F463810

General Info

Members Datasets Scaffolds Average Seq Length
561 295 529 232

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100027103|Ga0075428_1000271034
Length 250
Sequence MAKQRDPAAAKAAKAEAKVTRKAASKQRRSQLWQAFQIQRKEDKRLLPYMIGAFVLIVGASTAFGIISGGFTGYMMIPLGIVLGALVAFIIFGRRAQKSVYRKAEGQTGAAAWALDNMRGKWRVTPGVAATGHFDAVHRVIGRPGVIFVGEGAANRVKPLLAQEKKRTARLIGDIPIYDIMVGNDEGDVPLAKLERHLNKLPANITVKQMDSLESRLAALGTKAGPAAMPKGPLPTQAKMRNVQRTVRRR

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221692 Nocardia sp. Root136 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
12 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
16 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
17 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
18 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
19 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
20 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
21 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
22 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
23 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
24 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
25 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
26 2922554459 Rhodococcus sp. 66b Isolate Unclassified
27 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
28 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
29 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
30 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
31 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
32 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 0.18
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 9.98
Nodule 0.18
Rhizoplane 10.87
Rhizosphere 65.95
Stem 0
Stem Tuber 0
Unclassified 12.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10032750 3300001991 Bacteria 1027
2 JGI24744J21845_10001279 3300002077 Bacteria 4954
3 JGI24744J21845_10013707 3300002077 Bacteria 1633
4 rootH2_10013176 3300003320 Bacteria 2230
5 Ga0068869_100167165 3300005334 Bacteria 1716
6 Ga0070666_10046764 3300005335 Bacteria 2904
7 Ga0070682_100028266 3300005337 Bacteria 3372
8 Ga0068868_100002198 3300005338 Bacteria 13463
9 Ga0068868_100017484 3300005338 Bacteria 5345
10 Ga0070660_100655073 3300005339 Bacteria 879
11 Ga0070691_10002160 3300005341 Bacteria 8714
12 Ga0070691_10065386 3300005341 Bacteria 1756
13 Ga0070687_100104363 3300005343 Bacteria 1593
14 Ga0070692_10012152 3300005345 Bacteria 3974
15 Ga0070668_100002215 3300005347 Bacteria 14278
16 Ga0070668_100031910 3300005347 Bacteria 4008
17 Ga0070668_100156154 3300005347 Bacteria 1848
18 Ga0070669_100049360 3300005353 Bacteria 3072
19 Ga0070669_100287099 3300005353 Bacteria 1320
20 Ga0070671_100002915 3300005355 Bacteria 13297
21 Ga0070671_100048133 3300005355 Bacteria 3545
22 Ga0070671_100174173 3300005355 Bacteria 1820
23 Ga0070674_100005625 3300005356 Bacteria 7258
24 Ga0070674_100054374 3300005356 Bacteria 2769
25 Ga0070674_100552539 3300005356 Bacteria 966
26 Ga0070673_100204785 3300005364 Bacteria 1701
27 Ga0070688_100063901 3300005365 Bacteria 2334
28 Ga0070659_100084427 3300005366 Bacteria 2539
29 Ga0070667_100000226 3300005367 Bacteria 64893
30 Ga0070667_100057286 3300005367 Bacteria 3293
31 Ga0070709_10031936 3300005434 Bacteria 3172
32 Ga0070709_10162794 3300005434 Bacteria 1553
33 Ga0070714_100082921 3300005435 Bacteria 2794
34 Ga0070710_10000917 3300005437 Bacteria 14047
35 Ga0070710_10013911 3300005437 Bacteria 4039
36 Ga0070701_10001558 3300005438 Bacteria 8514
37 Ga0070711_100000208 3300005439 Bacteria 31129
38 Ga0070705_100006620 3300005440 Bacteria 5691
39 Ga0070694_100022914 3300005444 Bacteria 4008
40 Ga0070663_100011288 3300005455 Bacteria 5601
41 Ga0070678_100000253 3300005456 Bacteria 24788
42 Ga0070662_100027190 3300005457 Bacteria 3968
43 Ga0068867_100002052 3300005459 Bacteria 14107
44 Ga0068867_100040198 3300005459 Bacteria 3411
45 Ga0070685_10012884 3300005466 Bacteria 4401
46 Ga0070685_10037588 3300005466 Bacteria 2742
47 Ga0068853_100001256 3300005539 Bacteria 18123
48 Ga0068853_100633786 3300005539 Bacteria 1017
49 Ga0070672_100195305 3300005543 Bacteria 1691
50 Ga0070695_100030245 3300005545 Bacteria 3371
51 Ga0070696_100049236 3300005546 Bacteria 2927
52 Ga0070665_100006071 3300005548 Bacteria 12348
53 Ga0070665_100183730 3300005548 Bacteria 2091
54 Ga0070704_100000212 3300005549 Bacteria 24326
55 Ga0068855_100163360 3300005563 Bacteria 2526
56 Ga0068854_100004711 3300005578 Bacteria 8596
57 Ga0068859_100000266 3300005617 Bacteria 52170
58 Ga0068859_100003756 3300005617 Bacteria 15482
59 Ga0068859_100299847 3300005617 Bacteria 1700
60 Ga0068859_100934666 3300005617 Bacteria 951
61 Ga0068866_10001293 3300005718 Bacteria 10829
62 Ga0068866_10044224 3300005718 Bacteria 2227
63 Ga0068861_100000249 3300005719 Bacteria 29767
64 Ga0068851_10064507 3300005834 Bacteria 1883
65 Ga0068863_100000843 3300005841 Bacteria 30754
66 Ga0068863_100069623 3300005841 Bacteria 3326
67 Ga0068863_100299079 3300005841 Bacteria 1561
68 Ga0068858_100000569 3300005842 Bacteria 38556
69 Ga0068858_100058134 3300005842 Bacteria 3575
70 Ga0068860_100000166 3300005843 Bacteria 108310
71 Ga0068860_100002111 3300005843 Bacteria 20965
72 Ga0068862_100000247 3300005844 Bacteria 60325
73 Ga0068862_100001437 3300005844 Bacteria 21995
74 Ga0068862_100093351 3300005844 Bacteria 2624
75 Ga0068862_100321607 3300005844 Bacteria 1428
76 Ga0081455_10072799 3300005937 Bacteria 2843
77 Ga0075365_10053992 3300006038 Bacteria 2663
78 Ga0075365_10091431 3300006038 Bacteria 2074
79 Ga0075365_10366324 3300006038 Bacteria 1016
80 Ga0075368_10075823 3300006042 Bacteria 1364
81 Ga0075363_100026881 3300006048 Bacteria 2947
82 Ga0075363_100031685 3300006048 Bacteria 2742
83 Ga0075363_100034867 3300006048 Bacteria 2629
84 Ga0075363_100049666 3300006048 Bacteria 2234
85 Ga0075363_100116342 3300006048 Bacteria 1489
86 Ga0075364_10007343 3300006051 Bacteria 6541
87 Ga0075364_10020703 3300006051 Bacteria 4139
88 Ga0075364_10033425 3300006051 Bacteria 3312
89 Ga0075364_10038502 3300006051 Bacteria 3097
90 Ga0075364_10206604 3300006051 Bacteria 1331
91 Ga0070716_100065185 3300006173 Bacteria 2120
92 Ga0070716_100067625 3300006173 Bacteria 2088
93 Ga0070712_100000740 3300006175 Bacteria 19270
94 Ga0075362_10005846 3300006177 Bacteria 4539
95 Ga0075362_10053730 3300006177 Bacteria 1809
96 Ga0075362_10084785 3300006177 Bacteria 1464
97 Ga0075367_10004264 3300006178 Bacteria 6953
98 Ga0075367_10014813 3300006178 Bacteria 4224
99 Ga0075367_10038180 3300006178 Bacteria 2794
100 Ga0075369_10001245 3300006186 Bacteria 8643
101 Ga0075369_10001351 3300006186 Bacteria 8328
102 Ga0075369_10007786 3300006186 Bacteria 4097
103 Ga0097621_100531979 3300006237 Bacteria 1068
104 Ga0075370_10014213 3300006353 Bacteria 4242
105 Ga0075370_10131435 3300006353 Bacteria 1461
106 Ga0075428_100027103 3300006844 Bacteria 6344
107 Ga0075430_100015601 3300006846 Bacteria 6468
108 Ga0068865_100000636 3300006881 Bacteria 19796
109 Ga0068865_100062179 3300006881 Bacteria 2620
110 Ga0097620_100000266 3300006931 Bacteria 52170
111 Ga0097620_100003756 3300006931 Bacteria 15482
112 Ga0097620_100299826 3300006931 Bacteria 1700
113 Ga0097620_100934671 3300006931 Bacteria 951
114 Ga0099795_10013775 3300007788 Bacteria 2491
115 Ga0105250_10058140 3300009092 Bacteria 1552
116 Ga0105245_10002991 3300009098 Bacteria 15150
117 Ga0105245_10123136 3300009098 Bacteria 2425
118 Ga0105247_10000006 3300009101 Bacteria 416061
119 Ga0105247_10001045 3300009101 Bacteria 20770
120 Ga0114129_10307137 3300009147 Bacteria 2112
121 Ga0105243_10005027 3300009148 Bacteria 10371
122 Ga0105243_10491108 3300009148 Bacteria 1161
123 Ga0105241_10106697 3300009174 Bacteria 2236
124 Ga0105242_10000519 3300009176 Bacteria 30234
125 Ga0105242_10185992 3300009176 Bacteria 1836
