F463985

General Info

Members Datasets Scaffolds Average Seq Length
562 311 1124 293

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0354286|Ga0501034_0354286_370_1359
Length 329
Sequence VTGAFSGGLALAILAGALTGGGVMLLIVAIRGVSPRPGRPSARRREEIVRTLTTRTALAVVVGVLVLIITRWPVAGIGAALLVLGWNSIGGGAAEERRSMARLEALAAWTESLRDTIAGAVGLEQAIPSSLRAVAPVLRPKVQALVDRLHTRVPLADALRMFGDDLDDASADLVVAALILNARLRGPGLRDMLGALADSARAELDMRRRVEANRRTTRRSVQIVVGVSVGTALLLAVVNRTYVAMYDSVTGQLVLAVVVGLFAIGFVWLRRLAKYETPHRFLAAAASDKPDAQDKPGVPGEVPETVARWQGQTPANGSPTVPGPRGGNR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
68 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
282 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
288 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
289 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
290 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
291 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
292 2808606448 Streptomyces sp. 193411 Isolate Unclassified
293 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
294 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
295 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
296 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
297 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
298 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
299 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
300 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
301 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
302 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
303 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
304 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
305 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
306 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
307 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
308 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
309 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
310 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
311 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0.18
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 3.2
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0354286 3300049571 Bacteria 1395
2 rootL2_10124669 3300003322 Bacteria 1981
3 rootH1_10086857 3300003323 Bacteria 2657
4 Ga0070658_10431151 3300005327 Bacteria 1135
5 Ga0070683_100203658 3300005329 Bacteria 1879
6 Ga0070660_100085219 3300005339 Bacteria 2484
7 Ga0070671_100039822 3300005355 Bacteria 3901
8 Ga0070673_100112328 3300005364 Bacteria 2261
9 Ga0070659_100048058 3300005366 Bacteria 3350
10 Ga0070709_10071171 3300005434 Bacteria 2244
11 Ga0070709_10084477 3300005434 Bacteria 2079
12 Ga0070714_100004739 3300005435 Bacteria 10295
13 Ga0070714_100014181 3300005435 Bacteria 6398
14 Ga0070714_100114222 3300005435 Bacteria 2395
15 Ga0070714_100320754 3300005435 Bacteria 1449
16 Ga0070713_100049771 3300005436 Bacteria 3458
17 Ga0070713_100197500 3300005436 Bacteria 1815
18 Ga0070713_100344316 3300005436 Bacteria 1382
19 Ga0070711_100101977 3300005439 Bacteria 2089
20 Ga0070711_100152590 3300005439 Bacteria 1743
21 Ga0070705_100005283 3300005440 Bacteria 6278
22 Ga0070705_100271641 3300005440 Bacteria 1201
23 Ga0070694_100162554 3300005444 Bacteria 1639
24 Ga0070708_100020238 3300005445 Bacteria 5608
25 Ga0070708_100037036 3300005445 Bacteria 4254
26 Ga0070663_100021570 3300005455 Bacteria 4287
27 Ga0070663_100071912 3300005455 Bacteria 2518
28 Ga0070663_100092949 3300005455 Bacteria 2237
29 Ga0070678_100186716 3300005456 Bacteria 1701
30 Ga0070662_100066998 3300005457 Bacteria 2636
31 Ga0070681_10090510 3300005458 Bacteria 3010
32 Ga0070706_100004551 3300005467 Bacteria 13334
33 Ga0070706_100008619 3300005467 Bacteria 9504
34 Ga0070706_100024244 3300005467 Bacteria 5584
35 Ga0070706_100181252 3300005467 Bacteria 1966
36 Ga0070707_100006610 3300005468 Bacteria 10757
37 Ga0070707_100012902 3300005468 Bacteria 7805
38 Ga0070698_100002497 3300005471 Bacteria 20270
39 Ga0070698_100004639 3300005471 Bacteria 15108
40 Ga0070698_100105697 3300005471 Bacteria 2784
41 Ga0070699_100004163 3300005518 Bacteria 12787
42 Ga0070699_100024350 3300005518 Bacteria 5216
43 Ga0070699_100067587 3300005518 Bacteria 3104
44 Ga0070679_100020710 3300005530 Bacteria 6416
45 Ga0070679_100062903 3300005530 Bacteria 3699
46 Ga0070684_100165458 3300005535 Bacteria 2007
47 Ga0070697_100006393 3300005536 Bacteria 9121
48 Ga0070697_100073232 3300005536 Bacteria 2812
49 Ga0070697_100093117 3300005536 Bacteria 2495
50 Ga0068853_100130363 3300005539 Bacteria 2250
51 Ga0070672_100136426 3300005543 Bacteria 2021
52 Ga0070695_100026676 3300005545 Bacteria 3576
53 Ga0070696_100080305 3300005546 Bacteria 2308
54 Ga0070693_100013742 3300005547 Bacteria 4132
55 Ga0070665_100051045 3300005548 Bacteria 4149
56 Ga0070665_100120409 3300005548 Bacteria 2626
57 Ga0070704_100017298 3300005549 Bacteria 4582
58 Ga0068855_100006758 3300005563 Bacteria 13913
59 Ga0070664_100063752 3300005564 Bacteria 3142
60 Ga0068857_100174917 3300005577 Bacteria 1952
61 Ga0068857_100311023 3300005577 Bacteria 1453
62 Ga0068854_100051703 3300005578 Bacteria 2944
63 Ga0068856_100019065 3300005614 Bacteria 6657
