404
117 Ga0105238_10016585 3300009551 Bacteria 7458
118 Ga0105249_10402529 3300009553 Bacteria 1399
119 Ga0105028_125212 3300009993 Bacteria 656
120 Ga0105239_10033587 3300010375 Bacteria 5632
121 Ga0105239_10651195 3300010375 Bacteria 1203
122 Ga0105239_10785927 3300010375 Bacteria 1090
123 Ga0105239_12061179 3300010375 Bacteria 663
124 Ga0105246_10111711 3300011119 Bacteria 2009
125 Ga0105246_10351352 3300011119 Bacteria 1208
126 Ga0105246_10725211 3300011119 Bacteria 874
127 Ga0105246_10780910 3300011119 Bacteria 845
128 Ga0105246_10782143 3300011119 Bacteria 845
129 Ga0157373_10002429 3300013100 Bacteria 14177
130 Ga0157371_10039986 3300013102 Bacteria 3351
131 Ga0157371_10194729 3300013102 Bacteria 1452
132 Ga0157370_10001553 3300013104 Bacteria 28453
133 Ga0157370_10422079 3300013104 Bacteria 1227
134 Ga0157369_10026122 3300013105 Bacteria 6479
135 Ga0157369_10716938 3300013105 Bacteria 1030
136 Ga0157369_12221445 3300013105 Bacteria 556
137 Ga0157374_11446022 3300013296 Bacteria 710
138 Ga0163162_10152310 3300013306 Bacteria 2430
139 Ga0163162_11139102 3300013306 Bacteria 884
140 Ga0163162_11304463 3300013306 Unclassified 825
141 Ga0163162_11732832 3300013306 Bacteria 714
142 Ga0163162_12313665 3300013306 Bacteria 617
143 Ga0163162_13396826 3300013306 Bacteria 508
144 Ga0157375_10065716 3300013308 Bacteria 3617
145 Ga0157375_10708744 3300013308 Bacteria 1160
146 Ga0157375_10781878 3300013308 Bacteria 1104
147 Ga0157375_11177794 3300013308 Bacteria 899
148 Ga0157375_11526845 3300013308 Bacteria 789
149 Ga0157375_11586277 3300013308 Bacteria 774
150 Ga0163163_10207030 3300014325 Bacteria 2010
151 Ga0163163_10393166 3300014325 Bacteria 1444
152 Ga0163163_10831646 3300014325 Bacteria 987
153 Ga0163163_11434369 3300014325 Bacteria 752
154 Ga0157380_10294065 3300014326 Bacteria 1493
155 Ga0157380_10989620 3300014326 Bacteria 874
156 Ga0157380_12098743 3300014326 Bacteria 628
157 Ga0157380_12284024 3300014326 Bacteria 605
158 Ga0157377_10241650 3300014745 Bacteria 1166
159 Ga0157377_11105324 3300014745 Bacteria 607
160 Ga0157379_10764292 3300014968 Bacteria 910
161 Ga0157376_10598063 3300014969 Bacteria 1097
162 Ga0157376_11278154 3300014969 Bacteria 763
163 Ga0157376_11474479 3300014969 Bacteria 713
164 Ga0157376_11655312 3300014969 Bacteria 675
165 Ga0157376_11842035 3300014969 Bacteria 642
166 Ga0157376_12045770 3300014969 Unclassified 611
167 Ga0163161_11011915 3300017792 Bacteria 710
168 Ga0163161_11708019 3300017792 Bacteria 558
169 Ga0197907_10301419 3300020069 Bacteria 628
170 Ga0197907_10902729 3300020069 Unclassified 858
171 Ga0206349_1667466 3300020075 Bacteria 830
172 Ga0206354_11278698 3300020081 Bacteria 797
173 Ga0206353_10933170 3300020082 Bacteria 505
174 Ga0224712_10004814 3300022467 Bacteria 3686
175 Ga0224712_10065986 3300022467 Bacteria 1456
176 Ga0207697_10000589 3300025315 Bacteria 20692
177 Ga0207655_1010969 3300025728 Bacteria 5443
178 Ga0207655_1160524 3300025728 Bacteria 703
179 Ga0207713_1027753 3300025735 Bacteria 2566
180 Ga0207682_10003529 3300025893 Bacteria 6767
181 Ga0207682_10025021 3300025893 Bacteria 2366
182 Ga0207692_10000267 3300025898 Bacteria 17819
183 Ga0207692_10612402 3300025898 Bacteria 701
184 Ga0207642_10575991 3300025899 Unclassified 698
185 Ga0207710_10738742 3300025900 Bacteria 517
186 Ga0207688_10020257 3300025901 Bacteria 3631
187 Ga0207688_10990015 3300025901 Bacteria 532
188 Ga0207680_10453589 3300025903 Bacteria 910
189 Ga0207680_11003995 3300025903 Bacteria 598
190 Ga0207647_10015074 3300025904 Bacteria 5312
191 Ga0207647_10487922 3300025904 Bacteria 688
192 Ga0207699_10262740 3300025906 Bacteria 1194
193 Ga0207645_10081976 3300025907 Bacteria 2068
194 Ga0207643_10771973 3300025908 Unclassified 622
195 Ga0207654_10014151 3300025911 Bacteria 4117
196 Ga0207654_10826127 3300025911 Bacteria 670
197 Ga0207707_10575648 3300025912 Bacteria 955
198 Ga0207695_10015018 3300025913 Bacteria 9137
199 Ga0207671_10005109 3300025914 Bacteria 12236
200 Ga0207671_11163081 3300025914 Bacteria 604
201 Ga0207693_10149798 3300025915 Bacteria 1835
202 Ga0207663_10168855 3300025916 Bacteria 1552
203 Ga0207660_11080861 3300025917 Bacteria 654
204 Ga0207662_10197649 3300025918 Bacteria 1300
205 Ga0207657_10130366 3300025919 Bacteria 2061
206 Ga0207652_10020785 3300025921 Bacteria 5410
207 Ga0207652_11384217 3300025921 Bacteria 607
208 Ga0207681_10102622 3300025923 Bacteria 2065
209 Ga0207694_10004186 3300025924 Bacteria 11320
210 Ga0207650_10025618 3300025925 Bacteria 4202
211 Ga0207650_10508087 3300025925 Bacteria 1008
212 Ga0207650_10752589 3300025925 Bacteria 825
213 Ga0207659_10390474 3300025926 Bacteria 1162
214 Ga0207687_10440897 3300025927 Bacteria 1078
215 Ga0207687_10905968 3300025927 Bacteria 755
216 Ga0207687_11576946 3300025927 Bacteria 564
217 Ga0207700_10777054 3300025928 Bacteria 856
218 Ga0207664_10021621 3300025929 Bacteria 4789
219 Ga0207664_10562328 3300025929 Bacteria 1023
220 Ga0207644_10016049 3300025931 Bacteria 5035
221 Ga0207690_11644329 3300025932 Bacteria 537
222 Ga0207686_11558112 3300025934 Bacteria 545
223 Ga0207709_10185437 3300025935 Bacteria 1473
224 Ga0207669_10126726 3300025937 Bacteria 1746
225 Ga0207669_10464682 3300025937 Bacteria 1005
226 Ga0207669_11101663 3300025937 Bacteria 670
227 Ga0207669_11401234 3300025937 Bacteria 595
228 Ga0207691_10000237 3300025940 Bacteria 53889
229 Ga0207691_10806495 3300025940 Bacteria 789
230 Ga0207711_10193393 3300025941 Bacteria 1854
231 Ga0207667_10041259 3300025949 Bacteria 4909
232 Ga0207667_10866385 3300025949 Bacteria 897
233 Ga0207651_10015376 3300025960 Bacteria 4446
234 Ga0207651_10671308 3300025960 Bacteria 911
235 Ga0207712_10339997 3300025961 Bacteria 1244
236 Ga0207668_10836894 3300025972 Bacteria 816
237 Ga0207668_12148526 3300025972 Bacteria 502
238 Ga0207640_10005123 3300025981 Bacteria 7128
239 Ga0207640_11135082 3300025981 Bacteria 693
240 Ga0207658_10093201 3300025986 Bacteria 2341
241 Ga0207677_12116268 3300026023 Bacteria 523
242 Ga0207639_10094320 3300026041 Bacteria 2402
243 Ga0207639_10621897 3300026041 Bacteria 997
244 Ga0207678_10000171 3300026067 Bacteria 54729
245 Ga0207678_10026937 3300026067 Bacteria 5014
246 Ga0207678_10422462 3300026067 Bacteria 1156
247 Ga0207678_10792577 3300026067 Bacteria 836
248 Ga0207678_10966692 3300026067 Bacteria 753
249 Ga0207678_11420043 3300026067 Bacteria 613
250 Ga0207702_10039065 3300026078 Bacteria 3976
251 Ga0207676_11582973 3300026095 Archaea 653
252 Ga0207676_12469689 3300026095 Bacteria 516
253 Ga0207683_10001134 3300026121 Bacteria 24222
254 Ga0207683_10079024 3300026121 Bacteria 2916
255 Ga0207683_10359503 3300026121 Bacteria 1337
256 Ga0207683_10406543 3300026121 Bacteria 1253
257 Ga0207683_11549240 3300026121 Bacteria 612
258 Ga0207683_11789462 3300026121 Bacteria 563
259 Ga0207698_10349583 3300026142 Bacteria 1396
260 Ga0207698_10906914 3300026142 Bacteria 889