126 Ga0105248_10000042 3300009177 Bacteria 167583
127 Ga0105248_10050610 3300009177 Bacteria 4660
128 Ga0105248_10213435 3300009177 Bacteria 2174
129 Ga0105237_10006199 3300009545 Bacteria 13344
130 Ga0105237_10652811 3300009545 Bacteria 1059
131 Ga0105238_10283684 3300009551 Bacteria 1638
132 Ga0105249_10000008 3300009553 Bacteria 341271
133 Ga0105249_10001581 3300009553 Bacteria 19984
134 Ga0105249_10058644 3300009553 Bacteria 3528
135 Ga0105239_10007894 3300010375 Bacteria 12165
136 Ga0105239_10027691 3300010375 Bacteria 6235
137 Ga0105239_10291871 3300010375 Bacteria 1836
138 Ga0105239_10662571 3300010375 Bacteria 1192
139 Ga0105246_10135438 3300011119 Bacteria 1845
140 Ga0157369_10781335 3300013105 Bacteria 981
141 Ga0157374_10074079 3300013296 Bacteria 3214
142 Ga0157378_10000520 3300013297 Bacteria 36656
143 Ga0163162_10003026 3300013306 Bacteria 16062
144 Ga0163162_10158693 3300013306 Bacteria 2383
145 Ga0163162_10245017 3300013306 Bacteria 1924
146 Ga0163162_10443867 3300013306 Bacteria 1430
147 Ga0157372_10259875 3300013307 Bacteria 2016
148 Ga0157372_10352923 3300013307 Bacteria 1714
149 Ga0157375_10032558 3300013308 Bacteria 4945
150 Ga0157375_10083416 3300013308 Bacteria 3241
151 Ga0157375_10777933 3300013308 Bacteria 1107
152 Ga0163163_10137846 3300014325 Bacteria 2481
153 Ga0163163_10253845 3300014325 Bacteria 1809
154 Ga0163163_10872909 3300014325 Bacteria 963
155 Ga0157380_10004917 3300014326 Bacteria 9316
156 Ga0157380_10079237 3300014326 Bacteria 2682
157 Ga0157380_10295632 3300014326 Bacteria 1489
158 Ga0157377_10090171 3300014745 Bacteria 1809
159 Ga0157377_10341808 3300014745 Bacteria 1001
160 Ga0157379_10017254 3300014968 Bacteria 6360
161 Ga0157379_10021398 3300014968 Bacteria 5724
162 Ga0157379_10186047 3300014968 Bacteria 1877
163 Ga0163161_10001627 3300017792 Bacteria 16518
164 Ga0206352_10756639 3300020078 Bacteria 991
165 Ga0213874_10003800 3300021377 Bacteria 3391
166 Ga0213876_10002797 3300021384 Bacteria 10161
167 Ga0213876_10028934 3300021384 Bacteria 2922
168 Ga0213875_10060299 3300021388 Bacteria 1775
169 Ga0207653_10048875 3300025885 Bacteria 1403
170 Ga0207692_10001182 3300025898 Bacteria 9672
171 Ga0207642_10000951 3300025899 Bacteria 9056
172 Ga0207710_10000114 3300025900 Bacteria 101498
173 Ga0207710_10001573 3300025900 Bacteria 11211
174 Ga0207710_10091377 3300025900 Bacteria 1425
175 Ga0207688_10001040 3300025901 Bacteria 14224
176 Ga0207688_10010590 3300025901 Bacteria 5015
177 Ga0207688_10119005 3300025901 Bacteria 1540
178 Ga0207680_10150039 3300025903 Bacteria 1553
179 Ga0207685_10028693 3300025905 Bacteria 1963
180 Ga0207685_10058431 3300025905 Bacteria 1517
181 Ga0207699_10020317 3300025906 Bacteria 3557
182 Ga0207699_10165906 3300025906 Bacteria 1474
183 Ga0207654_10069628 3300025911 Bacteria 2085
184 Ga0207671_10015128 3300025914 Bacteria 6062
185 Ga0207693_10000824 3300025915 Bacteria 27611
186 Ga0207693_10001335 3300025915 Bacteria 21801
187 Ga0207660_10142009 3300025917 Bacteria 1837
188 Ga0207662_10048834 3300025918 Bacteria 2509
189 Ga0207681_10035901 3300025923 Bacteria 3268
190 Ga0207681_10043595 3300025923 Bacteria 3003
191 Ga0207681_10228413 3300025923 Bacteria 1443
192 Ga0207659_10134919 3300025926 Bacteria 1910
193 Ga0207687_10000930 3300025927 Bacteria 19965
194 Ga0207700_10087607 3300025928 Bacteria 2449
195 Ga0207664_10013799 3300025929 Bacteria 5815
196 Ga0207664_10300943 3300025929 Bacteria 1411
197 Ga0207644_10203468 3300025931 Bacteria 1562
198 Ga0207644_10449995 3300025931 Bacteria 1058
199 Ga0207706_10009285 3300025933 Bacteria 9029
200 Ga0207686_10013857 3300025934 Bacteria 4472
201 Ga0207709_10021683 3300025935 Bacteria 3638
202 Ga0207669_10001053 3300025937 Bacteria 11776
203 Ga0207669_10094684 3300025937 Bacteria 1955
204 Ga0207669_10177896 3300025937 Bacteria 1522
205 Ga0207704_10003583 3300025938 Bacteria 7051
206 Ga0207704_10160827 3300025938 Bacteria 1598
207 Ga0207704_10288997 3300025938 Bacteria 1250
208 Ga0207665_10055546 3300025939 Bacteria 2672
209 Ga0207665_10104122 3300025939 Bacteria 1986
210 Ga0207711_10001104 3300025941 Bacteria 25766
211 Ga0207711_10017475 3300025941 Bacteria 5959
212 Ga0207711_10054934 3300025941 Bacteria 3418
213 Ga0207711_10231144 3300025941 Bacteria 1694
214 Ga0207689_10184414 3300025942 Bacteria 1721
215 Ga0207651_10051503 3300025960 Bacteria 2802
216 Ga0207712_10000011 3300025961 Bacteria 412321
217 Ga0207712_10007605 3300025961 Bacteria 6847
218 Ga0207668_10001690 3300025972 Bacteria 12914
219 Ga0207668_10018913 3300025972 Bacteria 4342
220 Ga0207668_10221342 3300025972 Bacteria 1520
221 Ga0207640_10000683 3300025981 Bacteria 19708
222 Ga0207658_10000071 3300025986 Bacteria 112481
223 Ga0207658_10038749 3300025986 Bacteria 3436
224 Ga0207658_10095768 3300025986 Bacteria 2313
225 Ga0207658_10172675 3300025986 Bacteria 1782
226 Ga0207677_10010166 3300026023 Bacteria 5317
227 Ga0207677_10010980 3300026023 Bacteria 5145
228 Ga0207703_10009490 3300026035 Bacteria 7637
229 Ga0207703_10164389 3300026035 Bacteria 1946
230 Ga0207639_10016262 3300026041 Bacteria 5259
231 Ga0207678_10016989 3300026067 Bacteria 6388
232 Ga0207678_10069888 3300026067 Bacteria 3011
233 Ga0207641_10000683 3300026088 Bacteria 36606
234 Ga0207641_10014172 3300026088 Bacteria 6533
235 Ga0207641_10032587 3300026088 Bacteria 4326
236 Ga0207648_10002188 3300026089 Bacteria 21214
237 Ga0207648_10057145 3300026089 Bacteria 3404
238 Ga0207675_100002449 3300026118 Bacteria 18381
239 Ga0207675_100202051 3300026118 Bacteria 1909
240 Ga0207675_100305967 3300026118 Bacteria 1549
241 Ga0207683_10000334 3300026121 Bacteria 42872
242 Ga0207683_10006092 3300026121 Bacteria 10327
243 Ga0207698_10073630 3300026142 Bacteria 2721
244 Ga0209813_10039953 3300027866 Bacteria 1424
245 Ga0268266_10005347 3300028379 Bacteria 12008
246 Ga0268266_10123316 3300028379 Bacteria 2308
247 Ga0268266_10142401 3300028379 Bacteria 2152
248 Ga0268265_10000007 3300028380 Bacteria 431817
249 Ga0268265_10064413 3300028380 Bacteria 2823
250 Ga0268265_10224421 3300028380 Bacteria 1646
251 Ga0268264_10000007 3300028381 Bacteria 815790
252 Ga0268264_10001178 3300028381 Bacteria 25373
253 Ga0316578_10132510 3300031728 Bacteria 1500
254 Ga0307405_10595044 3300031731 Bacteria 902
255 Ga0307413_10015093 3300031824 Bacteria 3949
256 Ga0307413_10284920 3300031824 Bacteria 1245
257 Ga0307410_10008553 3300031852 Bacteria 5684
258 Ga0307410_10448948 3300031852 Bacteria 1051
259 Ga0307406_10069108 3300031901 Bacteria 2308
260 Ga0307406_10196900 3300031901 Bacteria 1480
261 Ga0307407_10024970 3300031903 Bacteria 3143
262 Ga0307407_10142020 3300031903 Bacteria 1550
263 Ga0307409_100033522 3300031995 Bacteria 3738
264 Ga0307416_100057801 3300032002 Bacteria 3140
265 Ga0307416_100110615 3300032002 Bacteria 2420
266 Ga0307411_10095168 3300032005 Bacteria 2090
267 Ga0307415_100107430 3300032126 Bacteria 2062
268 Ga0373939_0009318 3300035114 Bacteria 2432
269 Ga0373941_0035541 3300035115 Bacteria 1510
270 Ga0373945_0069076 3300035116 Bacteria 1334
271 Ga0373943_0142916 3300035170 Bacteria 1291
272 Ga0373931_0097624 3300035691 Bacteria 1648
273 Ga0436364_1017555 3300037853 Bacteria 4302
274 Ga0436364_1084651 3300037853 Bacteria 1312
275 Ga0436364_1113040 3300037853 Bacteria 6923
276 Ga0436364_1190183 3300037853 Bacteria 10651
277 Ga0436365_0102884 3300039437 Bacteria 3802
278 Ga0436365_0228461 3300039437 Bacteria 859
279 Ga0436365_0652744 3300039437 Bacteria 1638
280 Ga0436365_0946893 3300039437 Bacteria 3034
281 Ga0436365_1523773 3300039437 Bacteria 7712
282 Ga0436365_1896722 3300039437 Bacteria 34564
283 Ga0436361_0632395 3300039447 Bacteria 1717
284 Ga0436363_1021761 3300039450 Bacteria 5433
285 Ga0439461_0001190 3300041410 Bacteria 3974
286 Ga0439461_0002173 3300041410 Bacteria 3108
287 Ga0439466_0005423 3300041411 Bacteria 4875