64 Ga0068856_100647366 3300005614 Bacteria 1077
65 Ga0070702_100010849 3300005615 Bacteria 4508
66 Ga0068852_100057224 3300005616 Bacteria 3373
67 Ga0068851_10166191 3300005834 Bacteria 1215
68 Ga0068863_100123447 3300005841 Bacteria 2471
69 Ga0068862_100366119 3300005844 Bacteria 1341
70 Ga0081538_10001645 3300005981 Bacteria 22911
71 Ga0081540_1000156 3300005983 Bacteria 70177
72 Ga0070717_10016681 3300006028 Bacteria 5699
73 Ga0070717_10073701 3300006028 Bacteria 2854
74 Ga0070717_10079439 3300006028 Bacteria 2751
75 Ga0070717_10118031 3300006028 Bacteria 2270
76 Ga0070717_10143141 3300006028 Bacteria 2064
77 Ga0070717_10192424 3300006028 Bacteria 1783
78 Ga0070717_10258453 3300006028 Bacteria 1540
79 Ga0070717_10264404 3300006028 Bacteria 1523
80 Ga0070717_10307835 3300006028 Bacteria 1409
81 Ga0070717_10346024 3300006028 Bacteria 1328
82 Ga0070717_10430382 3300006028 Bacteria 1187
83 Ga0075365_10173209 3300006038 Bacteria 1507
84 Ga0070715_10002576 3300006163 Bacteria 5596
85 Ga0070715_10004597 3300006163 Bacteria 4547
86 Ga0070715_10039010 3300006163 Bacteria 1975
87 Ga0075433_10018642 3300006852 Bacteria 5772
88 Ga0075434_100474809 3300006871 Bacteria 1272
89 Ga0068865_100138067 3300006881 Bacteria 1835
90 Ga0075436_100274772 3300006914 Bacteria 1204
91 Ga0075435_100207121 3300007076 Bacteria 1663
92 Ga0099794_10094659 3300007265 Bacteria 1485
93 Ga0105251_10029369 3300009011 Bacteria 2769
94 Ga0105250_10047641 3300009092 Bacteria 1719
95 Ga0105240_10017938 3300009093 Bacteria 9519
96 Ga0105240_10131918 3300009093 Bacteria 2996
97 Ga0105245_10111472 3300009098 Bacteria 2544
98 Ga0105243_10053399 3300009148 Bacteria 3205
99 Ga0105242_10018231 3300009176 Bacteria 5485
100 Ga0105248_10209495 3300009177 Bacteria 2196
101 Ga0105237_10106725 3300009545 Bacteria 2792
102 Ga0105238_10008196 3300009551 Bacteria 10452
103 Ga0105249_10176967 3300009553 Bacteria 2073
104 Ga0105239_10013495 3300010375 Bacteria 9071
105 Ga0105239_10225451 3300010375 Bacteria 2102
106 Ga0157342_1000349 3300012507 Bacteria 2701
107 Ga0157338_1001441 3300012515 Bacteria 1699
108 Ga0157373_10032591 3300013100 Bacteria 3750
109 Ga0157369_10077270 3300013105 Bacteria 3568
110 Ga0157377_10039954 3300014745 Bacteria 2596
111 Ga0157376_10568861 3300014969 Bacteria 1124
112 Ga0183367_1002 3300015688 Bacteria 1101531
113 Ga0163161_10103936 3300017792 Bacteria 2117
114 Ga0206353_11781108 3300020082 Bacteria 3374
115 Ga0213875_10001145 3300021388 Bacteria 18237
116 Ga0213875_10006906 3300021388 Bacteria 5915
117 Ga0207692_10215297 3300025898 Bacteria 1136
118 Ga0207688_10001780 3300025901 Bacteria 11441
119 Ga0207680_10259135 3300025903 Bacteria 1203
120 Ga0207647_10018075 3300025904 Bacteria 4779
121 Ga0207685_10001593 3300025905 Bacteria 4842
122 Ga0207699_10022550 3300025906 Bacteria 3414
123 Ga0207699_10058249 3300025906 Bacteria 2310
124 Ga0207645_10029926 3300025907 Bacteria 3509
125 Ga0207643_10010021 3300025908 Bacteria 5094
126 Ga0207684_10002229 3300025910 Bacteria 19767
127 Ga0207684_10020321 3300025910 Bacteria 5673
128 Ga0207684_10023621 3300025910 Bacteria 5249
129 Ga0207684_10263343 3300025910 Bacteria 1488
130 Ga0207707_10354067 3300025912 Bacteria 1265
131 Ga0207695_10000796 3300025913 Bacteria 59143
132 Ga0207671_10000188 3300025914 Bacteria 95365
133 Ga0207693_10053518 3300025915 Bacteria 3167
134 Ga0207693_10293998 3300025915 Bacteria 1273
135 Ga0207663_10004897 3300025916 Bacteria 6701
136 Ga0207663_10060867 3300025916 Bacteria 2394
137 Ga0207662_10002898 3300025918 Bacteria 8697
138 Ga0207657_10007834 3300025919 Bacteria 10901
139 Ga0207652_10062401 3300025921 Bacteria 3220
140 Ga0207646_10005930 3300025922 Bacteria 12744
141 Ga0207646_10128919 3300025922 Bacteria 2276
142 Ga0207681_10206380 3300025923 Bacteria 1512
143 Ga0207694_10000164 3300025924 Bacteria 68118
144 Ga0207694_10074279 3300025924 Bacteria 2661
145 Ga0207659_10067664 3300025926 Bacteria 2595
146 Ga0207687_10176338 3300025927 Bacteria 1653
147 Ga0207700_10001733 3300025928 Bacteria 12393
148 Ga0207700_10079402 3300025928 Bacteria 2555
149 Ga0207700_10094194 3300025928 Bacteria 2372
150 Ga0207700_10114244 3300025928 Bacteria 2178
151 Ga0207700_10234852 3300025928 Bacteria 1561
152 Ga0207664_10000537 3300025929 Bacteria 27020
153 Ga0207664_10018026 3300025929 Bacteria 5186
154 Ga0207664_10034746 3300025929 Bacteria 3885
155 Ga0207664_10120925 3300025929 Bacteria 2191
156 Ga0207664_10137439 3300025929 Bacteria 2064
157 Ga0207664_10201657 3300025929 Bacteria 1718
158 Ga0207664_10317869 3300025929 Bacteria 1373
159 Ga0207706_10007954 3300025933 Bacteria 9789
160 Ga0207709_10078204 3300025935 Bacteria 2123
161 Ga0207669_10022571 3300025937 Bacteria 3346
162 Ga0207665_10006793 3300025939 Bacteria 7581
163 Ga0207665_10262168 3300025939 Bacteria 1281
164 Ga0207691_10019908 3300025940 Bacteria 6347
165 Ga0207691_10291916 3300025940 Bacteria 1402
166 Ga0207689_10158966 3300025942 Bacteria 1862
167 Ga0207667_10078032 3300025949 Bacteria 3433
168 Ga0207639_10035857 3300026041 Bacteria 3672
169 Ga0207678_10008779 3300026067 Bacteria 8891
170 Ga0207678_10088166 3300026067 Bacteria 2652
171 Ga0207678_10098038 3300026067 Bacteria 2504