261 Ga0268266_10091683 3300028379 Bacteria 2665
262 Ga0268266_10629166 3300028379 Bacteria 1032
263 Ga0268266_10731039 3300028379 Bacteria 955
264 Ga0268266_11431231 3300028379 Unclassified 667
265 Ga0268264_10758746 3300028381 Bacteria 967
266 Ga0307511_10001407 3300030521 Bacteria 25401
267 Ga0314311_1035664 3300030733 Bacteria 501
268 Ga0316178_1029189 3300030735 Bacteria 928
269 Ga0307513_10062578 3300031456 Bacteria 3932
270 Ga0307408_100778177 3300031548 Bacteria 867
271 Ga0307516_10859783 3300031730 Bacteria 571
272 Ga0307405_10645615 3300031731 Bacteria 870
273 Ga0307518_10012292 3300031838 Bacteria 6120
274 Ga0307410_10902300 3300031852 Bacteria 757
275 Ga0307406_12019596 3300031901 Bacteria 516
276 Ga0307406_12039030 3300031901 Bacteria 513
277 Ga0307412_11469274 3300031911 Bacteria 619
278 Ga0307412_11919829 3300031911 Bacteria 547
279 Ga0307409_100424863 3300031995 Bacteria 1276
280 Ga0307409_100658583 3300031995 Bacteria 1042
281 Ga0307409_101582149 3300031995 Bacteria 683
282 Ga0307416_100043846 3300032002 Bacteria 3507
283 Ga0307411_10993493 3300032005 Bacteria 751
284 Ga0307507_10000013 3300033179 Bacteria 242708
285 Ga0307510_10024593 3300033180 Bacteria 6956
286 Ga0395901_2168028 3300038443 Bacteria 500
287 Ga0451787_053604 3300041441 Bacteria 665
288 Ga0451789_0451907 3300041443 Bacteria 564
289 Ga0451789_0688429 3300041443 Bacteria 552
290 Ga0451791_1258843 3300041451 Bacteria 7268
291 Ga0451791_1932489 3300041451 Bacteria 1038
292 Ga0451793_0080236 3300041452 Bacteria 751
293 Ga0451793_0830341 3300041452 Bacteria 7160
294 Ga0451793_1723565 3300041452 Bacteria 632
295 Ga0451797_0391903 3300041453 Bacteria 1119
296 Ga0451797_0803356 3300041453 Bacteria 4085
297 Ga0451797_1541060 3300041453 Bacteria 522
298 Ga0451802_0989911 3300041460 Bacteria 577
299 Ga0451806_430110 3300041462 Bacteria 1495
300 Ga0451807_0220929 3300041486 Bacteria 563
301 Ga0451833_0551454 3300041491 Bacteria 1634
302 Ga0451835_0166726 3300041492 Bacteria 993
303 Ga0451837_1848794 3300041494 Bacteria 669
304 Ga0451839_1303485 3300041496 Bacteria 1371
305 Ga0451841_1438909 3300041498 Bacteria 3181
306 Ga0451847_0546697 3300041503 Bacteria 1192
307 Ga0451843_1298049 3300041509 Bacteria 1997
308 Ga0451853_0297658 3300041512 Bacteria 4268
309 Ga0439433_0180478 3300041999 Bacteria 552
310 Ga0439449_0017257 3300042007 Bacteria 2710
311 Ga0466969_0015566 3300044656 Bacteria 3984
312 Ga0466969_0018954 3300044656 Bacteria 3581
313 Ga0466969_0033764 3300044656 Bacteria 2596
314 Ga0466969_0050256 3300044656 Bacteria 2055
315 Ga0466969_0154149 3300044656 Bacteria 1057
316 Ga0466969_0180599 3300044656 Bacteria 966
317 Ga0466972_0071861 3300044658 Bacteria 1650
318 Ga0466972_0649552 3300044658 Unclassified 500
319 Ga0466965_0000005 3300044683 Bacteria 185168
320 Ga0466966_0006655 3300044684 Bacteria 7656
321 Ga0466966_0017949 3300044684 Bacteria 4672
322 Ga0466961_0003356 3300044693 Bacteria 9993
323 Ga0466961_0073324 3300044693 Bacteria 2171
324 Ga0466961_0126880 3300044693 Bacteria 1600
325 Ga0466961_0259900 3300044693 Bacteria 1065
326 Ga0466961_0334972 3300044693 Bacteria 922
327 Ga0466963_0296862 3300044694 Bacteria 1136
328 Ga0466971_0012806 3300044719 Bacteria 3676
329 Ga0466971_0227732 3300044719 Bacteria 884
330 Ga0466971_0681191 3300044719 Bacteria 516
331 Ga0466970_0016352 3300044765 Bacteria 3822
332 Ga0466970_0067511 3300044765 Bacteria 1920
333 Ga0466970_0067956 3300044765 Bacteria 1914
334 Ga0466970_0196425 3300044765 Bacteria 1122
335 Ga0466970_0283492 3300044765 Bacteria 932
336 Ga0466970_0316275 3300044765 Bacteria 882
337 Ga0466957_0095943 3300044842 Bacteria 1863
338 Ga0466959_0002152 3300045049 Bacteria 12503
339 Ga0466959_0016950 3300045049 Bacteria 5332
340 Ga0466959_0300137 3300045049 Bacteria 1100
341 Ga0466959_0459975 3300045049 Bacteria 862
342 Ga0466959_0593254 3300045049 Bacteria 745
343 Ga0466958_0165839 3300045836 Bacteria 1397
344 Ga0466958_0890648 3300045836 Bacteria 580
345 Ga0466967_0962879 3300045976 Bacteria 849
346 Ga0495627_152795 3300046453 Bacteria 644
347 Ga0495592_0024577 3300046454 Bacteria 4580
348 Ga0495629_0228444 3300046459 Bacteria 1283
349 Ga0495638_0536646 3300046460 Bacteria 584
350 Ga0495641_0339110 3300046461 Bacteria 679
351 Ga0495651_0123638 3300046462 Bacteria 1897
352 Ga0495651_0509157 3300046462 Bacteria 770
353 Ga0495653_0026926 3300046463 Bacteria 4605
354 Ga0495582_0081134 3300046473 Bacteria 1801
355 Ga0495582_0578746 3300046473 Bacteria 650
356 Ga0495639_0694701 3300046475 Unclassified 525
357 Ga0495662_0016851 3300046476 Bacteria 3536
358 Ga0495662_0573810 3300046476 Bacteria 552
359 Ga0495664_0053816 3300046477 Bacteria 2393
360 Ga0495664_0773318 3300046477 Bacteria 565
361 Ga0495664_0872000 3300046477 Bacteria 527
362 Ga0495594_0180273 3300046499 Bacteria 1202
363 Ga0495594_0256522 3300046499 Bacteria 996
364 Ga0495594_0618828 3300046499 Unclassified 614
365 Ga0495594_0890604 3300046499 Bacteria 500
366 Ga0495607_0233681 3300046501 Bacteria 893
367 Ga0495608_0775263 3300046511 Unclassified 567
368 Ga0495628_0021119 3300046516 Bacteria 5361
369 Ga0495631_0068846 3300046518 Bacteria 1531
370 Ga0495644_0134564 3300046523 Bacteria 943
371 Ga0495663_0082396 3300046525 Bacteria 1038
372 Ga0495642_0202928 3300046528 Bacteria 864
373 Ga0495642_0564015 3300046528 Bacteria 505
374 Ga0495652_0005902 3300046529 Bacteria 11454
375 Ga0495652_0102813 3300046529 Bacteria 2314
376 Ga0495665_0054458 3300046531 Bacteria 2113
377 Ga0495665_0496096 3300046531 Bacteria 615
378 Ga0495640_0846273 3300046533 Bacteria 544
379 Ga0495586_0014805 3300046535 Bacteria 4146
380 Ga0495586_0032444 3300046535 Bacteria 2799
381 Ga0495586_0294669 3300046535 Bacteria 929
382 Ga0495587_0007088 3300046536 Bacteria 7269
383 Ga0495645_0001343 3300046543 Bacteria 16622
384 Ga0495645_0043689 3300046543 Bacteria 3269
385 Ga0495622_0033450 3300046557 Bacteria 2399
386 Ga0495633_0297237 3300046558 Bacteria 734
387 Ga0495667_0000400 3300046559 Bacteria 27725
388 Ga0495667_0574851 3300046559 Bacteria 703
389 Ga0495656_0021813 3300046615 Bacteria 2498
390 Ga0495656_0485267 3300046615 Bacteria 654
391 Ga0495668_0035236 3300046616 Bacteria 2805
392 Ga0495635_0040941 3300046663 Bacteria 3201
393 Ga0495635_0441351 3300046663 Bacteria 861
394 Ga0495659_0006908 3300046664 Bacteria 3592
395 Ga0495661_0108037 3300046665 Bacteria 1555
396 Ga0495588_0009386 3300046674 Bacteria 4520
397 Ga0495657_0151595 3300046675 Bacteria 1439
398 Ga0495657_0324982 3300046675 Bacteria 914
399 Ga0495657_0844891 3300046675 Bacteria 522
400 Ga0495623_0162121 3300046679 Bacteria 1313
401 Ga0495623_0477681 3300046679 Bacteria 660
402 Ga0495646_0445467 3300046680 Bacteria 669
403 Ga0495647_0344301 3300046681 Bacteria 678
404 Ga0495658_0490223 3300046683 Bacteria 786
405 Ga0495658_0609242 3300046683 Bacteria 700
406 Ga0495613_0216900 3300046689 Bacteria 1344
407 Ga0495624_0084043 3300046690 Bacteria 1968