288 Ga0439466_0008420 3300041411 Bacteria 3887
289 Ga0439465_0000709 3300041413 Bacteria 10248
290 Ga0439465_0007778 3300041413 Bacteria 3398
291 Ga0439465_0015277 3300041413 Bacteria 2394
292 Ga0439465_0037638 3300041413 Bacteria 1556
293 Ga0451853_0780728 3300041512 Bacteria 2625
294 Ga0451853_1467993 3300041512 Bacteria 931
295 Ga0439431_0031589 3300041997 Bacteria 1317
296 Ga0439442_038488 3300042002 Bacteria 1002
297 Ga0439445_0017793 3300042004 Bacteria 1759
298 Ga0439450_044248 3300042008 Bacteria 1042
299 Ga0439434_0005156 3300042435 Bacteria 3821
300 Ga0466969_0090257 3300044656 Bacteria 1453
301 Ga0466972_0054957 3300044658 Bacteria 1915
302 Ga0466972_0108910 3300044658 Bacteria 1309
303 Ga0466966_0002492 3300044684 Bacteria 12062
304 Ga0466966_0033937 3300044684 Bacteria 3302
305 Ga0466966_0149681 3300044684 Bacteria 1424
306 Ga0466961_0001707 3300044693 Bacteria 13678
307 Ga0466961_0012946 3300044693 Bacteria 5335
308 Ga0466961_0077457 3300044693 Bacteria 2106
309 Ga0466963_0018081 3300044694 Bacteria 4401
310 Ga0466963_0066379 3300044694 Bacteria 2420
311 Ga0466963_0310658 3300044694 Bacteria 1109
312 Ga0466963_0424127 3300044694 Bacteria 938
313 Ga0466963_0477574 3300044694 Bacteria 880
314 Ga0466963_0657104 3300044694 Bacteria 740
315 Ga0466971_0162824 3300044719 Bacteria 1044
316 Ga0466968_0001580 3300044735 Bacteria 8203
317 Ga0466968_0031542 3300044735 Bacteria 2199
318 Ga0466968_0043030 3300044735 Bacteria 1911
319 Ga0466968_0108731 3300044735 Bacteria 1245
320 Ga0466970_0003660 3300044765 Bacteria 7502
321 Ga0466970_0034688 3300044765 Bacteria 2672
322 Ga0466970_0100052 3300044765 Bacteria 1578
323 Ga0466957_0008660 3300044842 Bacteria 5792
324 Ga0466957_0010567 3300044842 Bacteria 5303
325 Ga0466957_0026769 3300044842 Bacteria 3423
326 Ga0466960_0000383 3300044901 Bacteria 15126
327 Ga0466960_0023065 3300044901 Bacteria 2790
328 Ga0466959_0017401 3300045049 Bacteria 5268
329 Ga0466959_0077623 3300045049 Bacteria 2396
330 Ga0466958_0004621 3300045836 Bacteria 7296
331 Ga0466958_0018314 3300045836 Bacteria 4063
332 Ga0466958_0023206 3300045836 Bacteria 3639
333 Ga0466958_0196659 3300045836 Bacteria 1282
334 Ga0466967_0003505 3300045976 Bacteria 10254
335 Ga0466967_0006607 3300045976 Bacteria 8238
336 Ga0466967_0009929 3300045976 Bacteria 7106
337 Ga0466967_0051125 3300045976 Bacteria 3621
338 Ga0466967_0114982 3300045976 Bacteria 2477
339 Ga0466967_0308589 3300045976 Bacteria 1523
340 Ga0495603_0002992 3300046455 Bacteria 10003
341 Ga0495638_0004205 3300046460 Bacteria 10957
342 Ga0495638_0015971 3300046460 Bacteria 5032
343 Ga0495641_0065162 3300046461 Bacteria 1640
344 Ga0495594_0250959 3300046499 Bacteria 1008
345 Ga0495607_0085296 3300046501 Bacteria 1725
346 Ga0495628_0386752 3300046516 Bacteria 1024
347 Ga0495648_0022003 3300046524 Bacteria 4400
348 Ga0495654_0059977 3300046530 Bacteria 1830
349 Ga0495640_0032423 3300046533 Bacteria 3722
350 Ga0495668_0000634 3300046616 Bacteria 42294
351 Ga0495634_0123206 3300046642 Bacteria 1659
352 Ga0495611_0032280 3300046648 Bacteria 2307
353 Ga0495649_0046791 3300046694 Bacteria 2355
354 Ga0495672_0003312 3300047320 Bacteria 13919
355 Ga0495672_0020720 3300047320 Bacteria 4303
356 Ga0495672_0127401 3300047320 Bacteria 1344
357 Ga0495676_0113557 3300047321 Bacteria 1983
358 Ga0495683_0000311 3300047323 Bacteria 41077
359 Ga0495673_0005590 3300047469 Bacteria 7568
360 Ga0495593_0014636 3300047673 Bacteria 4457
361 Ga0496100_0001835 3300048903 Bacteria 10615
362 Ga0496100_0002126 3300048903 Bacteria 9978
363 Ga0496100_0004656 3300048903 Bacteria 7301
364 Ga0496100_0005077 3300048903 Bacteria 7044
365 Ga0496100_0057687 3300048903 Bacteria 2544
366 Ga0496101_0000056 3300048904 Bacteria 135446
367 Ga0496101_0000548 3300048904 Bacteria 23001
368 Ga0496101_0002105 3300048904 Bacteria 12134
369 Ga0496101_0003247 3300048904 Bacteria 10096
370 Ga0496101_0068649 3300048904 Bacteria 2592
371 Ga0496101_0109256 3300048904 Bacteria 2080
372 Ga0496102_0000025 3300048905 Bacteria 227201
373 Ga0496102_0000277 3300048905 Bacteria 65492
374 Ga0496102_0000282 3300048905 Bacteria 64788
375 Ga0496102_0007621 3300048905 Bacteria 9250
376 Ga0496102_0025405 3300048905 Bacteria 5272
377 Ga0496102_0055689 3300048905 Bacteria 3606
378 Ga0496102_0074504 3300048905 Bacteria 3120
379 Ga0496102_0224249 3300048905 Bacteria 1772
380 Ga0496102_0261764 3300048905 Bacteria 1631
381 Ga0496103_0000022 3300048906 Bacteria 227208
382 Ga0496103_0000498 3300048906 Bacteria 32388
383 Ga0496103_0000889 3300048906 Bacteria 21586
384 Ga0496103_0001027 3300048906 Bacteria 19533
385 Ga0496104_0003659 3300048907 Bacteria 13274
386 Ga0496104_0028890 3300048907 Bacteria 5142
387 Ga0496105_0004792 3300048908 Bacteria 10216
388 Ga0496105_0016926 3300048908 Bacteria 5833
389 Ga0496106_0003076 3300048909 Bacteria 12445
390 Ga0496106_0022721 3300048909 Bacteria 4661
391 Ga0496106_0025382 3300048909 Bacteria 4410
392 Ga0496106_0086353 3300048909 Bacteria 2416
393 Ga0496106_0124759 3300048909 Bacteria 2015
394 Ga0496107_0000533 3300048910 Bacteria 21209
395 Ga0496107_0022670 3300048910 Bacteria 4439
396 Ga0496107_0083424 3300048910 Bacteria 2330
397 Ga0496107_0097545 3300048910 Bacteria 2152
398 Ga0496108_0000506 3300048911 Bacteria 30708
399 Ga0496108_0014922 3300048911 Bacteria 6342
400 Ga0496108_0015573 3300048911 Bacteria 6202
401 Ga0496108_0054460 3300048911 Bacteria 3357
402 Ga0496108_0065033 3300048911 Bacteria 3073
403 Ga0496109_0012748 3300048912 Bacteria 7265
404 Ga0496109_0136606 3300048912 Bacteria 2291
405 Ga0496109_0171049 3300048912 Bacteria 2038
406 Ga0496109_0339833 3300048912 Bacteria 1418
407 Ga0496110_0019572 3300048913 Bacteria 5700
408 Ga0496112_0044381 3300048915 Bacteria 4355
409 Ga0496112_0079282 3300048915 Bacteria 3248
410 Ga0496112_0131882 3300048915 Bacteria 2470
411 Ga0496112_0180078 3300048915 Bacteria 2077
412 Ga0496112_0268273 3300048915 Bacteria 1655
413 Ga0496113_0145433 3300048916 Bacteria 1867
414 Ga0496113_0623182 3300048916 Bacteria 863
415 Ga0496113_0678178 3300048916 Bacteria 823
416 Ga0496114_0000285 3300048917 Bacteria 36880
417 Ga0496114_0000671 3300048917 Bacteria 25392
418 Ga0496114_0252839 3300048917 Bacteria 1551
419 Ga0496115_0003493 3300048918 Bacteria 11299
420 Ga0496115_0020569 3300048918 Bacteria 5091
421 Ga0496115_0029657 3300048918 Bacteria 4298
422 Ga0496116_0000059 3300048919 Bacteria 274491
423 Ga0496116_0000490 3300048919 Bacteria 54489
424 Ga0496117_0000055 3300048920 Bacteria 274518
425 Ga0496117_0000595 3300048920 Bacteria 59503
426 Ga0496117_0001568 3300048920 Bacteria 32443
427 Ga0496118_0000058 3300048921 Bacteria 227245
428 Ga0496118_0000225 3300048921 Bacteria 98639
429 Ga0496118_0000502 3300048921 Bacteria 64792
430 Ga0496118_0001085 3300048921 Bacteria 42355
431 Ga0496119_0000668 3300048922 Bacteria 45998
432 Ga0496119_0001939 3300048922 Bacteria 23572
433 Ga0496119_0008245 3300048922 Bacteria 9209
434 Ga0496120_0002577 3300048923 Bacteria 18062
435 Ga0496120_0004794 3300048923 Bacteria 11095
436 Ga0496120_0005668 3300048923 Bacteria 9871
437 Ga0496121_0000060 3300048924 Bacteria 276682
438 Ga0496121_0004107 3300048924 Bacteria 19963
439 Ga0496121_0026848 3300048924 Bacteria 5408
440 Ga0496121_0225642 3300048924 Bacteria 1316
441 Ga0496122_0013420 3300048925 Bacteria 8021
442 Ga0496123_0009293 3300048926 Bacteria 8872
443 Ga0496124_0050461 3300048927 Bacteria 3545
444 Ga0496124_0181963 3300048927 Bacteria 1616
445 Ga0496125_0010201 3300048928 Bacteria 9523
446 Ga0496125_0042071 3300048928 Bacteria 3897
447 Ga0496125_0059390 3300048928 Bacteria 3081
448 Ga0496125_0106653 3300048928 Bacteria 2044
449 Ga0496126_0000799 3300048929 Bacteria 56430
450 Ga0496126_0002848 3300048929 Bacteria 22633
451 Ga0496126_0004145 3300048929 Bacteria 17522
452 Ga0496126_0005848 3300048929 Bacteria 13887