172 Ga0207702_10094146 3300026078 Bacteria 2629
173 Ga0207702_10138740 3300026078 Bacteria 2197
174 Ga0207641_10122279 3300026088 Bacteria 2325
175 Ga0207648_10070708 3300026089 Bacteria 3042
176 Ga0207674_10028188 3300026116 Bacteria 5931
177 Ga0207674_10146360 3300026116 Bacteria 2321
178 Ga0207675_100087695 3300026118 Bacteria 2923
179 Ga0207683_10001399 3300026121 Bacteria 21779
180 Ga0207698_10021271 3300026142 Bacteria 4482
181 Ga0268266_10244185 3300028379 Bacteria 1658
182 Ga0265337_1001133 3300028556 Bacteria 13619
183 Ga0265326_10005904 3300028558 Bacteria 3836
184 Ga0265319_1003137 3300028563 Bacteria 8714
185 Ga0265334_10003561 3300028573 Bacteria 7056
186 Ga0265318_10007460 3300028577 Bacteria 4944
187 Ga0265336_10002741 3300028666 Bacteria 7124
188 Ga0265336_10031653 3300028666 Bacteria 1642
189 Ga0307515_10102318 3300028794 Bacteria 3447
190 Ga0307515_10124197 3300028794 Bacteria 2897
191 Ga0265338_10000940 3300028800 Bacteria 49081
192 Ga0265338_10001533 3300028800 Bacteria 37286
193 Ga0265324_10002117 3300029957 Bacteria 10461
194 Ga0307512_10003006 3300030522 Bacteria 20337
195 Ga0307512_10032175 3300030522 Bacteria 4532
196 Ga0265332_10002338 3300031238 Bacteria 9675
197 Ga0265320_10002174 3300031240 Bacteria 13772
198 Ga0265325_10029424 3300031241 Bacteria 2953
199 Ga0265340_10003496 3300031247 Bacteria 8846
200 Ga0265339_10012280 3300031249 Bacteria 5236
201 Ga0307513_10009278 3300031456 Bacteria 12457
202 Ga0307513_10089121 3300031456 Bacteria 3150
203 Ga0307508_10015950 3300031616 Bacteria 6843
204 Ga0307508_10075254 3300031616 Bacteria 2953
205 Ga0307514_10019451 3300031649 Bacteria 5558
206 Ga0265314_10015935 3300031711 Bacteria 5951
207 Ga0265342_10001543 3300031712 Bacteria 21280
208 Ga0373930_0004797 3300034816 Bacteria 2219
209 Ga0373930_0018523 3300034816 Bacteria 1339
210 Ga0373948_0021795 3300034817 Bacteria 1230
211 Ga0373929_0004582 3300035085 Bacteria 2476
212 Ga0373934_0010974 3300035086 Bacteria 3407
213 Ga0373934_0037352 3300035086 Bacteria 1912
214 Ga0373940_0001690 3300035088 Bacteria 4077
215 Ga0373940_0015605 3300035088 Bacteria 1871
216 Ga0373944_0012145 3300035089 Bacteria 2369
217 Ga0373949_0003721 3300035090 Bacteria 3569
218 Ga0373951_0016441 3300035091 Bacteria 1669
219 Ga0373951_0023654 3300035091 Bacteria 1420
220 Ga0373923_0042595 3300035111 Bacteria 1876
221 Ga0373923_0102850 3300035111 Bacteria 1262
222 Ga0373932_0022245 3300035112 Bacteria 1682
223 Ga0373936_0011818 3300035113 Bacteria 3311
224 Ga0373953_0007178 3300035117 Bacteria 3717
225 Ga0373953_0030501 3300035117 Bacteria 2091
226 Ga0373954_0024214 3300035118 Bacteria 2767
227 Ga0373957_0111446 3300035120 Bacteria 1102
228 Ga0373943_0002324 3300035170 Bacteria 8641
229 Ga0373943_0036289 3300035170 Bacteria 2360
230 Ga0373943_0101683 3300035170 Bacteria 1504
231 Ga0373946_0000069 3300035171 Bacteria 27568
232 Ga0373955_0019066 3300035172 Bacteria 3422
233 Ga0373955_0040451 3300035172 Bacteria 2493
234 Ga0373955_0070145 3300035172 Bacteria 1957
235 Ga0373942_0008055 3300035207 Bacteria 2451
236 Ga0373924_0015344 3300035410 Bacteria 2912
237 Ga0373931_0015661 3300035691 Bacteria 3721
238 Ga0373935_0000749 3300035692 Bacteria 17256
239 Ga0373935_0104194 3300035692 Bacteria 1874
240 Ga0373927_0001999 3300035695 Bacteria 15033
241 Ga0373933_0001608 3300035724 Bacteria 13212
242 Ga0373933_0043920 3300035724 Bacteria 2645
243 Ga0373933_0068161 3300035724 Bacteria 2160
244 Ga0373933_0162281 3300035724 Bacteria 1419
245 Ga0373947_0001054 3300035725 Bacteria 16819
246 Ga0373947_0042270 3300035725 Bacteria 2720
247 Ga0373947_0171490 3300035725 Bacteria 1408
248 Ga0373937_0018987 3300036401 Bacteria 6149
249 Ga0373937_0022186 3300036401 Bacteria 5704
250 Ga0373937_0073064 3300036401 Bacteria 3163
251 Ga0373937_0142339 3300036401 Bacteria 2244
252 Ga0373937_0236800 3300036401 Bacteria 1719
253 Ga0373925_0000154 3300037068 Bacteria 73830
254 Ga0373925_0012026 3300037068 Bacteria 6267
255 Ga0373925_0247368 3300037068 Bacteria 1429
256 Ga0436364_0018646 3300037853 Bacteria 10509
257 Ga0436364_0237127 3300037853 Bacteria 2063
258 Ga0436364_0316403 3300037853 Bacteria 9081
259 Ga0436364_1307046 3300037853 Bacteria 27649
260 Ga0436365_0588755 3300039437 Bacteria 2488
261 Ga0436363_0772293 3300039450 Bacteria 1972
262 Ga0439436_0001217 3300041404 Bacteria 7324
263 Ga0439439_0004211 3300041406 Bacteria 3226
264 Ga0439433_0002580 3300041999 Bacteria 3848
265 Ga0439449_0007878 3300042007 Bacteria 4045
266 Ga0439457_000525 3300042014 Bacteria 11109
267 Ga0466969_0004931 3300044656 Bacteria 7112
268 Ga0466969_0006750 3300044656 Bacteria 6103
269 Ga0466966_0006745 3300044684 Bacteria 7603
270 Ga0466966_0029963 3300044684 Bacteria 3537
271 Ga0466961_0093432 3300044693 Bacteria 1898
272 Ga0466963_0023541 3300044694 Bacteria 3913
273 Ga0466971_0083205 3300044719 Bacteria 1461
274 Ga0466970_0037144 3300044765 Bacteria 2581
275 Ga0466959_0181197 3300045049 Bacteria 1473
276 Ga0466958_0003920 3300045836 Bacteria 7799
277 Ga0466958_0028244 3300045836 Bacteria 3326
278 Ga0466958_0041157 3300045836 Bacteria 2779
279 Ga0466967_0055784 3300045976 Bacteria 3481
280 Ga0466967_0111393 3300045976 Bacteria 2515