408 Ga0495670_0008175 3300046691 Bacteria 5144
409 Ga0495670_0061062 3300046691 Bacteria 1894
410 Ga0495670_0158465 3300046691 Bacteria 1188
411 Ga0495671_0569407 3300046692 Bacteria 539
412 Ga0495600_0104835 3300046809 Bacteria 1842
413 Ga0495600_0481427 3300046809 Bacteria 765
414 Ga0495581_0017005 3300047315 Bacteria 4226
415 Ga0495581_0138978 3300047315 Bacteria 1416
416 Ga0495604_0007863 3300047317 Bacteria 8442
417 Ga0495604_0755044 3300047317 Unclassified 615
418 Ga0495636_0052488 3300047318 Bacteria 1710
419 Ga0495680_0066879 3300047322 Bacteria 2749
420 Ga0495680_0834731 3300047322 Unclassified 600
421 Ga0495675_0020175 3300047444 Bacteria 4236
422 Ga0495677_0087734 3300047445 Bacteria 1170
423 Ga0495677_0378594 3300047445 Bacteria 559
424 Ga0495685_001941 3300047447 Bacteria 6405
425 Ga0495681_0075932 3300047470 Bacteria 1511
426 Ga0495686_0523153 3300047472 Bacteria 622
427 Ga0495593_0196185 3300047673 Bacteria 1015
428 Ga0495593_0574586 3300047673 Unclassified 566
429 Ga0495602_0348160 3300048088 Bacteria 1070
430 Ga0495614_0400662 3300048089 Bacteria 645
431 Ga0496100_0022120 3300048903 Bacteria 3842
432 Ga0496100_0296497 3300048903 Bacteria 1209
433 Ga0496100_0971619 3300048903 Bacteria 668
434 Ga0496100_1072523 3300048903 Bacteria 634
435 Ga0496100_1475808 3300048903 Unclassified 537
436 Ga0496101_0035154 3300048904 Bacteria 3543
437 Ga0496101_0479118 3300048904 Bacteria 982
438 Ga0496101_1219326 3300048904 Bacteria 589
439 Ga0496102_0077082 3300048905 Bacteria 3067
440 Ga0496102_0084267 3300048905 Bacteria 2933
441 Ga0496102_0087643 3300048905 Bacteria 2876
442 Ga0496102_0114118 3300048905 Bacteria 2520
443 Ga0496102_0153088 3300048905 Bacteria 2167
444 Ga0496102_0452898 3300048905 Bacteria 1204
445 Ga0496102_0724256 3300048905 Unclassified 918
446 Ga0496103_0017773 3300048906 Bacteria 4259
447 Ga0496103_0050477 3300048906 Bacteria 2573
448 Ga0496103_0837591 3300048906 Bacteria 579
449 Ga0496103_1050451 3300048906 Bacteria 505
450 Ga0496104_0052525 3300048907 Bacteria 3850
451 Ga0496104_0319113 3300048907 Bacteria 1466
452 Ga0496104_1373252 3300048907 Bacteria 610
453 Ga0496105_0003086 3300048908 Bacteria 12249
454 Ga0496105_0087328 3300048908 Bacteria 2576
455 Ga0496106_0710831 3300048909 Bacteria 800
456 Ga0496107_0161142 3300048910 Bacteria 1662
457 Ga0496107_0912526 3300048910 Bacteria 640
458 Ga0496108_0001930 3300048911 Bacteria 16611
459 Ga0496108_0235591 3300048911 Bacteria 1592
460 Ga0496108_0326237 3300048911 Bacteria 1338
461 Ga0496108_0330988 3300048911 Bacteria 1328
462 Ga0496108_0414683 3300048911 Bacteria 1176
463 Ga0496108_0645757 3300048911 Unclassified 920
464 Ga0496109_0005859 3300048912 Bacteria 10301
465 Ga0496109_0020366 3300048912 Bacteria 5858
466 Ga0496109_0307702 3300048912 Bacteria 1495
467 Ga0496109_0925301 3300048912 Bacteria 810
468 Ga0496109_1152906 3300048912 Bacteria 712
469 Ga0496110_0004866 3300048913 Bacteria 10477
470 Ga0496110_0054530 3300048913 Bacteria 3516
471 Ga0496110_0078277 3300048913 Bacteria 2943
472 Ga0496110_0100278 3300048913 Bacteria 2595
473 Ga0496110_0233282 3300048913 Unclassified 1674
474 Ga0496110_0443085 3300048913 Bacteria 1184
475 Ga0496110_1625460 3300048913 Bacteria 556
476 Ga0496111_0002209 3300048914 Bacteria 11673
477 Ga0496111_0057359 3300048914 Bacteria 2819
478 Ga0496111_0061448 3300048914 Bacteria 2723
479 Ga0496111_0383250 3300048914 Unclassified 1040
480 Ga0496111_0534256 3300048914 Bacteria 862
481 Ga0496111_1058555 3300048914 Bacteria 579
482 Ga0496111_1236015 3300048914 Bacteria 528
483 Ga0496112_0379065 3300048915 Bacteria 1355
484 Ga0496112_1575534 3300048915 Unclassified 570
485 Ga0496113_0024578 3300048916 Bacteria 4284
486 Ga0496113_0095752 3300048916 Bacteria 2294
487 Ga0496114_0002155 3300048917 Bacteria 14988
488 Ga0496114_0091253 3300048917 Bacteria 2587
489 Ga0496114_0107321 3300048917 Bacteria 2389
490 Ga0496114_0125230 3300048917 Bacteria 2214
491 Ga0496114_0156396 3300048917 Bacteria 1979
492 Ga0496114_0194471 3300048917 Bacteria 1775
493 Ga0496114_0438315 3300048917 Bacteria 1157
494 Ga0496114_0693447 3300048917 Bacteria 893
495 Ga0496114_0766916 3300048917 Bacteria 842
496 Ga0496114_1778751 3300048917 Bacteria 504
497 Ga0496115_0617577 3300048918 Bacteria 860
498 Ga0496117_0017993 3300048920 Bacteria 5880
499 Ga0496118_0045487 3300048921 Bacteria 3426
500 Ga0496118_0160081 3300048921 Bacteria 1393
501 Ga0496118_0248334 3300048921 Bacteria 1013
502 Ga0496119_0008509 3300048922 Bacteria 8998
503 Ga0496119_0023086 3300048922 Bacteria 4427
504 Ga0496120_0001144 3300048923 Bacteria 34063
505 Ga0496122_0001463 3300048925 Bacteria 38046
506 Ga0496124_0314190 3300048927 Bacteria 1125
507 Ga0496124_0681840 3300048927 Bacteria 654
508 Ga0496125_0000086 3300048928 Bacteria 216489
509 Ga0496125_0331632 3300048928 Bacteria 917
510 Ga0496126_0080934 3300048929 Bacteria 2873
511 Ga0496126_0489218 3300048929 Bacteria 985
512 Ga0496126_0752176 3300048929 Bacteria 752
513 Ga0496126_1013674 3300048929 Bacteria 622
514 Ga0501034_1411274 3300049571 Bacteria 571
515 Ga0501041_0086701 3300049577 Bacteria 1932
516 Ga0501068_0886420 3300049584 Bacteria 587
517 Ga0501070_0696894 3300049586 Bacteria 803
518 Ga0501076_0861181 3300049592 Bacteria 747
519 Ga0501077_0671175 3300049593 Bacteria 666
520 Ga0501079_0489366 3300049741 Bacteria 967
521 Ga0501079_1426708 3300049741 Unclassified 545
522 Ga0501045_0533086 3300049824 Bacteria 871
523 nmdc:mga00v17_16593_c1 3300050491 Bacteria 4152
524 nmdc:mga00v17_424860_c1 3300050491 Bacteria 863
525 nmdc:mga00v17_560626_c1 3300050491 Bacteria 738
526 nmdc:mga0yw44_297830_c1 3300050492 Bacteria 535
527 nmdc:mga0yw44_35083_c1 3300050492 Bacteria 2945
528 nmdc:mga0yw44_3772_c1 3300050492 Bacteria 6797
529 nmdc:mga06z11_127902_c1 3300050494 Bacteria 1423
530 nmdc:mga05p37_484144_c1 3300050507 Bacteria 1424
531 nmdc:mga0sz30_928_c2 3300050516 Bacteria 9558
532 Ga0495601_0044462 3300053077 Bacteria 2792
533 Ga0495601_0127980 3300053077 Bacteria 1653
534 Ga0495619_0807255 3300053085 Bacteria 634
535 Ga0500556_0000215 3300053104 Bacteria 47104
536 Ga0500562_017949 3300053108 Bacteria 1826
537 Ga0500593_027366 3300053117 Bacteria 2544
538 Ga0500655_000952 3300053133 Bacteria 5580
539 Ga0500559_0000248 3300053136 Bacteria 42720
540 Ga0500573_0111534 3300053140 Bacteria 1530
541 Ga0500616_0025654 3300053153 Bacteria 3268
542 Ga0501084_1641213 3300054114 Bacteria 537
543 Ga0501084_1696731 3300054114 Bacteria 528
544 Ga0587106_149039 3300059605 Bacteria 519
545 Ga0466962_0009366 3300061719 Bacteria 4693

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100008723 Ga0068854_1000087235 74
2 3300025981 Ga0207640_10005123 Ga0207640_100051232 74
3 3300026041 Ga0207639_10094320 Ga0207639_100943205 74
4 iso_pu_bacteria 2585427649 2586062359 84
5 iso_pu_bacteria 2808606522 2809588468 84
6 iso_pu_bacteria 2884994152 2884996376 84