453 Ga0496126_0007025 3300048929 Bacteria 12419
454 Ga0496126_0014054 3300048929 Bacteria 8110
455 Ga0501032_0005219 3300049569 Bacteria 9668
456 Ga0501032_0005560 3300049569 Bacteria 9347
457 Ga0501032_0055033 3300049569 Bacteria 2677
458 Ga0501033_0015195 3300049570 Bacteria 5843
459 Ga0501034_0011280 3300049571 Bacteria 9274
460 Ga0501034_0023898 3300049571 Bacteria 6221
461 Ga0501034_0059361 3300049571 Bacteria 3842
462 Ga0501034_0109470 3300049571 Bacteria 2754
463 Ga0501036_0069564 3300049572 Bacteria 2977
464 Ga0501036_0262255 3300049572 Bacteria 1447
465 Ga0501037_0002804 3300049573 Bacteria 12628
466 Ga0501037_0181917 3300049573 Bacteria 1491
467 Ga0501038_0020859 3300049574 Bacteria 5889
468 Ga0501038_0254500 3300049574 Bacteria 1390
469 Ga0501039_0009179 3300049575 Bacteria 7535
470 Ga0501043_0005442 3300049579 Bacteria 10291
471 Ga0501043_0048036 3300049579 Bacteria 3355
472 Ga0501043_0140691 3300049579 Bacteria 1890
473 Ga0501046_0002482 3300049580 Bacteria 17295
474 Ga0501047_0001295 3300049581 Bacteria 24656
475 Ga0501047_0022572 3300049581 Bacteria 6042
476 Ga0501048_0201561 3300049582 Bacteria 1410
477 Ga0501067_0083130 3300049583 Bacteria 1776
478 Ga0501069_0025714 3300049585 Bacteria 3219
479 Ga0501069_0036823 3300049585 Bacteria 2699
480 Ga0501070_0003668 3300049586 Bacteria 13274
481 Ga0501070_0013767 3300049586 Bacteria 6813
482 Ga0501070_0171604 3300049586 Bacteria 1786
483 Ga0501073_0041284 3300049589 Bacteria 3260
484 Ga0501073_0273889 3300049589 Bacteria 1165
485 Ga0501080_0380076 3300049742 Bacteria 1273
486 Ga0501080_0393753 3300049742 Bacteria 1247
487 Ga0501035_0000147 3300049822 Bacteria 85803
488 Ga0501035_0002649 3300049822 Bacteria 17413
489 Ga0501044_0000152 3300049823 Bacteria 85715
490 Ga0501044_0006657 3300049823 Bacteria 12740
491 Ga0501044_0092585 3300049823 Bacteria 3049
492 Ga0501044_0100874 3300049823 Bacteria 2904
493 nmdc:mga03683_172246_c1 3300050489 Bacteria 984
494 nmdc:mga03n38_3860_c1 3300050490 Bacteria 4875
495 nmdc:mga00v17_4183_c1 3300050491 Bacteria 7485
496 nmdc:mga00v17_42743_c1 3300050491 Bacteria 2727
497 nmdc:mga00v17_5595_c1 3300050491 Bacteria 5844
498 nmdc:mga00v17_86166_c1 3300050491 Bacteria 1968
499 nmdc:mga0yw44_21979_c1 3300050492 Bacteria 3568
500 nmdc:mga0yw44_47839_c1 3300050492 Bacteria 2576
501 nmdc:mga0yw44_4903_c1 3300050492 Bacteria 6228
502 nmdc:mga0yw44_61730_c1 3300050492 Bacteria 2300
503 nmdc:mga06z11_118011_c1 3300050494 Bacteria 1477
504 nmdc:mga06z11_258041_c1 3300050494 Bacteria 1028
505 nmdc:mga04h51_47729_c1 3300050495 Bacteria 1424
506 nmdc:mga07m45_199840_c1 3300050496 Bacteria 1163
507 nmdc:mga07m45_21196_c1 3300050496 Bacteria 3536
508 nmdc:mga05p37_199722_c1 3300050507 Bacteria 2423
509 nmdc:mga0qj67_207397_c1 3300050509 Bacteria 1592
510 nmdc:mga06r32_868166_c1 3300050510 Bacteria 860
511 nmdc:mga0sz30_1932_c1 3300050516 Bacteria 7401
512 nmdc:mga0sz30_23301_c1 3300050516 Bacteria 2518
513 nmdc:mga0sz30_832_c1 3300050516 Bacteria 10312
514 Ga0500610_0050382 3300053079 Bacteria 2167
515 Ga0500635_0001934 3300053080 Bacteria 5056
516 Ga0495655_0027122 3300053083 Bacteria 1356
517 Ga0495619_0304940 3300053085 Bacteria 1103
518 Ga0500643_006425 3300053087 Bacteria 4913
519 Ga0500652_021251 3300053131 Bacteria 2442
520 Ga0500652_038894 3300053131 Bacteria 1905
521 Ga0500658_0147399 3300053134 Bacteria 1059
522 Ga0500577_0021898 3300053142 Bacteria 2113
523 Ga0500616_0008631 3300053153 Bacteria 6306
524 Ga0500616_0053787 3300053153 Bacteria 2111
525 Ga0500627_0062002 3300053158 Bacteria 1646
526 Ga0500627_0069491 3300053158 Bacteria 1558
527 Ga0500645_000074 3300053730 Bacteria 78753
528 Ga0466962_0022429 3300061719 Bacteria 3033
529 Ga0466962_0147746 3300061719 Bacteria 1140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0250959 Ga0495594_0250959_197_949 185
2 3300046533 Ga0495640_0032423 Ga0495640_0032423_145_897 185
3 3300035116 Ga0373945_0069076 Ga0373945_0069076_412_1164 186
4 3300035170 Ga0373943_0142916 Ga0373943_0142916_51_803 186
5 3300046455 Ga0495603_0002992 Ga0495603_0002992_1791_2543 186
6 3300046461 Ga0495641_0065162 Ga0495641_0065162_429_1181 186
7 3300046516 Ga0495628_0386752 Ga0495628_0386752_206_958 186
8 3300046616 Ga0495668_0000634 Ga0495668_0000634_328_1083 186
9 3300046642 Ga0495634_0123206 Ga0495634_0123206_60_812 186
10 3300047321 Ga0495676_0113557 Ga0495676_0113557_281_1033 186
11 3300047673 Ga0495593_0014636 Ga0495593_0014636_166_918 186
12 3300048928 Ga0496125_0059390 Ga0496125_0059390_463_1218 186
13 3300053085 Ga0495619_0304940 Ga0495619_0304940_316_1068 186
14 3300044719 Ga0466971_0162824 Ga0466971_0162824_34_639 192
15 3300046524 Ga0495648_0022003 Ga0495648_0022003_2287_3042 192
16 3300046530 Ga0495654_0059977 Ga0495654_0059977_495_1250 192
17 3300046648 Ga0495611_0032280 Ga0495611_0032280_654_1409 192
18 3300047320 Ga0495672_0003312 Ga0495672_0003312_11962_12717 192
19 3300047469 Ga0495673_0005590 Ga0495673_0005590_2803_3558 192
20 3300048916 Ga0496113_0623182 Ga0496113_0623182_231_836 192
21 3300048918 Ga0496115_0029657 Ga0496115_0029657_3624_4229 192
22 3300050494 nmdc:mga06z11_258041_c1 nmdc:mga06z11_258041_c1_382_987 192
23 3300053087 Ga0500643_006425 Ga0500643_006425_2588_3343 192
24 3300044684 Ga0466966_0002492 Ga0466966_0002492_11186_11938 200
25 3300044693 Ga0466961_0001707 Ga0466961_0001707_8464_9216 200
26 3300044735 Ga0466968_0043030 Ga0466968_0043030_377_1129 200
27 3300044842 Ga0466957_0010567 Ga0466957_0010567_2260_3012 200
28 3300045836 Ga0466958_0004621 Ga0466958_0004621_1632_2384 200
29 3300046501 Ga0495607_0085296 Ga0495607_0085296_703_1449 200
30 3300047323 Ga0495683_0000311 Ga0495683_0000311_27034_27780 200
31 3300061719 Ga0466962_0147746 Ga0466962_0147746_350_1102 200
32 3300013306 Ga0163162_10245017 Ga0163162_102450171 202
33 3300039437 Ga0436365_0652744 Ga0436365_0652744_649_1401 202
34 3300044694 Ga0466963_0477574 Ga0466963_0477574_45_797 202
35 3300049823 Ga0501044_0006657 Ga0501044_0006657_242_994 202
36 3300048916 Ga0496113_0678178 Ga0496113_0678178_22_663 204
37 3300053158 Ga0500627_0062002 Ga0500627_0062002_581_1336 204
38 3300045976 Ga0466967_0003505 Ga0466967_0003505_4595_5347 207
39 3300049571 Ga0501034_0109470 Ga0501034_0109470_1507_2259 208
40 3300053131 Ga0500652_038894 Ga0500652_038894_1008_1760 209
41 3300044694 Ga0466963_0657104 Ga0466963_0657104_69_728 210
42 3300005466 Ga0070685_10037588 Ga0070685_100375882 211
43 3300014326 Ga0157380_10295632 Ga0157380_102956322 211
44 3300020078 Ga0206352_10756639 Ga0206352_107566392 211
45 3300005356 Ga0070674_100552539 Ga0070674_1005525391 213
46 3300025901 Ga0207688_10119005 Ga0207688_101190052 213
47 3300025937 Ga0207669_10177896 Ga0207669_101778962 213
48 3300044694 Ga0466963_0018081 Ga0466963_0018081_1972_2727 213
49 3300049569 Ga0501032_0055033 Ga0501032_0055033_945_1697 213
50 3300049570 Ga0501033_0015195 Ga0501033_0015195_4774_5526 213
51 3300049571 Ga0501034_0023898 Ga0501034_0023898_2249_3001 213
52 3300049579 Ga0501043_0140691 Ga0501043_0140691_1044_1796 213
53 3300049822 Ga0501035_0000147 Ga0501035_0000147_50852_51604 213
54 3300049823 Ga0501044_0000152 Ga0501044_0000152_50744_51496 213
55 3300048912 Ga0496109_0339833 Ga0496109_0339833_241_993 214
56 3300048915 Ga0496112_0268273 Ga0496112_0268273_386_1138 214
57 3300037853 Ga0436364_1190183 Ga0436364_1190183_5770_6522 215
58 3300041512 Ga0451853_0780728 Ga0451853_0780728_1326_2066 215
59 iso_pu_bacteria 2551306166 2552107018 216
60 3300009545 Ga0105237_10652811 Ga0105237_106528112 217
61 3300014325 Ga0163163_10872909 Ga0163163_108729091 217
62 3300014968 Ga0157379_10017254 Ga0157379_100172544 217
63 3300025900 Ga0207710_10091377 Ga0207710_100913772 217
64 3300026088 Ga0207641_10014172 Ga0207641_100141724 217
65 3300048903 Ga0496100_0057687 Ga0496100_0057687_1263_1994 217