281 Ga0466967_0275264 3300045976 Bacteria 1614
282 Ga0466967_0571530 3300045976 Bacteria 1114
283 Ga0495592_0001763 3300046454 Bacteria 15222
284 Ga0495592_0012596 3300046454 Bacteria 6429
285 Ga0495592_0064064 3300046454 Bacteria 2695
286 Ga0495592_0089386 3300046454 Bacteria 2212
287 Ga0495592_0204998 3300046454 Bacteria 1328
288 Ga0495603_0005306 3300046455 Bacteria 7685
289 Ga0495603_0006554 3300046455 Bacteria 6987
290 Ga0495603_0053996 3300046455 Bacteria 2382
291 Ga0495629_0013094 3300046459 Bacteria 5993
292 Ga0495629_0014011 3300046459 Bacteria 5778
293 Ga0495629_0030508 3300046459 Bacteria 3821
294 Ga0495641_0008210 3300046461 Bacteria 6400
295 Ga0495641_0059754 3300046461 Bacteria 1723
296 Ga0495651_0033988 3300046462 Bacteria 3975
297 Ga0495651_0082815 3300046462 Bacteria 2420
298 Ga0495651_0083669 3300046462 Bacteria 2405
299 Ga0495651_0247973 3300046462 Bacteria 1218
300 Ga0495651_0296761 3300046462 Bacteria 1085
301 Ga0495653_0005729 3300046463 Bacteria 10158
302 Ga0495653_0029724 3300046463 Bacteria 4358
303 Ga0495653_0070141 3300046463 Bacteria 2623
304 Ga0495653_0192919 3300046463 Bacteria 1388
305 Ga0495582_0026696 3300046473 Bacteria 3165
306 Ga0495582_0075058 3300046473 Bacteria 1872
307 Ga0495639_0003477 3300046475 Bacteria 6811
308 Ga0495639_0068197 3300046475 Bacteria 1639
309 Ga0495662_0005078 3300046476 Bacteria 6590
310 Ga0495662_0011149 3300046476 Bacteria 4391
311 Ga0495662_0027254 3300046476 Bacteria 2761
312 Ga0495662_0050524 3300046476 Bacteria 2007
313 Ga0495662_0099541 3300046476 Bacteria 1421
314 Ga0495662_0111073 3300046476 Bacteria 1343
315 Ga0495664_0005724 3300046477 Bacteria 6845
316 Ga0495664_0030166 3300046477 Bacteria 3175
317 Ga0495664_0055775 3300046477 Bacteria 2351
318 Ga0495664_0278211 3300046477 Bacteria 1011
319 Ga0495594_0077384 3300046499 Bacteria 1856
320 Ga0495594_0172817 3300046499 Bacteria 1229
321 Ga0495608_0001601 3300046511 Bacteria 16213
322 Ga0495608_0073264 3300046511 Bacteria 2233
323 Ga0495608_0110141 3300046511 Bacteria 1770
324 Ga0495618_0056750 3300046514 Bacteria 2479
325 Ga0495618_0058771 3300046514 Bacteria 2436
326 Ga0495618_0100083 3300046514 Bacteria 1855
327 Ga0495618_0100306 3300046514 Bacteria 1853
328 Ga0495628_0002433 3300046516 Bacteria 16783
329 Ga0495628_0034274 3300046516 Bacteria 4084
330 Ga0495628_0039720 3300046516 Bacteria 3762
331 Ga0495628_0053693 3300046516 Bacteria 3179
332 Ga0495628_0170849 3300046516 Bacteria 1648
333 Ga0495630_0058075 3300046517 Bacteria 2900
334 Ga0495630_0107836 3300046517 Bacteria 2109
335 Ga0495643_0126842 3300046522 Bacteria 1284
336 Ga0495652_0001157 3300046529 Bacteria 29740
337 Ga0495652_0039344 3300046529 Bacteria 4089
338 Ga0495652_0057416 3300046529 Bacteria 3301
339 Ga0495652_0094434 3300046529 Bacteria 2439
340 Ga0495652_0159420 3300046529 Bacteria 1753
341 Ga0495665_0100675 3300046531 Bacteria 1516
342 Ga0495640_0022956 3300046533 Bacteria 4556
343 Ga0495640_0052422 3300046533 Bacteria 2801
344 Ga0495640_0060718 3300046533 Bacteria 2570
345 Ga0495640_0117833 3300046533 Bacteria 1728
346 Ga0495587_0007428 3300046536 Bacteria 7095
347 Ga0495587_0014467 3300046536 Bacteria 4947
348 Ga0495587_0016460 3300046536 Bacteria 4599
349 Ga0495587_0069811 3300046536 Bacteria 2045
350 Ga0495587_0123502 3300046536 Bacteria 1482
351 Ga0495645_0021651 3300046543 Bacteria 4646
352 Ga0495645_0090051 3300046543 Bacteria 2193
353 Ga0495645_0119300 3300046543 Bacteria 1859
354 Ga0495667_0039934 3300046559 Bacteria 3117
355 Ga0495667_0055632 3300046559 Bacteria 2602
356 Ga0495667_0120591 3300046559 Bacteria 1693
357 Ga0495634_0008554 3300046642 Bacteria 7605
358 Ga0495634_0040013 3300046642 Bacteria 3190
359 Ga0495634_0054346 3300046642 Bacteria 2681
360 Ga0495634_0161837 3300046642 Bacteria 1411
361 Ga0495625_0043201 3300046660 Bacteria 3270
362 Ga0495635_0003578 3300046663 Bacteria 10752
363 Ga0495635_0007480 3300046663 Bacteria 7625
364 Ga0495635_0020592 3300046663 Bacteria 4593
365 Ga0495588_0000842 3300046674 Bacteria 13599
366 Ga0495588_0030953 3300046674 Bacteria 2692
367 Ga0495657_0010651 3300046675 Bacteria 6914
368 Ga0495657_0026716 3300046675 Bacteria 4085
369 Ga0495657_0029473 3300046675 Bacteria 3849
370 Ga0495657_0059733 3300046675 Bacteria 2528
371 Ga0495599_0021693 3300046678 Bacteria 4007
372 Ga0495599_0041855 3300046678 Bacteria 2875
373 Ga0495599_0066563 3300046678 Bacteria 2250
374 Ga0495623_0018975 3300046679 Bacteria 4440
375 Ga0495646_0112237 3300046680 Bacteria 1551
376 Ga0495647_0081516 3300046681 Bacteria 1313
377 Ga0495658_0021906 3300046683 Bacteria 3374
378 Ga0495613_0002435 3300046689 Bacteria 14035
379 Ga0495613_0034997 3300046689 Bacteria 3729
380 Ga0495613_0095802 3300046689 Bacteria 2146
381 Ga0495613_0106629 3300046689 Bacteria 2021
382 Ga0495624_0010481 3300046690 Bacteria 6388
383 Ga0495649_0041312 3300046694 Bacteria 2523
384 Ga0495589_0005795 3300046794 Bacteria 6516
385 Ga0495589_0047149 3300046794 Bacteria 2136
386 Ga0495600_0001701 3300046809 Bacteria 12290
387 Ga0495600_0012624 3300046809 Bacteria 5288
388 Ga0495600_0021676 3300046809 Bacteria 4118
389 Ga0495600_0024379 3300046809 Bacteria 3893
390 Ga0495581_0031110 3300047315 Bacteria 3092