7 iso_pu_bacteria 2899359706 2899366826 84
8 iso_pu_bacteria 2915768154 2915770384 84
9 iso_pu_bacteria 8003314358 8003323955 84
10 3300003322 rootL2_10224527 rootL2_102245272 85
11 3300006038 Ga0075365_10014815 Ga0075365_100148154 85
12 3300006038 Ga0075365_10169808 Ga0075365_101698082 85
13 3300006038 Ga0075365_10267560 Ga0075365_102675602 85
14 3300006051 Ga0075364_10014520 Ga0075364_100145202 85
15 3300006051 Ga0075364_10336205 Ga0075364_103362052 85
16 3300006051 Ga0075364_10735929 Ga0075364_107359292 85
17 3300006186 Ga0075369_10006349 Ga0075369_100063492 85
18 3300041443 Ga0451789_0688429 Ga0451789_0688429_50_307 85
19 3300041486 Ga0451807_0220929 Ga0451807_0220929_106_363 85
20 3300048912 Ga0496109_1152906 Ga0496109_1152906_434_691 85
21 3300048929 Ga0496126_0080934 Ga0496126_0080934_811_1068 85
22 3300050491 nmdc:mga00v17_16593_c1 nmdc:mga00v17_16593_c1_865_1122 85
23 3300050491 nmdc:mga00v17_424860_c1 nmdc:mga00v17_424860_c1_501_758 85
24 3300050491 nmdc:mga00v17_560626_c1 nmdc:mga00v17_560626_c1_47_304 85
25 3300050492 nmdc:mga0yw44_297830_c1 nmdc:mga0yw44_297830_c1_174_431 85
26 3300050492 nmdc:mga0yw44_35083_c1 nmdc:mga0yw44_35083_c1_1331_1588 85
27 3300050492 nmdc:mga0yw44_3772_c1 nmdc:mga0yw44_3772_c1_4566_4823 85
28 3300050516 nmdc:mga0sz30_928_c2 nmdc:mga0sz30_928_c2_957_1214 85
29 3300053104 Ga0500556_0000215 Ga0500556_0000215_21872_22147 85
30 3300053108 Ga0500562_017949 Ga0500562_017949_695_952 85
31 3300053117 Ga0500593_027366 Ga0500593_027366_1951_2226 85
32 3300053133 Ga0500655_000952 Ga0500655_000952_2079_2354 85
33 3300053136 Ga0500559_0000248 Ga0500559_0000248_31549_31824 85
34 3300053153 Ga0500616_0025654 Ga0500616_0025654_371_628 85
35 iso_pu_bacteria 2558860280 2559424600 85
36 iso_pu_bacteria 2643221690 2644502908 85
37 iso_pu_bacteria 2751185734 2753073911 85
38 iso_pu_bacteria 2811994880 2812364430 85
39 iso_pu_bacteria 2844852863 2844854025 85
40 iso_pu_bacteria 2866612099 2866619189 85
41 iso_pu_bacteria 2870622029 2870623356 85
42 iso_pu_bacteria 2870721527 2870725822 85
43 iso_pu_bacteria 2964326757 2964329390 85
44 iso_pu_bacteria 8047710418 8047716818 85
45 3300049571 Ga0501034_1411274 Ga0501034_1411274_168_428 86
46 3300005614 Ga0068856_101962233 Ga0068856_1019622331 87
47 3300005985 Ga0081539_10000904 Ga0081539_1000090410 87
48 3300020069 Ga0197907_10301419 Ga0197907_103014192 87
49 3300025921 Ga0207652_11384217 Ga0207652_113842171 87
50 3300025949 Ga0207667_10866385 Ga0207667_108663851 87
51 3300044656 Ga0466969_0180599 Ga0466969_0180599_34_297 87
52 3300044693 Ga0466961_0334972 Ga0466961_0334972_85_348 87
53 3300045049 Ga0466959_0459975 Ga0466959_0459975_442_705 87
54 3300003320 rootH2_10020571 rootH2_100205712 88
55 3300003320 rootH2_10197868 rootH2_101978682 88
56 3300005331 Ga0070670_100459446 Ga0070670_1004594462 88
57 3300005336 Ga0070680_101021565 Ga0070680_1010215651 88
58 3300005434 Ga0070709_10631588 Ga0070709_106315882 88
59 3300005435 Ga0070714_100019901 Ga0070714_1000199015 88
60 3300005435 Ga0070714_100047254 Ga0070714_1000472542 88
61 3300005435 Ga0070714_100221296 Ga0070714_1002212964 88
62 3300005436 Ga0070713_100099763 Ga0070713_1000997632 88
63 3300005437 Ga0070710_10000488 Ga0070710_1000048818 88
64 3300005437 Ga0070710_10239328 Ga0070710_102393281 88
65 3300005439 Ga0070711_100071802 Ga0070711_1000718023 88
66 3300005455 Ga0070663_100005873 Ga0070663_10000587310 88
67 3300005455 Ga0070663_100100437 Ga0070663_1001004374 88
68 3300005536 Ga0070697_100776208 Ga0070697_1007762082 88
69 3300005548 Ga0070665_100655757 Ga0070665_1006557571 88
70 3300005563 Ga0068855_100014360 Ga0068855_1000143604 88
71 3300005614 Ga0068856_100164625 Ga0068856_1001646252 88
72 3300005614 Ga0068856_100914650 Ga0068856_1009146502 88
73 3300005616 Ga0068852_100383398 Ga0068852_1003833982 88
74 3300005834 Ga0068851_10741495 Ga0068851_107414952 88
75 3300006175 Ga0070712_100214737 Ga0070712_1002147372 88
76 3300006175 Ga0070712_101461223 Ga0070712_1014612231 88
77 3300009093 Ga0105240_10045269 Ga0105240_100452697 88
78 3300009098 Ga0105245_11557889 Ga0105245_115578892 88
79 3300009174 Ga0105241_10003908 Ga0105241_100039087 88
80 3300009545 Ga0105237_10039832 Ga0105237_100398322 88
81 3300009551 Ga0105238_10012997 Ga0105238_100129975 88
82 3300010375 Ga0105239_10033587 Ga0105239_100335877 88
83 3300010375 Ga0105239_10785927 Ga0105239_107859272 88
84 3300014969 Ga0157376_11278154 Ga0157376_112781541 88
85 3300014969 Ga0157376_11655312 Ga0157376_116553122 88
86 3300020069 Ga0197907_10902729 Ga0197907_109027292 88
87 3300020081 Ga0206354_11278698 Ga0206354_112786982 88
88 3300020082 Ga0206353_10933170 Ga0206353_109331701 88
89 3300022467 Ga0224712_10004814 Ga0224712_100048145 88
90 3300022467 Ga0224712_10065986 Ga0224712_100659862 88
91 3300025898 Ga0207692_10000267 Ga0207692_1000026717 88
92 3300025898 Ga0207692_10612402 Ga0207692_106124022 88
93 3300025904 Ga0207647_10015074 Ga0207647_100150744 88
94 3300025906 Ga0207699_10262740 Ga0207699_102627402 88
95 3300025911 Ga0207654_10014151 Ga0207654_100141512 88
96 3300025913 Ga0207695_10015018 Ga0207695_100150187 88
97 3300025914 Ga0207671_10005109 Ga0207671_100051097 88
98 3300025915 Ga0207693_10149798 Ga0207693_101497982 88
99 3300025916 Ga0207663_10168855 Ga0207663_101688552 88
100 3300025917 Ga0207660_11080861 Ga0207660_110808612 88
101 3300025919 Ga0207657_10130366 Ga0207657_101303662 88
102 3300025921 Ga0207652_10020785 Ga0207652_100207853 88
103 3300025924 Ga0207694_10004186 Ga0207694_100041866 88
104 3300025928 Ga0207700_10777054 Ga0207700_107770542 88
105 3300025929 Ga0207664_10021621 Ga0207664_100216215 88
106 3300025929 Ga0207664_10562328 Ga0207664_105623282 88
107 3300025949 Ga0207667_10041259 Ga0207667_100412594 88
108 3300026067 Ga0207678_10000171 Ga0207678_1000017110 88
109 3300026067 Ga0207678_10026937 Ga0207678_100269377 88
110 3300026067 Ga0207678_11420043 Ga0207678_114200432 88
111 3300026078 Ga0207702_10039065 Ga0207702_100390653 88
112 3300026142 Ga0207698_10349583 Ga0207698_103495833 88
113 3300028379 Ga0268266_10731039 Ga0268266_107310392 88
114 3300030521 Ga0307511_10001407 Ga0307511_1000140729 88
115 3300030733 Ga0314311_1035664 Ga0314311_10356642 88
116 3300030735 Ga0316178_1029189 Ga0316178_10291892 88
117 3300031730 Ga0307516_10859783 Ga0307516_108597831 88
118 3300031731 Ga0307405_10645615 Ga0307405_106456152 88
119 3300031838 Ga0307518_10012292 Ga0307518_100122925 88
120 3300031852 Ga0307410_10902300 Ga0307410_109023002 88
121 3300031901 Ga0307406_12019596 Ga0307406_120195962 88
122 3300031901 Ga0307406_12039030 Ga0307406_120390302 88
123 3300031995 Ga0307409_101582149 Ga0307409_1015821492 88
124 3300032002 Ga0307416_100043846 Ga0307416_1000438462 88
125 3300032005 Ga0307411_10993493 Ga0307411_109934932 88
126 3300033179 Ga0307507_10000013 Ga0307507_10000013117 88
127 3300033180 Ga0307510_10024593 Ga0307510_100245932 88