66 3300048904 Ga0496101_0003247 Ga0496101_0003247_8304_9035 217
67 3300048905 Ga0496102_0000282 Ga0496102_0000282_22026_22757 217
68 3300048906 Ga0496103_0000498 Ga0496103_0000498_9645_10376 217
69 3300048908 Ga0496105_0016926 Ga0496105_0016926_4025_4756 217
70 3300048909 Ga0496106_0086353 Ga0496106_0086353_1380_2132 217
71 3300048910 Ga0496107_0022670 Ga0496107_0022670_1793_2545 217
72 3300048911 Ga0496108_0015573 Ga0496108_0015573_3493_4224 217
73 3300048912 Ga0496109_0171049 Ga0496109_0171049_454_1185 217
74 3300048919 Ga0496116_0000490 Ga0496116_0000490_42077_42808 217
75 3300048920 Ga0496117_0001568 Ga0496117_0001568_9679_10410 217
76 3300048921 Ga0496118_0000502 Ga0496118_0000502_42032_42763 217
77 3300048922 Ga0496119_0008245 Ga0496119_0008245_2321_3052 217
78 3300048923 Ga0496120_0004794 Ga0496120_0004794_6884_7615 217
79 3300048924 Ga0496121_0026848 Ga0496121_0026848_418_1149 217
80 3300048927 Ga0496124_0050461 Ga0496124_0050461_2435_3166 217
81 3300048928 Ga0496125_0042071 Ga0496125_0042071_2660_3391 217
82 3300048929 Ga0496126_0000799 Ga0496126_0000799_46096_46827 217
83 iso_pu_bacteria 2738543011 2739238289 217
84 iso_pu_bacteria 2889300758 2889302248 217
85 iso_pu_bacteria 2939743619 2939748326 217
86 iso_pu_bacteria 2974315732 2974317015 217
87 iso_pu_bacteria 2984523437 2984525222 217
88 3300014325 Ga0163163_10137846 Ga0163163_101378463 218
89 3300046460 Ga0495638_0004205 Ga0495638_0004205_6637_7392 218
90 3300046460 Ga0495638_0015971 Ga0495638_0015971_164_916 218
91 3300049586 Ga0501070_0171604 Ga0501070_0171604_181_933 218
92 3300049589 Ga0501073_0273889 Ga0501073_0273889_62_814 218
93 3300049742 Ga0501080_0380076 Ga0501080_0380076_38_790 218
94 3300053142 Ga0500577_0021898 Ga0500577_0021898_710_1465 218
95 iso_pu_bacteria 2565956761 2566996880 218
96 iso_pu_bacteria 2643221687 2644488879 218
97 iso_pu_bacteria 2643221692 2644516622 218
98 iso_pu_bacteria 2643221715 2644638618 218
99 iso_pu_bacteria 2738541264 2738668004 218
100 iso_pu_bacteria 2738541274 2738703876 218
101 iso_pu_bacteria 2738541308 2738887033 218
102 iso_pu_bacteria 2738541356 2739147074 218
103 iso_pu_bacteria 2738543005 2739203523 218
104 iso_pu_bacteria 2738543028 2739330750 218
105 iso_pu_bacteria 2738543034 2739366651 218
106 iso_pu_bacteria 2842134933 2842137457 218
107 iso_pu_bacteria 2902792274 2902797015 218
108 iso_pu_bacteria 2902799365 2902804018 218
109 iso_pu_bacteria 2902810491 2902812808 218
110 iso_pu_bacteria 2902837492 2902838840 218
111 iso_pu_bacteria 2904535858 2904540046 218
112 iso_pu_bacteria 2904765812 2904769417 218
113 iso_pu_bacteria 2904770941 2904772973 218
114 iso_pu_bacteria 2908811453 2908814202 218
115 iso_pu_bacteria 2919420072 2919422661 218
116 iso_pu_bacteria 2919432681 2919435086 218
117 iso_pu_bacteria 2922554459 2922560550 218
118 iso_pu_bacteria 2928142448 2928146130 218
119 iso_pu_bacteria 2939582691 2939588413 218
120 3300005355 Ga0070671_100174173 Ga0070671_1001741732 219
121 3300005718 Ga0068866_10044224 Ga0068866_100442242 219
122 3300006051 Ga0075364_10038502 Ga0075364_100385022 219
123 3300006178 Ga0075367_10014813 Ga0075367_100148133 219
124 3300009177 Ga0105248_10213435 Ga0105248_102134352 219
125 3300013308 Ga0157375_10083416 Ga0157375_100834163 219
126 3300025931 Ga0207644_10203468 Ga0207644_102034683 219
127 3300025937 Ga0207669_10094684 Ga0207669_100946841 219
128 3300025941 Ga0207711_10017475 Ga0207711_100174753 219
129 3300046694 Ga0495649_0046791 Ga0495649_0046791_266_1030 219
130 3300048903 Ga0496100_0005077 Ga0496100_0005077_2107_2865 219
131 3300048904 Ga0496101_0000548 Ga0496101_0000548_11665_12423 219
132 3300048905 Ga0496102_0224249 Ga0496102_0224249_260_1018 219
133 3300048907 Ga0496104_0003659 Ga0496104_0003659_8081_8839 219
134 3300048908 Ga0496105_0004792 Ga0496105_0004792_1387_2145 219
135 3300048909 Ga0496106_0022721 Ga0496106_0022721_2105_2863 219
136 3300048910 Ga0496107_0083424 Ga0496107_0083424_1193_1951 219
137 3300048917 Ga0496114_0000671 Ga0496114_0000671_17875_18633 219
138 3300048918 Ga0496115_0020569 Ga0496115_0020569_2036_2794 219
139 3300050492 nmdc:mga0yw44_21979_c1 nmdc:mga0yw44_21979_c1_1465_2217 219
140 3300053134 Ga0500658_0147399 Ga0500658_0147399_101_853 219
141 3300006048 Ga0075363_100049666 Ga0075363_1000496662 220
142 3300006048 Ga0075363_100116342 Ga0075363_1001163422 220
143 3300006051 Ga0075364_10033425 Ga0075364_100334252 220
144 3300006051 Ga0075364_10206604 Ga0075364_102066042 220
145 3300006177 Ga0075362_10005846 Ga0075362_100058465 220
146 3300006178 Ga0075367_10004264 Ga0075367_100042645 220
147 3300006186 Ga0075369_10001245 Ga0075369_100012453 220
148 3300006353 Ga0075370_10014213 Ga0075370_100142135 220
149 3300006353 Ga0075370_10131435 Ga0075370_101314352 220
150 3300009553 Ga0105249_10000008 Ga0105249_1000000874 220
151 3300025961 Ga0207712_10000011 Ga0207712_10000011245 220
152 3300031824 Ga0307413_10015093 Ga0307413_100150931 220
153 3300031852 Ga0307410_10008553 Ga0307410_100085535 220
154 3300031901 Ga0307406_10196900 Ga0307406_101969002 220
155 3300031903 Ga0307407_10024970 Ga0307407_100249704 220
156 3300031995 Ga0307409_100033522 Ga0307409_1000335223 220
157 3300032002 Ga0307416_100057801 Ga0307416_1000578014 220
158 3300032005 Ga0307411_10095168 Ga0307411_100951682 220
159 3300032126 Ga0307415_100107430 Ga0307415_1001074303 220
160 3300041413 Ga0439465_0000709 Ga0439465_0000709_5052_5804 220
161 3300041997 Ga0439431_0031589 Ga0439431_0031589_70_822 220
162 3300042002 Ga0439442_038488 Ga0439442_038488_221_973 220
163 3300048917 Ga0496114_0252839 Ga0496114_0252839_427_1179 220
164 3300048928 Ga0496125_0106653 Ga0496125_0106653_905_1657 220
165 3300048929 Ga0496126_0007025 Ga0496126_0007025_1735_2487 220
166 3300050489 nmdc:mga03683_172246_c1 nmdc:mga03683_172246_c1_193_945 220
167 3300050491 nmdc:mga00v17_86166_c1 nmdc:mga00v17_86166_c1_680_1432 220
168 3300050496 nmdc:mga07m45_199840_c1 nmdc:mga07m45_199840_c1_182_934 220
169 3300050496 nmdc:mga07m45_21196_c1 nmdc:mga07m45_21196_c1_2550_3302 220
170 3300050516 nmdc:mga0sz30_1932_c1 nmdc:mga0sz30_1932_c1_1743_2495 220
171 3300053080 Ga0500635_0001934 Ga0500635_0001934_1216_1977 220
172 3300053131 Ga0500652_021251 Ga0500652_021251_448_1209 220
173 3300053153 Ga0500616_0053787 Ga0500616_0053787_677_1432 220
174 3300053158 Ga0500627_0069491 Ga0500627_0069491_637_1389 220
175 3300053730 Ga0500645_000074 Ga0500645_000074_63833_64585 220
176 3300005355 Ga0070671_100002915 Ga0070671_10000291510 221
177 3300006048 Ga0075363_100031685 Ga0075363_1000316852 221
178 3300006177 Ga0075362_10053730 Ga0075362_100537302 221
179 3300006237 Ga0097621_100531979 Ga0097621_1005319791 221
180 3300009098 Ga0105245_10123136 Ga0105245_101231362 221
181 3300014325 Ga0163163_10253845 Ga0163163_102538452 221
182 3300021377 Ga0213874_10003800 Ga0213874_100038003 221
183 3300025931 Ga0207644_10449995 Ga0207644_104499952 221
184 3300025938 Ga0207704_10288997 Ga0207704_102889972 221
185 3300035691 Ga0373931_0097624 Ga0373931_0097624_13_765 221
186 3300039450 Ga0436363_1021761 Ga0436363_1021761_2281_3033 221
187 3300041512 Ga0451853_1467993 Ga0451853_1467993_133_888 221
188 3300048904 Ga0496101_0068649 Ga0496101_0068649_1418_2170 221
189 3300048905 Ga0496102_0007621 Ga0496102_0007621_1561_2316 221
190 3300048911 Ga0496108_0014922 Ga0496108_0014922_3922_4677 221
191 3300048913 Ga0496110_0019572 Ga0496110_0019572_3906_4661 221
192 3300048915 Ga0496112_0044381 Ga0496112_0044381_1097_1852 221
193 3300048915 Ga0496112_0180078 Ga0496112_0180078_870_1622 221
194 3300048924 Ga0496121_0225642 Ga0496121_0225642_77_829 221
195 3300048925 Ga0496122_0013420 Ga0496122_0013420_182_934 221
196 3300048926 Ga0496123_0009293 Ga0496123_0009293_2236_2988 221
197 3300048929 Ga0496126_0014054 Ga0496126_0014054_3418_4170 221
198 3300053083 Ga0495655_0027122 Ga0495655_0027122_456_1211 221