391 Ga0495581_0056887 3300047315 Bacteria 2257
392 Ga0495604_0003545 3300047317 Bacteria 12448
393 Ga0495604_0029308 3300047317 Bacteria 4378
394 Ga0495604_0036815 3300047317 Bacteria 3857
395 Ga0495604_0182381 3300047317 Bacteria 1467
396 Ga0495636_0000251 3300047318 Bacteria 21247
397 Ga0495636_0006534 3300047318 Bacteria 4584
398 Ga0495636_0008206 3300047318 Bacteria 4119
399 Ga0495674_0000343 3300047319 Bacteria 41172
400 Ga0495674_0018522 3300047319 Bacteria 6481
401 Ga0495674_0044985 3300047319 Bacteria 3922
402 Ga0495674_0136288 3300047319 Bacteria 2065
403 Ga0495674_0197647 3300047319 Bacteria 1669
404 Ga0495674_0236193 3300047319 Bacteria 1507
405 Ga0495676_0007636 3300047321 Bacteria 9917
406 Ga0495676_0013313 3300047321 Bacteria 7394
407 Ga0495680_0009875 3300047322 Bacteria 8554
408 Ga0495680_0020761 3300047322 Bacteria 5515
409 Ga0495680_0077468 3300047322 Bacteria 2518
410 Ga0495680_0170728 3300047322 Bacteria 1574
411 Ga0495680_0182355 3300047322 Bacteria 1514
412 Ga0495687_004799 3300047443 Bacteria 8911
413 Ga0495675_0087053 3300047444 Bacteria 1963
414 Ga0495685_001251 3300047447 Bacteria 7772
415 Ga0495685_022439 3300047447 Bacteria 2172
416 Ga0495684_0014256 3300047471 Bacteria 6116
417 Ga0495684_0036934 3300047471 Bacteria 3745
418 Ga0495684_0038742 3300047471 Bacteria 3654
419 Ga0495684_0068224 3300047471 Bacteria 2704
420 Ga0495684_0074545 3300047471 Bacteria 2579
421 Ga0495593_0007352 3300047673 Bacteria 6449
422 Ga0495593_0012702 3300047673 Bacteria 4809
423 Ga0495593_0067032 3300047673 Bacteria 1869
424 Ga0495602_0030971 3300048088 Bacteria 5064
425 Ga0495602_0053661 3300048088 Bacteria 3567
426 Ga0495602_0135981 3300048088 Bacteria 1952
427 Ga0496101_0072169 3300048904 Bacteria 2533
428 Ga0496102_0094840 3300048905 Bacteria 2765
429 Ga0496102_0139582 3300048905 Bacteria 2272
430 Ga0496104_0004682 3300048907 Bacteria 11910
431 Ga0496104_0033555 3300048907 Bacteria 4783
432 Ga0496104_0656458 3300048907 Bacteria 958
433 Ga0496105_0003802 3300048908 Bacteria 11261
434 Ga0496105_0143774 3300048908 Bacteria 1962
435 Ga0496105_0185290 3300048908 Bacteria 1703
436 Ga0496106_0118338 3300048909 Bacteria 2068
437 Ga0496107_0030973 3300048910 Bacteria 3814
438 Ga0496107_0111068 3300048910 Bacteria 2015
439 Ga0496108_0449111 3300048911 Bacteria 1126
440 Ga0496109_0017316 3300048912 Bacteria 6314
441 Ga0496110_0124045 3300048913 Bacteria 2329
442 Ga0496112_0204170 3300048915 Bacteria 1935
443 Ga0496114_0070022 3300048917 Bacteria 2945
444 Ga0496115_0003639 3300048918 Bacteria 11093
445 Ga0496119_0071539 3300048922 Bacteria 2030
446 Ga0496126_0029920 3300048929 Bacteria 5168
447 Ga0496126_0091821 3300048929 Bacteria 2669
448 Ga0501031_0016789 3300049568 Bacteria 4755
449 Ga0501031_0047909 3300049568 Bacteria 2786
450 Ga0501031_0166573 3300049568 Bacteria 1440
451 Ga0501032_0024865 3300049569 Bacteria 4131
452 Ga0501032_0072253 3300049569 Bacteria 2299
453 Ga0501033_0006353 3300049570 Bacteria 9261
454 Ga0501033_0012072 3300049570 Bacteria 6593
455 Ga0501034_0009899 3300049571 Bacteria 9964
456 Ga0501034_0010585 3300049571 Bacteria 9596
457 Ga0501034_0015792 3300049571 Bacteria 7755
458 Ga0501036_0006820 3300049572 Bacteria 9279
459 Ga0501036_0017873 3300049572 Bacteria 5936
460 Ga0501036_0021173 3300049572 Bacteria 5462
461 Ga0501036_0060910 3300049572 Bacteria 3196
462 Ga0501036_0318026 3300049572 Bacteria 1301
463 Ga0501037_0018099 3300049573 Bacteria 5190
464 Ga0501037_0030464 3300049573 Bacteria 3987
465 Ga0501037_0070357 3300049573 Bacteria 2546
466 Ga0501037_0089574 3300049573 Bacteria 2226
467 Ga0501038_0001895 3300049574 Bacteria 19341
468 Ga0501038_0003482 3300049574 Bacteria 14660
469 Ga0501038_0022354 3300049574 Bacteria 5669
470 Ga0501038_0038695 3300049574 Bacteria 4175
471 Ga0501039_0020849 3300049575 Bacteria 5024
472 Ga0501039_0032082 3300049575 Bacteria 4049
473 Ga0501039_0040414 3300049575 Bacteria 3601
474 Ga0501040_0003972 3300049576 Bacteria 9611
475 Ga0501041_0015476 3300049577 Bacteria 4529
476 Ga0501042_0005746 3300049578 Bacteria 8013
477 Ga0501043_0000851 3300049579 Bacteria 27034
478 Ga0501043_0032910 3300049579 Bacteria 4078
479 Ga0501043_0044522 3300049579 Bacteria 3489
480 Ga0501043_0087354 3300049579 Bacteria 2450
481 Ga0501043_0094119 3300049579 Bacteria 2355
482 Ga0501046_0008281 3300049580 Bacteria 9079
483 Ga0501047_0000133 3300049581 Bacteria 90926
484 Ga0501047_0006834 3300049581 Bacteria 10720
485 Ga0501047_0029454 3300049581 Bacteria 5293
486 Ga0501047_0054707 3300049581 Bacteria 3860
487 Ga0501047_0067764 3300049581 Bacteria 3438
488 Ga0501047_0086886 3300049581 Bacteria 3005
489 Ga0501048_0016428 3300049582 Bacteria 5455
490 Ga0501048_0022457 3300049582 Bacteria 4615
491 Ga0501069_0070191 3300049585 Bacteria 1962
492 Ga0501070_0023617 3300049586 Bacteria 5151
493 Ga0501070_0069395 3300049586 Bacteria 2918
494 Ga0501071_0007135 3300049587 Bacteria 7306
495 Ga0501072_0029298 3300049588 Bacteria 4299
496 Ga0501073_0033988 3300049589 Bacteria 3630
497 Ga0501074_0029780 3300049590 Bacteria 3955
498 Ga0501074_0099256 3300049590 Bacteria 2084
499 Ga0501075_0008783 3300049591 Bacteria 7043
500 Ga0501076_0019965 3300049592 Bacteria 5126