128 3300038443 Ga0395901_2168028 Ga0395901_2168028_196_462 88
129 3300041460 Ga0451802_0989911 Ga0451802_0989911_199_465 88
130 3300044656 Ga0466969_0033764 Ga0466969_0033764_273_539 88
131 3300044656 Ga0466969_0050256 Ga0466969_0050256_1752_2021 88
132 3300044656 Ga0466969_0154149 Ga0466969_0154149_154_420 88
133 3300044658 Ga0466972_0071861 Ga0466972_0071861_19_285 88
134 3300044684 Ga0466966_0017949 Ga0466966_0017949_4179_4445 88
135 3300044693 Ga0466961_0073324 Ga0466961_0073324_1141_1410 88
136 3300044693 Ga0466961_0126880 Ga0466961_0126880_542_808 88
137 3300044694 Ga0466963_0296862 Ga0466963_0296862_107_373 88
138 3300044719 Ga0466971_0012806 Ga0466971_0012806_19_285 88
139 3300044719 Ga0466971_0227732 Ga0466971_0227732_237_503 88
140 3300044719 Ga0466971_0681191 Ga0466971_0681191_170_439 88
141 3300044765 Ga0466970_0016352 Ga0466970_0016352_371_640 88
142 3300044765 Ga0466970_0067511 Ga0466970_0067511_1431_1697 88
143 3300044765 Ga0466970_0196425 Ga0466970_0196425_683_961 88
144 3300044765 Ga0466970_0283492 Ga0466970_0283492_281_547 88
145 3300044765 Ga0466970_0316275 Ga0466970_0316275_442_708 88
146 3300044842 Ga0466957_0095943 Ga0466957_0095943_158_424 88
147 3300045049 Ga0466959_0002152 Ga0466959_0002152_12130_12396 88
148 3300045049 Ga0466959_0016950 Ga0466959_0016950_4147_4413 88
149 3300045049 Ga0466959_0300137 Ga0466959_0300137_277_546 88
150 3300045836 Ga0466958_0165839 Ga0466958_0165839_128_394 88
151 3300045836 Ga0466958_0890648 Ga0466958_0890648_191_457 88
152 3300045976 Ga0466967_0962879 Ga0466967_0962879_259_525 88
153 3300046454 Ga0495592_0024577 Ga0495592_0024577_2991_3260 88
154 3300046462 Ga0495651_0123638 Ga0495651_0123638_338_607 88
155 3300046516 Ga0495628_0021119 Ga0495628_0021119_763_1032 88
156 3300046529 Ga0495652_0005902 Ga0495652_0005902_4004_4273 88
157 3300046529 Ga0495652_0102813 Ga0495652_0102813_1895_2164 88
158 3300046543 Ga0495645_0043689 Ga0495645_0043689_377_646 88
159 3300046557 Ga0495622_0033450 Ga0495622_0033450_827_1096 88
160 3300046679 Ga0495623_0162121 Ga0495623_0162121_1018_1287 88
161 3300046680 Ga0495646_0445467 Ga0495646_0445467_253_522 88
162 3300047317 Ga0495604_0007863 Ga0495604_0007863_4886_5155 88
163 3300048911 Ga0496108_0330988 Ga0496108_0330988_988_1254 88
164 3300048913 Ga0496110_1625460 Ga0496110_1625460_171_437 88
165 3300048917 Ga0496114_0002155 Ga0496114_0002155_9859_10125 88
166 3300048917 Ga0496114_1778751 Ga0496114_1778751_140_406 88
167 3300048929 Ga0496126_0489218 Ga0496126_0489218_644_910 88
168 3300048929 Ga0496126_1013674 Ga0496126_1013674_188_454 88
169 3300049584 Ga0501068_0886420 Ga0501068_0886420_107_373 88
170 3300049741 Ga0501079_1426708 Ga0501079_1426708_139_417 88
171 3300053077 Ga0495601_0044462 Ga0495601_0044462_259_528 88
172 3300053077 Ga0495601_0127980 Ga0495601_0127980_882_1151 88
173 3300053085 Ga0495619_0807255 Ga0495619_0807255_106_375 88
174 3300053140 Ga0500573_0111534 Ga0500573_0111534_107_376 88
175 3300054114 Ga0501084_1641213 Ga0501084_1641213_150_464 88
176 3300054114 Ga0501084_1696731 Ga0501084_1696731_236_502 88
177 3300061719 Ga0466962_0009366 Ga0466962_0009366_2297_2563 88
178 iso_pu_bacteria 8004021418 8004022976 88
179 iso_pu_bacteria 8004025490 8004027185 88
180 3300003285 Ga0007423J48922_101310 Ga0007423J48922_1013102 89
181 3300003316 rootH1_10128615 rootH1_101286152 89
182 3300005337 Ga0070682_100748526 Ga0070682_1007485262 89
183 3300005337 Ga0070682_100753093 Ga0070682_1007530932 89
184 3300005343 Ga0070687_101321414 Ga0070687_1013214141 89
185 3300005347 Ga0070668_100727700 Ga0070668_1007277002 89
186 3300005354 Ga0070675_101386288 Ga0070675_1013862882 89
187 3300005356 Ga0070674_101097040 Ga0070674_1010970402 89
188 3300005356 Ga0070674_101358603 Ga0070674_1013586031 89
189 3300005366 Ga0070659_100778811 Ga0070659_1007788112 89
190 3300005455 Ga0070663_100229589 Ga0070663_1002295891 89
191 3300005456 Ga0070678_100093681 Ga0070678_1000936812 89
192 3300005456 Ga0070678_101212286 Ga0070678_1012122861 89
193 3300005456 Ga0070678_101710889 Ga0070678_1017108891 89
194 3300005458 Ga0070681_12005962 Ga0070681_120059622 89
195 3300005459 Ga0068867_100795767 Ga0068867_1007957671 89
196 3300005535 Ga0070684_102027669 Ga0070684_1020276691 89
197 3300005539 Ga0068853_100106550 Ga0068853_1001065502 89
198 3300005543 Ga0070672_101088797 Ga0070672_1010887972 89
199 3300005547 Ga0070693_101611554 Ga0070693_1016115542 89
200 3300005548 Ga0070665_100661226 Ga0070665_1006612262 89
201 3300005548 Ga0070665_101949970 Ga0070665_1019499701 89
202 3300005564 Ga0070664_101096989 Ga0070664_1010969892 89
203 3300005578 Ga0068854_100798859 Ga0068854_1007988592 89
204 3300005616 Ga0068852_101136672 Ga0068852_1011366722 89
205 3300005618 Ga0068864_100873975 Ga0068864_1008739751 89
206 3300005618 Ga0068864_100956659 Ga0068864_1009566592 89
207 3300005618 Ga0068864_101965956 Ga0068864_1019659562 89
208 3300005840 Ga0068870_10435544 Ga0068870_104355442 89
209 3300005842 Ga0068858_101470105 Ga0068858_1014701051 89
210 3300005843 Ga0068860_101452639 Ga0068860_1014526392 89
211 3300006237 Ga0097621_100841766 Ga0097621_1008417662 89
212 3300006358 Ga0068871_101535109 Ga0068871_1015351091 89
213 3300006881 Ga0068865_100840650 Ga0068865_1008406502 89
214 3300009098 Ga0105245_10656852 Ga0105245_106568522 89
215 3300009098 Ga0105245_10945921 Ga0105245_109459212 89
216 3300009098 Ga0105245_11492590 Ga0105245_114925902 89
217 3300009101 Ga0105247_10928893 Ga0105247_109288932 89
218 3300009147 Ga0114129_10358527 Ga0114129_103585272 89
219 3300009148 Ga0105243_10695624 Ga0105243_106956241 89
220 3300009174 Ga0105241_10606872 Ga0105241_106068722 89
221 3300009174 Ga0105241_11339257 Ga0105241_113392572 89
222 3300009176 Ga0105242_12211634 Ga0105242_122116341 89
223 3300009551 Ga0105238_10016585 Ga0105238_100165859 89
224 3300009993 Ga0105028_125212 Ga0105028_1252122 89
225 3300010375 Ga0105239_10651195 Ga0105239_106511952 89
226 3300011119 Ga0105246_10351352 Ga0105246_103513522 89
227 3300011119 Ga0105246_10780910 Ga0105246_107809102 89
228 3300013104 Ga0157370_10422079 Ga0157370_104220792 89
229 3300013105 Ga0157369_10716938 Ga0157369_107169382 89
230 3300013105 Ga0157369_12221445 Ga0157369_122214451 89
231 3300013296 Ga0157374_11446022 Ga0157374_114460221 89
232 3300013306 Ga0163162_11304463 Ga0163162_113044632 89
233 3300013306 Ga0163162_11732832 Ga0163162_117328322 89
234 3300013306 Ga0163162_13396826 Ga0163162_133968261 89
235 3300013308 Ga0157375_10708744 Ga0157375_107087442 89
236 3300013308 Ga0157375_10781878 Ga0157375_107818782 89
237 3300013308 Ga0157375_11177794 Ga0157375_111777941 89
238 3300014325 Ga0163163_10207030 Ga0163163_102070302 89
239 3300014325 Ga0163163_10393166 Ga0163163_103931663 89
240 3300014325 Ga0163163_10831646 Ga0163163_108316462 89
241 3300014325 Ga0163163_11434369 Ga0163163_114343691 89
242 3300014326 Ga0157380_10294065 Ga0157380_102940652 89