199 3300001991 JGI24743J22301_10032750 JGI24743J22301_100327502 222
200 3300002077 JGI24744J21845_10001279 JGI24744J21845_100012792 222
201 3300002077 JGI24744J21845_10013707 JGI24744J21845_100137073 222
202 3300003320 rootH2_10013176 rootH2_100131761 222
203 3300005334 Ga0068869_100167165 Ga0068869_1001671652 222
204 3300005335 Ga0070666_10046764 Ga0070666_100467643 222
205 3300005337 Ga0070682_100028266 Ga0070682_1000282664 222
206 3300005338 Ga0068868_100002198 Ga0068868_10000219812 222
207 3300005338 Ga0068868_100017484 Ga0068868_1000174845 222
208 3300005339 Ga0070660_100655073 Ga0070660_1006550731 222
209 3300005341 Ga0070691_10002160 Ga0070691_100021608 222
210 3300005341 Ga0070691_10065386 Ga0070691_100653863 222
211 3300005343 Ga0070687_100104363 Ga0070687_1001043631 222
212 3300005345 Ga0070692_10012152 Ga0070692_100121522 222
213 3300005347 Ga0070668_100002215 Ga0070668_1000022153 222
214 3300005347 Ga0070668_100031910 Ga0070668_1000319104 222
215 3300005347 Ga0070668_100156154 Ga0070668_1001561542 222
216 3300005353 Ga0070669_100049360 Ga0070669_1000493602 222
217 3300005353 Ga0070669_100287099 Ga0070669_1002870992 222
218 3300005355 Ga0070671_100048133 Ga0070671_1000481334 222
219 3300005356 Ga0070674_100005625 Ga0070674_1000056252 222
220 3300005356 Ga0070674_100054374 Ga0070674_1000543741 222
221 3300005364 Ga0070673_100204785 Ga0070673_1002047852 222
222 3300005365 Ga0070688_100063901 Ga0070688_1000639012 222
223 3300005366 Ga0070659_100084427 Ga0070659_1000844273 222
224 3300005367 Ga0070667_100000226 Ga0070667_10000022646 222
225 3300005367 Ga0070667_100057286 Ga0070667_1000572862 222
226 3300005434 Ga0070709_10031936 Ga0070709_100319362 222
227 3300005434 Ga0070709_10162794 Ga0070709_101627942 222
228 3300005435 Ga0070714_100082921 Ga0070714_1000829213 222
229 3300005437 Ga0070710_10000917 Ga0070710_100009175 222
230 3300005437 Ga0070710_10013911 Ga0070710_100139112 222
231 3300005438 Ga0070701_10001558 Ga0070701_100015583 222
232 3300005439 Ga0070711_100000208 Ga0070711_10000020820 222
233 3300005440 Ga0070705_100006620 Ga0070705_1000066205 222
234 3300005444 Ga0070694_100022914 Ga0070694_1000229142 222
235 3300005455 Ga0070663_100011288 Ga0070663_1000112885 222
236 3300005456 Ga0070678_100000253 Ga0070678_10000025310 222
237 3300005457 Ga0070662_100027190 Ga0070662_1000271903 222
238 3300005459 Ga0068867_100002052 Ga0068867_1000020527 222
239 3300005459 Ga0068867_100040198 Ga0068867_1000401983 222
240 3300005466 Ga0070685_10012884 Ga0070685_100128842 222
241 3300005539 Ga0068853_100001256 Ga0068853_1000012568 222
242 3300005539 Ga0068853_100633786 Ga0068853_1006337862 222
243 3300005543 Ga0070672_100195305 Ga0070672_1001953053 222
244 3300005545 Ga0070695_100030245 Ga0070695_1000302452 222
245 3300005546 Ga0070696_100049236 Ga0070696_1000492363 222
246 3300005548 Ga0070665_100006071 Ga0070665_1000060713 222
247 3300005548 Ga0070665_100183730 Ga0070665_1001837302 222
248 3300005549 Ga0070704_100000212 Ga0070704_1000002127 222
249 3300005563 Ga0068855_100163360 Ga0068855_1001633602 222
250 3300005578 Ga0068854_100004711 Ga0068854_1000047112 222
251 3300005617 Ga0068859_100000266 Ga0068859_10000026612 222
252 3300005617 Ga0068859_100003756 Ga0068859_10000375612 222
253 3300005617 Ga0068859_100299847 Ga0068859_1002998472 222
254 3300005617 Ga0068859_100934666 Ga0068859_1009346661 222
255 3300005718 Ga0068866_10001293 Ga0068866_100012937 222
256 3300005719 Ga0068861_100000249 Ga0068861_1000002498 222
257 3300005834 Ga0068851_10064507 Ga0068851_100645072 222
258 3300005841 Ga0068863_100000843 Ga0068863_10000084318 222
259 3300005841 Ga0068863_100069623 Ga0068863_1000696233 222
260 3300005841 Ga0068863_100299079 Ga0068863_1002990792 222
261 3300005842 Ga0068858_100000569 Ga0068858_10000056927 222
262 3300005842 Ga0068858_100058134 Ga0068858_1000581343 222
263 3300005843 Ga0068860_100000166 Ga0068860_10000016643 222
264 3300005843 Ga0068860_100002111 Ga0068860_10000211112 222
265 3300005844 Ga0068862_100000247 Ga0068862_10000024746 222
266 3300005844 Ga0068862_100001437 Ga0068862_10000143710 222
267 3300005844 Ga0068862_100093351 Ga0068862_1000933513 222
268 3300005844 Ga0068862_100321607 Ga0068862_1003216072 222
269 3300005937 Ga0081455_10072799 Ga0081455_100727993 222
270 3300006038 Ga0075365_10053992 Ga0075365_100539922 222
271 3300006038 Ga0075365_10091431 Ga0075365_100914313 222
272 3300006038 Ga0075365_10366324 Ga0075365_103663242 222
273 3300006042 Ga0075368_10075823 Ga0075368_100758232 222
274 3300006048 Ga0075363_100026881 Ga0075363_1000268813 222
275 3300006048 Ga0075363_100034867 Ga0075363_1000348672 222
276 3300006051 Ga0075364_10007343 Ga0075364_100073434 222
277 3300006051 Ga0075364_10020703 Ga0075364_100207035 222
278 3300006173 Ga0070716_100065185 Ga0070716_1000651853 222
279 3300006173 Ga0070716_100067625 Ga0070716_1000676252 222
280 3300006175 Ga0070712_100000740 Ga0070712_1000007402 222
281 3300006177 Ga0075362_10084785 Ga0075362_100847852 222
282 3300006178 Ga0075367_10038180 Ga0075367_100381803 222
283 3300006186 Ga0075369_10001351 Ga0075369_100013518 222
284 3300006186 Ga0075369_10007786 Ga0075369_100077863 222
285 3300006844 Ga0075428_100027103 Ga0075428_1000271034 222
286 3300006846 Ga0075430_100015601 Ga0075430_1000156015 222
287 3300006881 Ga0068865_100000636 Ga0068865_1000006367 222
288 3300006881 Ga0068865_100062179 Ga0068865_1000621792 222
289 3300006931 Ga0097620_100000266 Ga0097620_10000026612 222
290 3300006931 Ga0097620_100003756 Ga0097620_10000375612 222
291 3300006931 Ga0097620_100299826 Ga0097620_1002998262 222
292 3300006931 Ga0097620_100934671 Ga0097620_1009346712 222
293 3300007788 Ga0099795_10013775 Ga0099795_100137753 222
294 3300009092 Ga0105250_10058140 Ga0105250_100581403 222
295 3300009098 Ga0105245_10002991 Ga0105245_1000299112 222
296 3300009101 Ga0105247_10000006 Ga0105247_10000006343 222
297 3300009101 Ga0105247_10001045 Ga0105247_100010458 222
298 3300009147 Ga0114129_10307137 Ga0114129_103071373 222
299 3300009148 Ga0105243_10005027 Ga0105243_100050278 222
300 3300009148 Ga0105243_10491108 Ga0105243_104911081 222
301 3300009174 Ga0105241_10106697 Ga0105241_101066972 222
302 3300009176 Ga0105242_10000519 Ga0105242_1000051927 222
303 3300009176 Ga0105242_10185992 Ga0105242_101859922 222
304 3300009177 Ga0105248_10000042 Ga0105248_1000004225 222
305 3300009177 Ga0105248_10050610 Ga0105248_100506105 222
306 3300009545 Ga0105237_10006199 Ga0105237_100061993 222
307 3300009551 Ga0105238_10283684 Ga0105238_102836842 222
308 3300009553 Ga0105249_10001581 Ga0105249_1000158112 222
309 3300009553 Ga0105249_10058644 Ga0105249_100586442 222
310 3300010375 Ga0105239_10007894 Ga0105239_100078943 222
311 3300010375 Ga0105239_10027691 Ga0105239_100276913 222
312 3300010375 Ga0105239_10291871 Ga0105239_102918712 222
313 3300010375 Ga0105239_10662571 Ga0105239_106625712 222
314 3300011119 Ga0105246_10135438 Ga0105246_101354382 222
315 3300013105 Ga0157369_10781335 Ga0157369_107813352 222
316 3300013296 Ga0157374_10074079 Ga0157374_100740793 222
317 3300013297 Ga0157378_10000520 Ga0157378_100005209 222
318 3300013306 Ga0163162_10003026 Ga0163162_1000302613 222
319 3300013306 Ga0163162_10158693 Ga0163162_101586932 222
320 3300013306 Ga0163162_10443867 Ga0163162_104438672 222
321 3300013307 Ga0157372_10259875 Ga0157372_102598753 222
322 3300013307 Ga0157372_10352923 Ga0157372_103529233 222
323 3300013308 Ga0157375_10032558 Ga0157375_100325585 222
324 3300013308 Ga0157375_10777933 Ga0157375_107779331 222
325 3300014326 Ga0157380_10004917 Ga0157380_100049175 222
326 3300014326 Ga0157380_10079237 Ga0157380_100792373 222
327 3300014745 Ga0157377_10090171 Ga0157377_100901713 222
328 3300014745 Ga0157377_10341808 Ga0157377_103418082 222
329 3300014968 Ga0157379_10021398 Ga0157379_100213983 222