501 Ga0501077_0014969 3300049593 Bacteria 4877
502 Ga0501079_0025093 3300049741 Bacteria 4572
503 Ga0501080_0054659 3300049742 Bacteria 3718
504 Ga0501080_0232051 3300049742 Bacteria 1686
505 Ga0501081_0016362 3300049743 Bacteria 4902
506 Ga0501035_0002338 3300049822 Bacteria 18696
507 Ga0501035_0014362 3300049822 Bacteria 7311
508 Ga0501035_0025233 3300049822 Bacteria 5449
509 Ga0501035_0032676 3300049822 Bacteria 4733
510 Ga0501035_0035684 3300049822 Bacteria 4511
511 Ga0501035_0043164 3300049822 Bacteria 4064
512 Ga0501035_0177252 3300049822 Bacteria 1838
513 Ga0501035_0257411 3300049822 Bacteria 1480
514 Ga0501044_0028457 3300049823 Bacteria 5898
515 Ga0501044_0062960 3300049823 Bacteria 3790
516 Ga0501044_0075899 3300049823 Bacteria 3412
517 Ga0501044_0097597 3300049823 Bacteria 2959
518 Ga0501044_0113372 3300049823 Bacteria 2718
519 Ga0501044_0130356 3300049823 Bacteria 2509
520 Ga0501044_0287855 3300049823 Bacteria 1575
521 Ga0501045_0025208 3300049824 Bacteria 4273
522 nmdc:mga00v17_3506_c1 3300050491 Bacteria 8111
523 nmdc:mga0yw44_41214_c1 3300050492 Bacteria 2748
524 nmdc:mga0yw44_60211_c1 3300050492 Bacteria 2325
525 nmdc:mga0n895_83650_c1 3300050512 Bacteria 3183
526 nmdc:mga0a205_36809_c1 3300050515 Bacteria 4704
527 Ga0495601_0006811 3300053077 Bacteria 6694
528 Ga0495601_0075403 3300053077 Bacteria 2159
529 Ga0495612_0048959 3300053078 Bacteria 1733
530 Ga0495595_0043451 3300053084 Bacteria 2061
531 Ga0495619_0072665 3300053085 Bacteria 2304
532 Ga0500553_041402 3300053101 Bacteria 2256
533 Ga0500614_001375 3300053123 Bacteria 5858
534 Ga0501084_0038116 3300054114 Bacteria 4018
535 Ga0501082_0071565 3300060353 Bacteria 2986
536 Ga0466962_0006779 3300061719 Bacteria 5495
537 Ga0530510_0003513 3300061734 Bacteria 10778
538 2547410103 2547132111 Bacteria 8013147
539 2645721257 2643221961 Bacteria 3919167
540 2645724729 2643221962 Bacteria 3874254
541 2784589588 2784132148 Bacteria 8627943
542 2804845683 2802429296 Bacteria 7227771
543 2809233271 2808606448 Bacteria 8656184
544 2812356860 2811994879 Bacteria 9313447
545 2812479564 2811994917 Bacteria 7761064
546 2852640472 2852635781 Bacteria 8251373
547 2862286993 2862281513 Bacteria 9621493
548 2862514426 2862507626 Bacteria 9425308
549 2862707810 2862705112 Bacteria 6563286
550 2867350125 2867346516 Bacteria 7608576
551 2873154802 2873151551 Bacteria 8625867
552 2946069010 2946064051 Bacteria 8957905
553 2947227919 2947224130 Bacteria 9938529
554 2954002999 2954002825 Bacteria 9173742
555 2990046631 2990044586 Bacteria 6603797
556 3003001437 3002998708 Bacteria 11715108
557 8008487328 8008485437 Bacteria 7198341
558 8023626378 8023623736 Bacteria 8593882
559 8025416753 8025413630 Bacteria 7014048
560 8025526522 8025524527 Bacteria 7197316
561 8033690034 8033684223 Bacteria 6906479
562 8053948904 8053945823 Bacteria 8962862
563 Ga0501034_0354286
564 rootL2_10124669
565 rootH1_10086857
566 Ga0070658_10431151
567 Ga0070683_100203658
568 Ga0070660_100085219
569 Ga0070671_100039822
570 Ga0070673_100112328
571 Ga0070659_100048058
572 Ga0070709_10071171
573 Ga0070709_10084477
574 Ga0070714_100004739
575 Ga0070714_100014181
576 Ga0070714_100114222
577 Ga0070714_100320754
578 Ga0070713_100049771
579 Ga0070713_100197500
580 Ga0070713_100344316
581 Ga0070711_100101977
582 Ga0070711_100152590
583 Ga0070705_100005283
584 Ga0070705_100271641
585 Ga0070694_100162554
586 Ga0070708_100020238
587 Ga0070708_100037036
588 Ga0070663_100021570
589 Ga0070663_100071912
590 Ga0070663_100092949
591 Ga0070678_100186716
592 Ga0070662_100066998
593 Ga0070681_10090510
594 Ga0070706_100004551
595 Ga0070706_100008619
596 Ga0070706_100024244
597 Ga0070706_100181252
598 Ga0070707_100006610
599 Ga0070707_100012902
600 Ga0070698_100002497
601 Ga0070698_100004639
602 Ga0070698_100105697
603 Ga0070699_100004163
604 Ga0070699_100024350
605 Ga0070699_100067587
606 Ga0070679_100020710
607 Ga0070679_100062903
608 Ga0070684_100165458
609 Ga0070697_100006393
610 Ga0070697_100073232
611 Ga0070697_100093117
612 Ga0068853_100130363
613 Ga0070672_100136426
614 Ga0070695_100026676
615 Ga0070696_100080305
616 Ga0070693_100013742
617 Ga0070665_100051045
618 Ga0070665_100120409
619 Ga0070704_100017298
620 Ga0068855_100006758
621 Ga0070664_100063752
622 Ga0068857_100174917
623 Ga0068857_100311023
624 Ga0068854_100051703
625 Ga0068856_100019065
626 Ga0068856_100647366
627 Ga0070702_100010849
628 Ga0068852_100057224
629 Ga0068851_10166191
630 Ga0068863_100123447
631 Ga0068862_100366119
632 Ga0081538_10001645
633 Ga0081540_1000156
634 Ga0070717_10016681
635 Ga0070717_10073701
636 Ga0070717_10079439
637 Ga0070717_10118031
638 Ga0070717_10143141
639 Ga0070717_10192424
640 Ga0070717_10258453
641 Ga0070717_10264404
642 Ga0070717_10307835
643 Ga0070717_10346024
644 Ga0070717_10430382
645 Ga0075365_10173209
646 Ga0070715_10002576
647 Ga0070715_10004597
648 Ga0070715_10039010
649 Ga0075433_10018642
650 Ga0075434_100474809
651 Ga0068865_100138067
652 Ga0075436_100274772
653 Ga0075435_100207121
654 Ga0099794_10094659
655 Ga0105251_10029369
656 Ga0105250_10047641
657 Ga0105240_10017938
658 Ga0105240_10131918
659 Ga0105245_10111472
660 Ga0105243_10053399