243 3300014326 Ga0157380_10989620 Ga0157380_109896201 89
244 3300014326 Ga0157380_12098743 Ga0157380_120987431 89
245 3300014326 Ga0157380_12284024 Ga0157380_122840241 89
246 3300014745 Ga0157377_10241650 Ga0157377_102416501 89
247 3300014968 Ga0157379_10764292 Ga0157379_107642921 89
248 3300014969 Ga0157376_10598063 Ga0157376_105980632 89
249 3300014969 Ga0157376_11474479 Ga0157376_114744791 89
250 3300014969 Ga0157376_12045770 Ga0157376_120457701 89
251 3300017792 Ga0163161_11708019 Ga0163161_117080191 89
252 3300020075 Ga0206349_1667466 Ga0206349_16674662 89
253 3300025899 Ga0207642_10575991 Ga0207642_105759911 89
254 3300025901 Ga0207688_10020257 Ga0207688_100202573 89
255 3300025901 Ga0207688_10990015 Ga0207688_109900152 89
256 3300025903 Ga0207680_11003995 Ga0207680_110039952 89
257 3300025904 Ga0207647_10487922 Ga0207647_104879222 89
258 3300025908 Ga0207643_10771973 Ga0207643_107719732 89
259 3300025912 Ga0207707_10575648 Ga0207707_105756482 89
260 3300025918 Ga0207662_10197649 Ga0207662_101976492 89
261 3300025927 Ga0207687_10440897 Ga0207687_104408972 89
262 3300025927 Ga0207687_11576946 Ga0207687_115769461 89
263 3300025932 Ga0207690_11644329 Ga0207690_116443292 89
264 3300025935 Ga0207709_10185437 Ga0207709_101854372 89
265 3300025937 Ga0207669_10126726 Ga0207669_101267262 89
266 3300025937 Ga0207669_11101663 Ga0207669_111016632 89
267 3300025937 Ga0207669_11401234 Ga0207669_114012341 89
268 3300025940 Ga0207691_10806495 Ga0207691_108064952 89
269 3300025960 Ga0207651_10671308 Ga0207651_106713082 89
270 3300025972 Ga0207668_10836894 Ga0207668_108368941 89
271 3300025972 Ga0207668_12148526 Ga0207668_121485261 89
272 3300025981 Ga0207640_11135082 Ga0207640_111350822 89
273 3300026023 Ga0207677_12116268 Ga0207677_121162681 89
274 3300026041 Ga0207639_10621897 Ga0207639_106218972 89
275 3300026067 Ga0207678_10422462 Ga0207678_104224621 89
276 3300026067 Ga0207678_10792577 Ga0207678_107925771 89
277 3300026095 Ga0207676_11582973 Ga0207676_115829731 89
278 3300026095 Ga0207676_12469689 Ga0207676_124696891 89
279 3300026121 Ga0207683_10079024 Ga0207683_100790241 89
280 3300026121 Ga0207683_10359503 Ga0207683_103595032 89
281 3300026121 Ga0207683_11789462 Ga0207683_117894621 89
282 3300026142 Ga0207698_10906914 Ga0207698_109069142 89
283 3300028379 Ga0268266_10629166 Ga0268266_106291662 89
284 3300028379 Ga0268266_11431231 Ga0268266_114312311 89
285 3300028381 Ga0268264_10758746 Ga0268264_107587462 89
286 3300031456 Ga0307513_10062578 Ga0307513_100625782 89
287 3300031548 Ga0307408_100778177 Ga0307408_1007781772 89
288 3300031911 Ga0307412_11469274 Ga0307412_114692742 89
289 3300031995 Ga0307409_100658583 Ga0307409_1006585832 89
290 3300041441 Ga0451787_053604 Ga0451787_053604_286_555 89
291 3300041443 Ga0451789_0451907 Ga0451789_0451907_14_283 89
292 3300041451 Ga0451791_1258843 Ga0451791_1258843_1852_2121 89
293 3300041451 Ga0451791_1932489 Ga0451791_1932489_259_537 89
294 3300041452 Ga0451793_0080236 Ga0451793_0080236_382_651 89
295 3300041452 Ga0451793_0830341 Ga0451793_0830341_668_937 89
296 3300041452 Ga0451793_1723565 Ga0451793_1723565_22_300 89
297 3300041453 Ga0451797_0391903 Ga0451797_0391903_346_615 89
298 3300041453 Ga0451797_0803356 Ga0451797_0803356_1510_1779 89
299 3300041453 Ga0451797_1541060 Ga0451797_1541060_114_392 89
300 3300041462 Ga0451806_430110 Ga0451806_430110_81_350 89
301 3300041491 Ga0451833_0551454 Ga0451833_0551454_903_1172 89
302 3300041492 Ga0451835_0166726 Ga0451835_0166726_419_688 89
303 3300041494 Ga0451837_1848794 Ga0451837_1848794_75_344 89
304 3300041496 Ga0451839_1303485 Ga0451839_1303485_207_476 89
305 3300041498 Ga0451841_1438909 Ga0451841_1438909_2094_2363 89
306 3300041503 Ga0451847_0546697 Ga0451847_0546697_580_849 89
307 3300041509 Ga0451843_1298049 Ga0451843_1298049_1329_1598 89
308 3300041512 Ga0451853_0297658 Ga0451853_0297658_3207_3476 89
309 3300041999 Ga0439433_0180478 Ga0439433_0180478_123_401 89
310 3300042007 Ga0439449_0017257 Ga0439449_0017257_2246_2515 89
311 3300044656 Ga0466969_0018954 Ga0466969_0018954_2880_3149 89
312 3300044683 Ga0466965_0000005 Ga0466965_0000005_131563_131832 89
313 3300046461 Ga0495641_0339110 Ga0495641_0339110_141_410 89
314 3300046462 Ga0495651_0509157 Ga0495651_0509157_68_337 89
315 3300046475 Ga0495639_0694701 Ga0495639_0694701_117_386 89
316 3300046476 Ga0495662_0573810 Ga0495662_0573810_175_444 89
317 3300046477 Ga0495664_0773318 Ga0495664_0773318_281_550 89
318 3300046477 Ga0495664_0872000 Ga0495664_0872000_100_369 89
319 3300046499 Ga0495594_0618828 Ga0495594_0618828_19_288 89
320 3300046499 Ga0495594_0890604 Ga0495594_0890604_185_454 89
321 3300046511 Ga0495608_0775263 Ga0495608_0775263_68_337 89
322 3300046523 Ga0495644_0134564 Ga0495644_0134564_52_321 89
323 3300046531 Ga0495665_0496096 Ga0495665_0496096_132_401 89
324 3300046533 Ga0495640_0846273 Ga0495640_0846273_79_348 89
325 3300046559 Ga0495667_0574851 Ga0495667_0574851_372_641 89
326 3300046615 Ga0495656_0485267 Ga0495656_0485267_246_515 89
327 3300046663 Ga0495635_0441351 Ga0495635_0441351_574_843 89
328 3300046675 Ga0495657_0324982 Ga0495657_0324982_385_654 89
329 3300046675 Ga0495657_0844891 Ga0495657_0844891_118_387 89
330 3300046681 Ga0495647_0344301 Ga0495647_0344301_203_472 89
331 3300046683 Ga0495658_0490223 Ga0495658_0490223_341_610 89
332 3300046683 Ga0495658_0609242 Ga0495658_0609242_136_405 89
333 3300046690 Ga0495624_0084043 Ga0495624_0084043_1590_1859 89
334 3300046809 Ga0495600_0481427 Ga0495600_0481427_12_281 89
335 3300047317 Ga0495604_0755044 Ga0495604_0755044_199_468 89
336 3300047322 Ga0495680_0834731 Ga0495680_0834731_212_481 89
337 3300047472 Ga0495686_0523153 Ga0495686_0523153_330_599 89
338 3300047673 Ga0495593_0574586 Ga0495593_0574586_75_344 89
339 3300048088 Ga0495602_0348160 Ga0495602_0348160_48_317 89
340 3300048089 Ga0495614_0400662 Ga0495614_0400662_68_337 89
341 3300048903 Ga0496100_0971619 Ga0496100_0971619_377_646 89
342 3300048903 Ga0496100_1475808 Ga0496100_1475808_159_428 89
343 3300048905 Ga0496102_0087643 Ga0496102_0087643_88_357 89
344 3300048905 Ga0496102_0452898 Ga0496102_0452898_846_1115 89
345 3300048905 Ga0496102_0724256 Ga0496102_0724256_539_817 89
346 3300048906 Ga0496103_0837591 Ga0496103_0837591_198_467 89
347 3300048907 Ga0496104_0052525 Ga0496104_0052525_1342_1611 89
348 3300048907 Ga0496104_1373252 Ga0496104_1373252_259_537 89
349 3300048908 Ga0496105_0003086 Ga0496105_0003086_2370_2639 89
350 3300048910 Ga0496107_0912526 Ga0496107_0912526_320_589 89
351 3300048911 Ga0496108_0001930 Ga0496108_0001930_7348_7617 89
352 3300048911 Ga0496108_0414683 Ga0496108_0414683_418_687 89
353 3300048911 Ga0496108_0645757 Ga0496108_0645757_193_462 89
354 3300048912 Ga0496109_0005859 Ga0496109_0005859_8225_8494 89
355 3300048912 Ga0496109_0307702 Ga0496109_0307702_624_893 89
356 3300048912 Ga0496109_0925301 Ga0496109_0925301_495_773 89
357 3300048913 Ga0496110_0004866 Ga0496110_0004866_1984_2253 89