330 3300014968 Ga0157379_10186047 Ga0157379_101860471 222
331 3300017792 Ga0163161_10001627 Ga0163161_1000162712 222
332 3300021384 Ga0213876_10002797 Ga0213876_100027974 222
333 3300021384 Ga0213876_10028934 Ga0213876_100289343 222
334 3300021388 Ga0213875_10060299 Ga0213875_100602993 222
335 3300025885 Ga0207653_10048875 Ga0207653_100488752 222
336 3300025898 Ga0207692_10001182 Ga0207692_100011827 222
337 3300025899 Ga0207642_10000951 Ga0207642_100009514 222
338 3300025900 Ga0207710_10000114 Ga0207710_1000011445 222
339 3300025900 Ga0207710_10001573 Ga0207710_1000157310 222
340 3300025901 Ga0207688_10001040 Ga0207688_100010408 222
341 3300025901 Ga0207688_10010590 Ga0207688_100105905 222
342 3300025903 Ga0207680_10150039 Ga0207680_101500392 222
343 3300025905 Ga0207685_10028693 Ga0207685_100286933 222
344 3300025905 Ga0207685_10058431 Ga0207685_100584312 222
345 3300025906 Ga0207699_10020317 Ga0207699_100203172 222
346 3300025906 Ga0207699_10165906 Ga0207699_101659062 222
347 3300025911 Ga0207654_10069628 Ga0207654_100696282 222
348 3300025914 Ga0207671_10015128 Ga0207671_100151283 222
349 3300025915 Ga0207693_10000824 Ga0207693_1000082422 222
350 3300025915 Ga0207693_10001335 Ga0207693_100013353 222
351 3300025917 Ga0207660_10142009 Ga0207660_101420092 222
352 3300025918 Ga0207662_10048834 Ga0207662_100488341 222
353 3300025923 Ga0207681_10035901 Ga0207681_100359014 222
354 3300025923 Ga0207681_10043595 Ga0207681_100435952 222
355 3300025923 Ga0207681_10228413 Ga0207681_102284132 222
356 3300025926 Ga0207659_10134919 Ga0207659_101349191 222
357 3300025927 Ga0207687_10000930 Ga0207687_100009304 222
358 3300025928 Ga0207700_10087607 Ga0207700_100876073 222
359 3300025929 Ga0207664_10013799 Ga0207664_100137996 222
360 3300025929 Ga0207664_10300943 Ga0207664_103009431 222
361 3300025933 Ga0207706_10009285 Ga0207706_100092853 222
362 3300025934 Ga0207686_10013857 Ga0207686_100138572 222
363 3300025935 Ga0207709_10021683 Ga0207709_100216832 222
364 3300025937 Ga0207669_10001053 Ga0207669_100010537 222
365 3300025938 Ga0207704_10003583 Ga0207704_100035835 222
366 3300025938 Ga0207704_10160827 Ga0207704_101608271 222
367 3300025939 Ga0207665_10055546 Ga0207665_100555462 222
368 3300025939 Ga0207665_10104122 Ga0207665_101041222 222
369 3300025941 Ga0207711_10001104 Ga0207711_1000110420 222
370 3300025941 Ga0207711_10054934 Ga0207711_100549343 222
371 3300025941 Ga0207711_10231144 Ga0207711_102311442 222
372 3300025942 Ga0207689_10184414 Ga0207689_101844142 222
373 3300025960 Ga0207651_10051503 Ga0207651_100515033 222
374 3300025961 Ga0207712_10007605 Ga0207712_100076054 222
375 3300025972 Ga0207668_10001690 Ga0207668_1000169010 222
376 3300025972 Ga0207668_10018913 Ga0207668_100189132 222
377 3300025972 Ga0207668_10221342 Ga0207668_102213422 222
378 3300025981 Ga0207640_10000683 Ga0207640_100006837 222
379 3300025986 Ga0207658_10000071 Ga0207658_1000007174 222
380 3300025986 Ga0207658_10038749 Ga0207658_100387493 222
381 3300025986 Ga0207658_10095768 Ga0207658_100957682 222
382 3300025986 Ga0207658_10172675 Ga0207658_101726752 222
383 3300026023 Ga0207677_10010166 Ga0207677_100101662 222
384 3300026023 Ga0207677_10010980 Ga0207677_100109802 222
385 3300026035 Ga0207703_10009490 Ga0207703_100094905 222
386 3300026035 Ga0207703_10164389 Ga0207703_101643892 222
387 3300026041 Ga0207639_10016262 Ga0207639_100162624 222
388 3300026067 Ga0207678_10016989 Ga0207678_100169896 222
389 3300026067 Ga0207678_10069888 Ga0207678_100698883 222
390 3300026088 Ga0207641_10000683 Ga0207641_1000068318 222
391 3300026088 Ga0207641_10032587 Ga0207641_100325871 222
392 3300026089 Ga0207648_10002188 Ga0207648_100021888 222
393 3300026089 Ga0207648_10057145 Ga0207648_100571452 222
394 3300026118 Ga0207675_100002449 Ga0207675_1000024494 222
395 3300026118 Ga0207675_100202051 Ga0207675_1002020513 222
396 3300026118 Ga0207675_100305967 Ga0207675_1003059672 222
397 3300026121 Ga0207683_10000334 Ga0207683_1000033426 222
398 3300026121 Ga0207683_10006092 Ga0207683_100060927 222
399 3300026142 Ga0207698_10073630 Ga0207698_100736303 222
400 3300027866 Ga0209813_10039953 Ga0209813_100399532 222
401 3300028379 Ga0268266_10005347 Ga0268266_100053475 222
402 3300028379 Ga0268266_10123316 Ga0268266_101233163 222
403 3300028379 Ga0268266_10142401 Ga0268266_101424012 222
404 3300028380 Ga0268265_10000007 Ga0268265_10000007392 222
405 3300028380 Ga0268265_10064413 Ga0268265_100644132 222
406 3300028380 Ga0268265_10224421 Ga0268265_102244212 222
407 3300028381 Ga0268264_10000007 Ga0268264_10000007518 222
408 3300028381 Ga0268264_10001178 Ga0268264_100011788 222
409 3300031728 Ga0316578_10132510 Ga0316578_101325102 222
410 3300031731 Ga0307405_10595044 Ga0307405_105950441 222
411 3300031824 Ga0307413_10284920 Ga0307413_102849202 222
412 3300031852 Ga0307410_10448948 Ga0307410_104489482 222
413 3300031901 Ga0307406_10069108 Ga0307406_100691082 222
414 3300031903 Ga0307407_10142020 Ga0307407_101420201 222
415 3300032002 Ga0307416_100110615 Ga0307416_1001106152 222
416 3300035114 Ga0373939_0009318 Ga0373939_0009318_1414_2166 222
417 3300035115 Ga0373941_0035541 Ga0373941_0035541_653_1405 222
418 3300037853 Ga0436364_1017555 Ga0436364_1017555_683_1441 222
419 3300037853 Ga0436364_1084651 Ga0436364_1084651_37_789 222
420 3300037853 Ga0436364_1113040 Ga0436364_1113040_4162_4914 222
421 3300039437 Ga0436365_0102884 Ga0436365_0102884_2355_3107 222
422 3300039437 Ga0436365_0228461 Ga0436365_0228461_60_812 222
423 3300039437 Ga0436365_0946893 Ga0436365_0946893_1956_2708 222
424 3300039437 Ga0436365_1523773 Ga0436365_1523773_4722_5474 222
425 3300039437 Ga0436365_1896722 Ga0436365_1896722_18595_19353 222
426 3300039447 Ga0436361_0632395 Ga0436361_0632395_869_1621 222
427 3300041410 Ga0439461_0001190 Ga0439461_0001190_3146_3898 222
428 3300041410 Ga0439461_0002173 Ga0439461_0002173_218_970 222
429 3300041411 Ga0439466_0005423 Ga0439466_0005423_2839_3591 222
430 3300041411 Ga0439466_0008420 Ga0439466_0008420_1721_2473 222
431 3300041413 Ga0439465_0007778 Ga0439465_0007778_778_1530 222
432 3300041413 Ga0439465_0015277 Ga0439465_0015277_680_1432 222
433 3300041413 Ga0439465_0037638 Ga0439465_0037638_621_1373 222
434 3300042004 Ga0439445_0017793 Ga0439445_0017793_615_1367 222
435 3300042008 Ga0439450_044248 Ga0439450_044248_113_865 222
436 3300042435 Ga0439434_0005156 Ga0439434_0005156_2668_3420 222
437 3300044656 Ga0466969_0090257 Ga0466969_0090257_201_953 222
438 3300044658 Ga0466972_0054957 Ga0466972_0054957_504_1256 222
439 3300044658 Ga0466972_0108910 Ga0466972_0108910_495_1247 222
440 3300044684 Ga0466966_0033937 Ga0466966_0033937_2264_3016 222
441 3300044684 Ga0466966_0149681 Ga0466966_0149681_521_1273 222
442 3300044693 Ga0466961_0012946 Ga0466961_0012946_2508_3260 222
443 3300044693 Ga0466961_0077457 Ga0466961_0077457_207_959 222
444 3300044694 Ga0466963_0066379 Ga0466963_0066379_1073_1825 222
445 3300044694 Ga0466963_0310658 Ga0466963_0310658_97_849 222
446 3300044694 Ga0466963_0424127 Ga0466963_0424127_116_868 222
447 3300044735 Ga0466968_0001580 Ga0466968_0001580_5410_6162 222
448 3300044735 Ga0466968_0031542 Ga0466968_0031542_562_1314 222
449 3300044735 Ga0466968_0108731 Ga0466968_0108731_482_1234 222
450 3300044765 Ga0466970_0003660 Ga0466970_0003660_3966_4718 222
451 3300044765 Ga0466970_0034688 Ga0466970_0034688_287_1039 222
452 3300044765 Ga0466970_0100052 Ga0466970_0100052_560_1312 222
453 3300044842 Ga0466957_0008660 Ga0466957_0008660_3524_4276 222
454 3300044842 Ga0466957_0026769 Ga0466957_0026769_2247_2999 222
455 3300044901 Ga0466960_0000383 Ga0466960_0000383_5117_5869 222
456 3300044901 Ga0466960_0023065 Ga0466960_0023065_1371_2123 222
457 3300045049 Ga0466959_0017401 Ga0466959_0017401_2352_3104 222
458 3300045049 Ga0466959_0077623 Ga0466959_0077623_1634_2386 222
459 3300045836 Ga0466958_0018314 Ga0466958_0018314_2803_3555 222