661 Ga0105242_10018231
662 Ga0105248_10209495
663 Ga0105237_10106725
664 Ga0105238_10008196
665 Ga0105249_10176967
666 Ga0105239_10013495
667 Ga0105239_10225451
668 Ga0157342_1000349
669 Ga0157338_1001441
670 Ga0157373_10032591
671 Ga0157369_10077270
672 Ga0157377_10039954
673 Ga0157376_10568861
674 Ga0183367_1002
675 Ga0163161_10103936
676 Ga0206353_11781108
677 Ga0213875_10001145
678 Ga0213875_10006906
679 Ga0207692_10215297
680 Ga0207688_10001780
681 Ga0207680_10259135
682 Ga0207647_10018075
683 Ga0207685_10001593
684 Ga0207699_10022550
685 Ga0207699_10058249
686 Ga0207645_10029926
687 Ga0207643_10010021
688 Ga0207684_10002229
689 Ga0207684_10020321
690 Ga0207684_10023621
691 Ga0207684_10263343
692 Ga0207707_10354067
693 Ga0207695_10000796
694 Ga0207671_10000188
695 Ga0207693_10053518
696 Ga0207693_10293998
697 Ga0207663_10004897
698 Ga0207663_10060867
699 Ga0207662_10002898
700 Ga0207657_10007834
701 Ga0207652_10062401
702 Ga0207646_10005930
703 Ga0207646_10128919
704 Ga0207681_10206380
705 Ga0207694_10000164
706 Ga0207694_10074279
707 Ga0207659_10067664
708 Ga0207687_10176338
709 Ga0207700_10001733
710 Ga0207700_10079402
711 Ga0207700_10094194
712 Ga0207700_10114244
713 Ga0207700_10234852
714 Ga0207664_10000537
715 Ga0207664_10018026
716 Ga0207664_10034746
717 Ga0207664_10120925
718 Ga0207664_10137439
719 Ga0207664_10201657
720 Ga0207664_10317869
721 Ga0207706_10007954
722 Ga0207709_10078204
723 Ga0207669_10022571
724 Ga0207665_10006793
725 Ga0207665_10262168
726 Ga0207691_10019908
727 Ga0207691_10291916
728 Ga0207689_10158966
729 Ga0207667_10078032
730 Ga0207639_10035857
731 Ga0207678_10008779
732 Ga0207678_10088166
733 Ga0207678_10098038
734 Ga0207702_10094146
735 Ga0207702_10138740
736 Ga0207641_10122279
737 Ga0207648_10070708
738 Ga0207674_10028188
739 Ga0207674_10146360
740 Ga0207675_100087695
741 Ga0207683_10001399
742 Ga0207698_10021271
743 Ga0268266_10244185
744 Ga0265337_1001133
745 Ga0265326_10005904
746 Ga0265319_1003137
747 Ga0265334_10003561
748 Ga0265318_10007460
749 Ga0265336_10002741
750 Ga0265336_10031653
751 Ga0307515_10102318
752 Ga0307515_10124197
753 Ga0265338_10000940
754 Ga0265338_10001533
755 Ga0265324_10002117
756 Ga0307512_10003006
757 Ga0307512_10032175
758 Ga0265332_10002338
759 Ga0265320_10002174
760 Ga0265325_10029424
761 Ga0265340_10003496
762 Ga0265339_10012280
763 Ga0307513_10009278
764 Ga0307513_10089121
765 Ga0307508_10015950
766 Ga0307508_10075254
767 Ga0307514_10019451
768 Ga0265314_10015935
769 Ga0265342_10001543
770 Ga0373930_0004797
771 Ga0373930_0018523
772 Ga0373948_0021795
773 Ga0373929_0004582
774 Ga0373934_0010974
775 Ga0373934_0037352
776 Ga0373940_0001690
777 Ga0373940_0015605
778 Ga0373944_0012145
779 Ga0373949_0003721
780 Ga0373951_0016441
781 Ga0373951_0023654
782 Ga0373923_0042595
783 Ga0373923_0102850
784 Ga0373932_0022245
785 Ga0373936_0011818
786 Ga0373953_0007178
787 Ga0373953_0030501
788 Ga0373954_0024214
789 Ga0373957_0111446
790 Ga0373943_0002324
791 Ga0373943_0036289
792 Ga0373943_0101683
793 Ga0373946_0000069
794 Ga0373955_0019066
795 Ga0373955_0040451
796 Ga0373955_0070145
797 Ga0373942_0008055
798 Ga0373924_0015344
799 Ga0373931_0015661
800 Ga0373935_0000749
801 Ga0373935_0104194
802 Ga0373927_0001999
803 Ga0373933_0001608
804 Ga0373933_0043920
805 Ga0373933_0068161
806 Ga0373933_0162281
807 Ga0373947_0001054
808 Ga0373947_0042270
809 Ga0373947_0171490
810 Ga0373937_0018987
811 Ga0373937_0022186
812 Ga0373937_0073064
813 Ga0373937_0142339
814 Ga0373937_0236800
815 Ga0373925_0000154
816 Ga0373925_0012026
817 Ga0373925_0247368
818 Ga0436364_0018646
819 Ga0436364_0237127
820 Ga0436364_0316403
821 Ga0436364_1307046
822 Ga0436365_0588755
823 Ga0436363_0772293
824 Ga0439436_0001217
825 Ga0439439_0004211
826 Ga0439433_0002580
827 Ga0439449_0007878
828 Ga0439457_000525
829 Ga0466969_0004931
830 Ga0466969_0006750
831 Ga0466966_0006745
832 Ga0466966_0029963
833 Ga0466961_0093432
834 Ga0466963_0023541
835 Ga0466971_0083205
836 Ga0466970_0037144
837 Ga0466959_0181197
838 Ga0466958_0003920
839 Ga0466958_0028244
840 Ga0466958_0041157
841 Ga0466967_0055784
842 Ga0466967_0111393
843 Ga0466967_0275264
844 Ga0466967_0571530
845 Ga0495592_0001763
846 Ga0495592_0012596
847 Ga0495592_0064064
848 Ga0495592_0089386
849 Ga0495592_0204998
850 Ga0495603_0005306
851 Ga0495603_0006554
852 Ga0495603_0053996
853 Ga0495629_0013094
854 Ga0495629_0014011
855 Ga0495629_0030508
856 Ga0495641_0008210
857 Ga0495641_0059754
858 Ga0495651_0033988
859 Ga0495651_0082815
860 Ga0495651_0083669
861 Ga0495651_0247973
862 Ga0495651_0296761
863 Ga0495653_0005729
864 Ga0495653_0029724
865 Ga0495653_0070141
866 Ga0495653_0192919
867 Ga0495582_0026696
868 Ga0495582_0075058
869 Ga0495639_0003477
870 Ga0495639_0068197
871 Ga0495662_0005078
872 Ga0495662_0011149
873 Ga0495662_0027254
874 Ga0495662_0050524
875 Ga0495662_0099541
876 Ga0495662_0111073
877 Ga0495664_0005724
878 Ga0495664_0030166
879 Ga0495664_0055775
880 Ga0495664_0278211
881 Ga0495594_0077384
882 Ga0495594_0172817
883 Ga0495608_0001601
884 Ga0495608_0073264
885 Ga0495608_0110141
886 Ga0495618_0056750
887 Ga0495618_0058771
888 Ga0495618_0100083
889 Ga0495618_0100306
890 Ga0495628_0002433
891 Ga0495628_0034274