358 3300048913 Ga0496110_0233282 Ga0496110_0233282_19_288 89
359 3300048913 Ga0496110_0443085 Ga0496110_0443085_404_673 89
360 3300048914 Ga0496111_0002209 Ga0496111_0002209_11306_11575 89
361 3300048914 Ga0496111_0383250 Ga0496111_0383250_122_391 89
362 3300048914 Ga0496111_0534256 Ga0496111_0534256_160_438 89
363 3300048914 Ga0496111_1236015 Ga0496111_1236015_149_418 89
364 3300048915 Ga0496112_1575534 Ga0496112_1575534_100_369 89
365 3300048916 Ga0496113_0024578 Ga0496113_0024578_80_349 89
366 3300048917 Ga0496114_0091253 Ga0496114_0091253_600_869 89
367 3300048917 Ga0496114_0156396 Ga0496114_0156396_1634_1903 89
368 3300048917 Ga0496114_0194471 Ga0496114_0194471_17_286 89
369 3300048917 Ga0496114_0438315 Ga0496114_0438315_266_535 89
370 3300048917 Ga0496114_0693447 Ga0496114_0693447_115_384 89
371 3300048917 Ga0496114_0766916 Ga0496114_0766916_541_810 89
372 3300048918 Ga0496115_0617577 Ga0496115_0617577_459_728 89
373 3300048920 Ga0496117_0017993 Ga0496117_0017993_2008_2277 89
374 3300048921 Ga0496118_0045487 Ga0496118_0045487_231_500 89
375 3300048921 Ga0496118_0160081 Ga0496118_0160081_16_312 89
376 3300048921 Ga0496118_0248334 Ga0496118_0248334_39_311 89
377 3300048922 Ga0496119_0008509 Ga0496119_0008509_4681_4950 89
378 3300048922 Ga0496119_0023086 Ga0496119_0023086_2475_2771 89
379 3300048923 Ga0496120_0001144 Ga0496120_0001144_8555_8824 89
380 3300048925 Ga0496122_0001463 Ga0496122_0001463_31979_32275 89
381 3300048927 Ga0496124_0681840 Ga0496124_0681840_40_339 89
382 3300048928 Ga0496125_0000086 Ga0496125_0000086_41575_41871 89
383 3300048929 Ga0496126_0752176 Ga0496126_0752176_277_576 89
384 3300049577 Ga0501041_0086701 Ga0501041_0086701_30_299 89
385 3300049592 Ga0501076_0861181 Ga0501076_0861181_248_517 89
386 3300049741 Ga0501079_0489366 Ga0501079_0489366_253_522 89
387 3300049824 Ga0501045_0533086 Ga0501045_0533086_341_610 89
388 3300050507 nmdc:mga05p37_484144_c1 nmdc:mga05p37_484144_c1_823_1092 89
389 3300059605 Ga0587106_149039 Ga0587106_149039_159_437 89
390 3300044656 Ga0466969_0015566 Ga0466969_0015566_294_578 91
391 3300044658 Ga0466972_0649552 Ga0466972_0649552_77_355 91
392 3300044684 Ga0466966_0006655 Ga0466966_0006655_1097_1381 91
393 3300044693 Ga0466961_0003356 Ga0466961_0003356_6983_7267 91
394 3300044693 Ga0466961_0259900 Ga0466961_0259900_92_370 91
395 3300044765 Ga0466970_0067956 Ga0466970_0067956_52_336 91
396 3300045049 Ga0466959_0593254 Ga0466959_0593254_174_458 91
397 3300049586 Ga0501070_0696894 Ga0501070_0696894_281_559 91
398 3300003578 Ga0006562J51391_1013352 Ga0006562J51391_10133522 92
399 3300005328 Ga0070676_10547907 Ga0070676_105479072 92
400 3300005331 Ga0070670_102091382 Ga0070670_1020913822 92
401 3300005333 Ga0070677_10147791 Ga0070677_101477911 92
402 3300011119 Ga0105246_10111711 Ga0105246_101117112 92
403 3300013100 Ga0157373_10002429 Ga0157373_1000242910 92
404 3300013102 Ga0157371_10194729 Ga0157371_101947292 92
405 3300013104 Ga0157370_10001553 Ga0157370_1000155314 92
406 3300025893 Ga0207682_10025021 Ga0207682_100250212 92
407 3300025914 Ga0207671_11163081 Ga0207671_111630812 92
408 3300025925 Ga0207650_10508087 Ga0207650_105080871 92
409 3300026121 Ga0207683_11549240 Ga0207683_115492401 92
410 3300031911 Ga0307412_11919829 Ga0307412_119198292 92
411 3300031995 Ga0307409_100424863 Ga0307409_1004248631 92
412 3300049593 Ga0501077_0671175 Ga0501077_0671175_252_530 92
413 3300002070 JGI24750J21931_1064211 JGI24750J21931_10642112 93
414 3300005328 Ga0070676_10021692 Ga0070676_100216924 93
415 3300005331 Ga0070670_100697905 Ga0070670_1006979052 93
416 3300005333 Ga0070677_10001852 Ga0070677_100018524 93
417 3300005335 Ga0070666_10032554 Ga0070666_100325544 93
418 3300005347 Ga0070668_100031497 Ga0070668_1000314971 93
419 3300005353 Ga0070669_100014380 Ga0070669_1000143804 93
420 3300005354 Ga0070675_100579618 Ga0070675_1005796181 93
421 3300005355 Ga0070671_100033741 Ga0070671_1000337414 93
422 3300005356 Ga0070674_100142812 Ga0070674_1001428121 93
423 3300005356 Ga0070674_100624009 Ga0070674_1006240092 93
424 3300005364 Ga0070673_100037250 Ga0070673_1000372502 93
425 3300005367 Ga0070667_100285354 Ga0070667_1002853542 93
426 3300005444 Ga0070694_101507830 Ga0070694_1015078301 93
427 3300005455 Ga0070663_101194801 Ga0070663_1011948011 93
428 3300005456 Ga0070678_100057391 Ga0070678_1000573912 93
429 3300005548 Ga0070665_100096666 Ga0070665_1000966662 93
430 3300005615 Ga0070702_100228459 Ga0070702_1002284592 93
431 3300005834 Ga0068851_10074414 Ga0068851_100744142 93
432 3300005841 Ga0068863_102367389 Ga0068863_1023673891 93
433 3300006178 Ga0075367_10334963 Ga0075367_103349632 93
434 3300009011 Ga0105251_10014182 Ga0105251_100141823 93
435 3300009036 Ga0105244_10073228 Ga0105244_100732283 93
436 3300009092 Ga0105250_10057020 Ga0105250_100570202 93
437 3300009098 Ga0105245_10129116 Ga0105245_101291162 93
438 3300009101 Ga0105247_10183130 Ga0105247_101831301 93
439 3300009148 Ga0105243_10175674 Ga0105243_101756743 93
440 3300009174 Ga0105241_10058352 Ga0105241_100583524 93
441 3300009176 Ga0105242_10075285 Ga0105242_100752852 93
442 3300009177 Ga0105248_10043912 Ga0105248_100439122 93
443 3300009553 Ga0105249_10402529 Ga0105249_104025292 93
444 3300010375 Ga0105239_12061179 Ga0105239_120611791 93
445 3300011119 Ga0105246_10725211 Ga0105246_107252112 93
446 3300011119 Ga0105246_10782143 Ga0105246_107821432 93
447 3300013102 Ga0157371_10039986 Ga0157371_100399864 93
448 3300013105 Ga0157369_10026122 Ga0157369_100261224 93
449 3300013306 Ga0163162_10152310 Ga0163162_101523102 93
450 3300013306 Ga0163162_11139102 Ga0163162_111391022 93
451 3300013306 Ga0163162_12313665 Ga0163162_123136651 93
452 3300013308 Ga0157375_10065716 Ga0157375_100657164 93
453 3300013308 Ga0157375_11526845 Ga0157375_115268451 93
454 3300013308 Ga0157375_11586277 Ga0157375_115862772 93
455 3300014745 Ga0157377_11105324 Ga0157377_111053242 93
456 3300014969 Ga0157376_11842035 Ga0157376_118420352 93
457 3300017792 Ga0163161_11011915 Ga0163161_110119151 93
458 3300025315 Ga0207697_10000589 Ga0207697_100005898 93
459 3300025728 Ga0207655_1010969 Ga0207655_10109692 93
460 3300025728 Ga0207655_1160524 Ga0207655_11605241 93
461 3300025735 Ga0207713_1027753 Ga0207713_10277532 93
462 3300025893 Ga0207682_10003529 Ga0207682_100035293 93
463 3300025900 Ga0207710_10738742 Ga0207710_107387422 93
464 3300025903 Ga0207680_10453589 Ga0207680_104535892 93
465 3300025907 Ga0207645_10081976 Ga0207645_100819762 93
466 3300025911 Ga0207654_10826127 Ga0207654_108261272 93
467 3300025923 Ga0207681_10102622 Ga0207681_101026223 93
468 3300025925 Ga0207650_10025618 Ga0207650_100256181 93
469 3300025925 Ga0207650_10752589 Ga0207650_107525891 93
470 3300025926 Ga0207659_10390474 Ga0207659_103904741 93
471 3300025927 Ga0207687_10905968 Ga0207687_109059682 93
472 3300025931 Ga0207644_10016049 Ga0207644_100160492 93
473 3300025934 Ga0207686_11558112 Ga0207686_115581121 93
474 3300025937 Ga0207669_10464682 Ga0207669_104646822 93
475 3300025940 Ga0207691_10000237 Ga0207691_1000023718 93
476 3300025941 Ga0207711_10193393 Ga0207711_101933932 93
477 3300025960 Ga0207651_10015376 Ga0207651_100153762 93
478 3300025961 Ga0207712_10339997 Ga0207712_103399972 93
479 3300025986 Ga0207658_10093201 Ga0207658_100932011 93
480 3300026067 Ga0207678_10966692 Ga0207678_109666921 93
481 3300026121 Ga0207683_10001134 Ga0207683_1000113419 93
482 3300026121 Ga0207683_10406543 Ga0207683_104065433 93
483 3300028379 Ga0268266_10091683 Ga0268266_100916832 93
484 3300046453 Ga0495627_152795 Ga0495627_152795_213_494 93
485 3300046459 Ga0495629_0228444 Ga0495629_0228444_117_398 93
486 3300046460 Ga0495638_0536646 Ga0495638_0536646_95_376 93
487 3300046463 Ga0495653_0026926 Ga0495653_0026926_4171_4452 93
488 3300046473 Ga0495582_0081134 Ga0495582_0081134_1421_1702 93
489 3300046473 Ga0495582_0578746 Ga0495582_0578746_332_613 93
490 3300046476 Ga0495662_0016851 Ga0495662_0016851_2123_2404 93
491 3300046477 Ga0495664_0053816 Ga0495664_0053816_1027_1308 93
492 3300046499 Ga0495594_0180273 Ga0495594_0180273_127_408 93
493 3300046499 Ga0495594_0256522 Ga0495594_0256522_480_761 93
494 3300046501 Ga0495607_0233681 Ga0495607_0233681_77_358 93
495 3300046518 Ga0495631_0068846 Ga0495631_0068846_1201_1482 93
496 3300046525 Ga0495663_0082396 Ga0495663_0082396_603_884 93
497 3300046528 Ga0495642_0202928 Ga0495642_0202928_521_802 93
498 3300046528 Ga0495642_0564015 Ga0495642_0564015_28_309 93
499 3300046531 Ga0495665_0054458 Ga0495665_0054458_897_1178 93
500 3300046535 Ga0495586_0014805 Ga0495586_0014805_2116_2397 93
501 3300046535 Ga0495586_0032444 Ga0495586_0032444_71_352 93
502 3300046535 Ga0495586_0294669 Ga0495586_0294669_614_895 93
503 3300046536 Ga0495587_0007088 Ga0495587_0007088_357_638 93
504 3300046543 Ga0495645_0001343 Ga0495645_0001343_2980_3261 93
505 3300046558 Ga0495633_0297237 Ga0495633_0297237_403_684 93
506 3300046559 Ga0495667_0000400 Ga0495667_0000400_4578_4859 93
507 3300046615 Ga0495656_0021813 Ga0495656_0021813_1544_1825 93
508 3300046616 Ga0495668_0035236 Ga0495668_0035236_1973_2254 93
509 3300046663 Ga0495635_0040941 Ga0495635_0040941_2840_3121 93
510 3300046664 Ga0495659_0006908 Ga0495659_0006908_1070_1351 93
511 3300046665 Ga0495661_0108037 Ga0495661_0108037_484_765 93
512 3300046674 Ga0495588_0009386 Ga0495588_0009386_4198_4479 93
513 3300046675 Ga0495657_0151595 Ga0495657_0151595_1060_1341 93
514 3300046679 Ga0495623_0477681 Ga0495623_0477681_337_618 93
515 3300046689 Ga0495613_0216900 Ga0495613_0216900_970_1251 93
516 3300046691 Ga0495670_0008175 Ga0495670_0008175_3337_3618 93
517 3300046691 Ga0495670_0061062 Ga0495670_0061062_1584_1865 93
518 3300046691 Ga0495670_0158465 Ga0495670_0158465_37_318 93
519 3300046692 Ga0495671_0569407 Ga0495671_0569407_213_494 93
520 3300046809 Ga0495600_0104835 Ga0495600_0104835_873_1154 93
521 3300047315 Ga0495581_0017005 Ga0495581_0017005_656_937 93
522 3300047315 Ga0495581_0138978 Ga0495581_0138978_200_481 93
523 3300047318 Ga0495636_0052488 Ga0495636_0052488_100_381 93
524 3300047322 Ga0495680_0066879 Ga0495680_0066879_165_446 93
525 3300047444 Ga0495675_0020175 Ga0495675_0020175_3515_3796 93
526 3300047445 Ga0495677_0087734 Ga0495677_0087734_822_1103 93
527 3300047445 Ga0495677_0378594 Ga0495677_0378594_23_304 93
528 3300047447 Ga0495685_001941 Ga0495685_001941_3633_3914 93
529 3300047470 Ga0495681_0075932 Ga0495681_0075932_954_1235 93
530 3300047673 Ga0495593_0196185 Ga0495593_0196185_321_602 93
531 3300048903 Ga0496100_0022120 Ga0496100_0022120_1390_1671 93
532 3300048903 Ga0496100_0296497 Ga0496100_0296497_859_1140 93
533 3300048903 Ga0496100_1072523 Ga0496100_1072523_305_586 93
534 3300048904 Ga0496101_0035154 Ga0496101_0035154_1389_1670 93
535 3300048904 Ga0496101_0479118 Ga0496101_0479118_470_751 93
536 3300048904 Ga0496101_1219326 Ga0496101_1219326_28_309 93
537 3300048905 Ga0496102_0077082 Ga0496102_0077082_823_1104 93
538 3300048905 Ga0496102_0084267 Ga0496102_0084267_60_341 93
539 3300048905 Ga0496102_0114118 Ga0496102_0114118_1200_1481 93
540 3300048905 Ga0496102_0153088 Ga0496102_0153088_476_757 93
541 3300048906 Ga0496103_0017773 Ga0496103_0017773_2662_2943 93
542 3300048906 Ga0496103_0050477 Ga0496103_0050477_1531_1812 93
543 3300048906 Ga0496103_1050451 Ga0496103_1050451_134_415 93
544 3300048907 Ga0496104_0319113 Ga0496104_0319113_248_529 93
545 3300048908 Ga0496105_0087328 Ga0496105_0087328_1519_1800 93
546 3300048909 Ga0496106_0710831 Ga0496106_0710831_104_385 93
547 3300048910 Ga0496107_0161142 Ga0496107_0161142_1042_1323 93
548 3300048911 Ga0496108_0235591 Ga0496108_0235591_311_592 93
549 3300048911 Ga0496108_0326237 Ga0496108_0326237_1001_1282 93
550 3300048912 Ga0496109_0020366 Ga0496109_0020366_2093_2374 93
551 3300048913 Ga0496110_0054530 Ga0496110_0054530_2362_2643 93
552 3300048913 Ga0496110_0078277 Ga0496110_0078277_1001_1282 93
553 3300048913 Ga0496110_0100278 Ga0496110_0100278_460_741 93
554 3300048914 Ga0496111_0057359 Ga0496111_0057359_405_686 93
555 3300048914 Ga0496111_0061448 Ga0496111_0061448_2224_2505 93
556 3300048914 Ga0496111_1058555 Ga0496111_1058555_66_347 93
557 3300048915 Ga0496112_0379065 Ga0496112_0379065_213_494 93
558 3300048916 Ga0496113_0095752 Ga0496113_0095752_1243_1524 93
559 3300048917 Ga0496114_0107321 Ga0496114_0107321_1521_1802 93
560 3300048917 Ga0496114_0125230 Ga0496114_0125230_22_303 93
561 3300048927 Ga0496124_0314190 Ga0496124_0314190_292_573 93
562 3300048928 Ga0496125_0331632 Ga0496125_0331632_570_851 93
563 3300050494 nmdc:mga06z11_127902_c1 nmdc:mga06z11_127902_c1_48_329 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

2

84

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9403 1 86
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.938 2 86
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.9328 1 87
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9291 1 86
1cm3-assembly1.cif.gz_A his15asp hpr from e. coli 0.9273 1 87
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9401 1 86 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9209 2 87 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.92 4 86 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.904 2 86 3.30.1340.10
1pchA00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.889 2 85 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A345VA70-F1-model_v4 HPr family phosphocarrier protein 1.003 1 93 GO:0005737
GO:0009401
AF-A0A4R7KS02-F1-model_v4 deleted 1 1 92
AF-A0A176UDN9-F1-model_v4 deleted 1 1 92
AF-A0A0V8HSN3-F1-model_v4 Phosphotransferase 0.9965 1 93 GO:0005737
GO:0009401
GO:0016740
AF-A0A024H7M4-F1-model_v4 Phosphocarrier protein HPr (EC 2.7.11.-) 0.9946 12 93 GO:0005737
GO:0009401
GO:0016740

Feature Viewer

pLDDT pTM Quality
91.03 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map