892 Ga0495628_0039720
893 Ga0495628_0053693
894 Ga0495628_0170849
895 Ga0495630_0058075
896 Ga0495630_0107836
897 Ga0495643_0126842
898 Ga0495652_0001157
899 Ga0495652_0039344
900 Ga0495652_0057416
901 Ga0495652_0094434
902 Ga0495652_0159420
903 Ga0495665_0100675
904 Ga0495640_0022956
905 Ga0495640_0052422
906 Ga0495640_0060718
907 Ga0495640_0117833
908 Ga0495587_0007428
909 Ga0495587_0014467
910 Ga0495587_0016460
911 Ga0495587_0069811
912 Ga0495587_0123502
913 Ga0495645_0021651
914 Ga0495645_0090051
915 Ga0495645_0119300
916 Ga0495667_0039934
917 Ga0495667_0055632
918 Ga0495667_0120591
919 Ga0495634_0008554
920 Ga0495634_0040013
921 Ga0495634_0054346
922 Ga0495634_0161837
923 Ga0495625_0043201
924 Ga0495635_0003578
925 Ga0495635_0007480
926 Ga0495635_0020592
927 Ga0495588_0000842
928 Ga0495588_0030953
929 Ga0495657_0010651
930 Ga0495657_0026716
931 Ga0495657_0029473
932 Ga0495657_0059733
933 Ga0495599_0021693
934 Ga0495599_0041855
935 Ga0495599_0066563
936 Ga0495623_0018975
937 Ga0495646_0112237
938 Ga0495647_0081516
939 Ga0495658_0021906
940 Ga0495613_0002435
941 Ga0495613_0034997
942 Ga0495613_0095802
943 Ga0495613_0106629
944 Ga0495624_0010481
945 Ga0495649_0041312
946 Ga0495589_0005795
947 Ga0495589_0047149
948 Ga0495600_0001701
949 Ga0495600_0012624
950 Ga0495600_0021676
951 Ga0495600_0024379
952 Ga0495581_0031110
953 Ga0495581_0056887
954 Ga0495604_0003545
955 Ga0495604_0029308
956 Ga0495604_0036815
957 Ga0495604_0182381
958 Ga0495636_0000251
959 Ga0495636_0006534
960 Ga0495636_0008206
961 Ga0495674_0000343
962 Ga0495674_0018522
963 Ga0495674_0044985
964 Ga0495674_0136288
965 Ga0495674_0197647
966 Ga0495674_0236193
967 Ga0495676_0007636
968 Ga0495676_0013313
969 Ga0495680_0009875
970 Ga0495680_0020761
971 Ga0495680_0077468
972 Ga0495680_0170728
973 Ga0495680_0182355
974 Ga0495687_004799
975 Ga0495675_0087053
976 Ga0495685_001251
977 Ga0495685_022439
978 Ga0495684_0014256
979 Ga0495684_0036934
980 Ga0495684_0038742
981 Ga0495684_0068224
982 Ga0495684_0074545
983 Ga0495593_0007352
984 Ga0495593_0012702
985 Ga0495593_0067032
986 Ga0495602_0030971
987 Ga0495602_0053661
988 Ga0495602_0135981
989 Ga0496101_0072169
990 Ga0496102_0094840
991 Ga0496102_0139582
992 Ga0496104_0004682
993 Ga0496104_0033555
994 Ga0496104_0656458
995 Ga0496105_0003802
996 Ga0496105_0143774
997 Ga0496105_0185290
998 Ga0496106_0118338
999 Ga0496107_0030973
1000 Ga0496107_0111068
1001 Ga0496108_0449111
1002 Ga0496109_0017316
1003 Ga0496110_0124045
1004 Ga0496112_0204170
1005 Ga0496114_0070022
1006 Ga0496115_0003639
1007 Ga0496119_0071539
1008 Ga0496126_0029920
1009 Ga0496126_0091821
1010 Ga0501031_0016789
1011 Ga0501031_0047909
1012 Ga0501031_0166573
1013 Ga0501032_0024865
1014 Ga0501032_0072253
1015 Ga0501033_0006353
1016 Ga0501033_0012072
1017 Ga0501034_0009899
1018 Ga0501034_0010585
1019 Ga0501034_0015792
1020 Ga0501036_0006820
1021 Ga0501036_0017873
1022 Ga0501036_0021173
1023 Ga0501036_0060910
1024 Ga0501036_0318026
1025 Ga0501037_0018099
1026 Ga0501037_0030464
1027 Ga0501037_0070357
1028 Ga0501037_0089574
1029 Ga0501038_0001895
1030 Ga0501038_0003482
1031 Ga0501038_0022354
1032 Ga0501038_0038695
1033 Ga0501039_0020849
1034 Ga0501039_0032082
1035 Ga0501039_0040414
1036 Ga0501040_0003972
1037 Ga0501041_0015476
1038 Ga0501042_0005746
1039 Ga0501043_0000851
1040 Ga0501043_0032910
1041 Ga0501043_0044522
1042 Ga0501043_0087354
1043 Ga0501043_0094119
1044 Ga0501046_0008281
1045 Ga0501047_0000133
1046 Ga0501047_0006834
1047 Ga0501047_0029454
1048 Ga0501047_0054707
1049 Ga0501047_0067764
1050 Ga0501047_0086886
1051 Ga0501048_0016428
1052 Ga0501048_0022457
1053 Ga0501069_0070191
1054 Ga0501070_0023617
1055 Ga0501070_0069395
1056 Ga0501071_0007135
1057 Ga0501072_0029298
1058 Ga0501073_0033988
1059 Ga0501074_0029780
1060 Ga0501074_0099256
1061 Ga0501075_0008783
1062 Ga0501076_0019965
1063 Ga0501077_0014969
1064 Ga0501079_0025093
1065 Ga0501080_0054659
1066 Ga0501080_0232051
1067 Ga0501081_0016362
1068 Ga0501035_0002338
1069 Ga0501035_0014362
1070 Ga0501035_0025233
1071 Ga0501035_0032676
1072 Ga0501035_0035684
1073 Ga0501035_0043164
1074 Ga0501035_0177252
1075 Ga0501035_0257411
1076 Ga0501044_0028457
1077 Ga0501044_0062960
1078 Ga0501044_0075899
1079 Ga0501044_0097597
1080 Ga0501044_0113372
1081 Ga0501044_0130356
1082 Ga0501044_0287855
1083 Ga0501045_0025208
1084 nmdc:mga00v17_3506_c1
1085 nmdc:mga0yw44_41214_c1
1086 nmdc:mga0yw44_60211_c1
1087 nmdc:mga0n895_83650_c1
1088 nmdc:mga0a205_36809_c1
1089 Ga0495601_0006811
1090 Ga0495601_0075403
1091 Ga0495612_0048959
1092 Ga0495595_0043451
1093 Ga0495619_0072665
1094 Ga0500553_041402
1095 Ga0500614_001375
1096 Ga0501084_0038116
1097 Ga0501082_0071565
1098 Ga0466962_0006779
1099 Ga0530510_0003513
1100 2547410103
1101 2645721257
1102 2645724729
1103 2784589588
1104 2804845683
1105 2809233271
1106 2812356860
1107 2812479564
1108 2852640472
1109 2862286993
1110 2862514426
1111 2862707810
1112 2867350125
1113 2873154802
1114 2946069010
1115 2947227919
1116 2954002999
1117 2990046631
1118 3003001437
1119 8008487328
1120 8023626378
1121 8025416753
1122 8025526522
1123 8033690034
1124 8053948904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

109

237

0.88

Map