460 3300045836 Ga0466958_0023206 Ga0466958_0023206_2753_3505 222
461 3300045836 Ga0466958_0196659 Ga0466958_0196659_63_815 222
462 3300045976 Ga0466967_0006607 Ga0466967_0006607_2873_3625 222
463 3300045976 Ga0466967_0009929 Ga0466967_0009929_1858_2610 222
464 3300045976 Ga0466967_0051125 Ga0466967_0051125_1014_1766 222
465 3300045976 Ga0466967_0114982 Ga0466967_0114982_429_1181 222
466 3300045976 Ga0466967_0308589 Ga0466967_0308589_224_976 222
467 3300047320 Ga0495672_0020720 Ga0495672_0020720_1085_1837 222
468 3300047320 Ga0495672_0127401 Ga0495672_0127401_205_960 222
469 3300048903 Ga0496100_0001835 Ga0496100_0001835_8880_9635 222
470 3300048903 Ga0496100_0002126 Ga0496100_0002126_2028_2780 222
471 3300048903 Ga0496100_0004656 Ga0496100_0004656_1212_1967 222
472 3300048904 Ga0496101_0000056 Ga0496101_0000056_111789_112544 222
473 3300048904 Ga0496101_0002105 Ga0496101_0002105_2288_3040 222
474 3300048904 Ga0496101_0109256 Ga0496101_0109256_601_1353 222
475 3300048905 Ga0496102_0000025 Ga0496102_0000025_23045_23800 222
476 3300048905 Ga0496102_0000277 Ga0496102_0000277_62789_63544 222
477 3300048905 Ga0496102_0025405 Ga0496102_0025405_2894_3646 222
478 3300048905 Ga0496102_0055689 Ga0496102_0055689_1871_2623 222
479 3300048905 Ga0496102_0074504 Ga0496102_0074504_2057_2809 222
480 3300048905 Ga0496102_0261764 Ga0496102_0261764_16_783 222
481 3300048906 Ga0496103_0000022 Ga0496103_0000022_23045_23800 222
482 3300048906 Ga0496103_0000889 Ga0496103_0000889_9479_10231 222
483 3300048906 Ga0496103_0001027 Ga0496103_0001027_3668_4423 222
484 3300048907 Ga0496104_0028890 Ga0496104_0028890_374_1126 222
485 3300048909 Ga0496106_0003076 Ga0496106_0003076_7571_8323 222
486 3300048909 Ga0496106_0025382 Ga0496106_0025382_2894_3649 222
487 3300048909 Ga0496106_0124759 Ga0496106_0124759_251_1006 222
488 3300048910 Ga0496107_0000533 Ga0496107_0000533_2041_2793 222
489 3300048910 Ga0496107_0097545 Ga0496107_0097545_592_1347 222
490 3300048911 Ga0496108_0000506 Ga0496108_0000506_15709_16461 222
491 3300048911 Ga0496108_0054460 Ga0496108_0054460_553_1305 222
492 3300048911 Ga0496108_0065033 Ga0496108_0065033_1468_2232 222
493 3300048912 Ga0496109_0012748 Ga0496109_0012748_4403_5155 222
494 3300048912 Ga0496109_0136606 Ga0496109_0136606_1374_2138 222
495 3300048915 Ga0496112_0079282 Ga0496112_0079282_2324_3076 222
496 3300048915 Ga0496112_0131882 Ga0496112_0131882_930_1682 222
497 3300048916 Ga0496113_0145433 Ga0496113_0145433_323_1075 222
498 3300048917 Ga0496114_0000285 Ga0496114_0000285_25074_25826 222
499 3300048918 Ga0496115_0003493 Ga0496115_0003493_7380_8132 222
500 3300048919 Ga0496116_0000059 Ga0496116_0000059_250692_251447 222
501 3300048920 Ga0496117_0000055 Ga0496117_0000055_23045_23800 222
502 3300048920 Ga0496117_0000595 Ga0496117_0000595_16232_16987 222
503 3300048921 Ga0496118_0000058 Ga0496118_0000058_23045_23800 222
504 3300048921 Ga0496118_0000225 Ga0496118_0000225_73209_73964 222
505 3300048921 Ga0496118_0001085 Ga0496118_0001085_8687_9439 222
506 3300048922 Ga0496119_0000668 Ga0496119_0000668_22285_23040 222
507 3300048922 Ga0496119_0001939 Ga0496119_0001939_18809_19564 222
508 3300048923 Ga0496120_0002577 Ga0496120_0002577_16554_17309 222
509 3300048923 Ga0496120_0005668 Ga0496120_0005668_8274_9029 222
510 3300048924 Ga0496121_0000060 Ga0496121_0000060_252891_253646 222
511 3300048924 Ga0496121_0004107 Ga0496121_0004107_17600_18355 222
512 3300048927 Ga0496124_0181963 Ga0496124_0181963_274_1029 222
513 3300048928 Ga0496125_0010201 Ga0496125_0010201_5886_6641 222
514 3300048929 Ga0496126_0002848 Ga0496126_0002848_4283_5038 222
515 3300048929 Ga0496126_0004145 Ga0496126_0004145_3601_4356 222
516 3300048929 Ga0496126_0005848 Ga0496126_0005848_4531_5283 222
517 3300049569 Ga0501032_0005219 Ga0501032_0005219_2424_3176 222
518 3300049569 Ga0501032_0005560 Ga0501032_0005560_3140_3892 222
519 3300049571 Ga0501034_0011280 Ga0501034_0011280_396_1148 222
520 3300049571 Ga0501034_0059361 Ga0501034_0059361_2816_3568 222
521 3300049572 Ga0501036_0069564 Ga0501036_0069564_210_962 222
522 3300049572 Ga0501036_0262255 Ga0501036_0262255_258_1010 222
523 3300049573 Ga0501037_0002804 Ga0501037_0002804_1826_2578 222
524 3300049573 Ga0501037_0181917 Ga0501037_0181917_464_1216 222
525 3300049574 Ga0501038_0020859 Ga0501038_0020859_1826_2578 222
526 3300049574 Ga0501038_0254500 Ga0501038_0254500_33_785 222
527 3300049575 Ga0501039_0009179 Ga0501039_0009179_404_1156 222
528 3300049579 Ga0501043_0005442 Ga0501043_0005442_2828_3580 222
529 3300049579 Ga0501043_0048036 Ga0501043_0048036_2192_2944 222
530 3300049580 Ga0501046_0002482 Ga0501046_0002482_12795_13547 222
531 3300049581 Ga0501047_0001295 Ga0501047_0001295_14823_15575 222
532 3300049581 Ga0501047_0022572 Ga0501047_0022572_574_1326 222
533 3300049582 Ga0501048_0201561 Ga0501048_0201561_74_826 222
534 3300049583 Ga0501067_0083130 Ga0501067_0083130_483_1235 222
535 3300049585 Ga0501069_0025714 Ga0501069_0025714_1517_2269 222
536 3300049585 Ga0501069_0036823 Ga0501069_0036823_572_1324 222
537 3300049586 Ga0501070_0003668 Ga0501070_0003668_2864_3616 222
538 3300049586 Ga0501070_0013767 Ga0501070_0013767_1878_2630 222
539 3300049589 Ga0501073_0041284 Ga0501073_0041284_2205_2957 222
540 3300049742 Ga0501080_0393753 Ga0501080_0393753_55_807 222
541 3300049822 Ga0501035_0002649 Ga0501035_0002649_11441_12193 222
542 3300049823 Ga0501044_0092585 Ga0501044_0092585_44_796 222
543 3300049823 Ga0501044_0100874 Ga0501044_0100874_396_1148 222
544 3300050490 nmdc:mga03n38_3860_c1 nmdc:mga03n38_3860_c1_3755_4507 222
545 3300050491 nmdc:mga00v17_4183_c1 nmdc:mga00v17_4183_c1_3422_4174 222
546 3300050491 nmdc:mga00v17_42743_c1 nmdc:mga00v17_42743_c1_741_1493 222
547 3300050491 nmdc:mga00v17_5595_c1 nmdc:mga00v17_5595_c1_3246_3998 222
548 3300050492 nmdc:mga0yw44_47839_c1 nmdc:mga0yw44_47839_c1_115_867 222
549 3300050492 nmdc:mga0yw44_4903_c1 nmdc:mga0yw44_4903_c1_5023_5775 222
550 3300050492 nmdc:mga0yw44_61730_c1 nmdc:mga0yw44_61730_c1_1467_2222 222
551 3300050494 nmdc:mga06z11_118011_c1 nmdc:mga06z11_118011_c1_599_1351 222
552 3300050495 nmdc:mga04h51_47729_c1 nmdc:mga04h51_47729_c1_581_1333 222
553 3300050507 nmdc:mga05p37_199722_c1 nmdc:mga05p37_199722_c1_1619_2371 222
554 3300050509 nmdc:mga0qj67_207397_c1 nmdc:mga0qj67_207397_c1_72_824 222
555 3300050510 nmdc:mga06r32_868166_c1 nmdc:mga06r32_868166_c1_74_826 222
556 3300050516 nmdc:mga0sz30_23301_c1 nmdc:mga0sz30_23301_c1_1439_2191 222
557 3300050516 nmdc:mga0sz30_832_c1 nmdc:mga0sz30_832_c1_3634_4386 222
558 3300053079 Ga0500610_0050382 Ga0500610_0050382_1116_1871 222
559 3300053153 Ga0500616_0008631 Ga0500616_0008631_2434_3189 222
560 3300061719 Ga0466962_0022429 Ga0466962_0022429_601_1353 222
561 iso_pu_bacteria 2929212328 2929216322 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13829

DUF4191

Domain of unknown function (DUF4191)

22

243

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xmv-assembly1.cif.gz_A the crystal structure of neisseria gonorrhoeae dolp (ngo1985) 0.6947 109 158
4m1a-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1904) from sebaldella termitidis atcc 33386 0.6483 118 158
4jcv-assembly1.cif.gz_F crystal structure of the recor complex in an open conformation 0.6068 94 128
4jcv-assembly1.cif.gz_E crystal structure of the recor complex in an open conformation 0.5808 92 128
6wuq-assembly1.cif.gz_A crystal structure of ajia1 in apo form 0.573 94 153
ID Description Score Start End Superfamily
af_Q8IJA4_325_412_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6781 94 126 2.40.50.140
af_A0A0G2LA86_2_218_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.6765 94 122 3.60.10.10
af_Q8III5_2_235_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.6719 93 125 3.30.830.10
4cehA06 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.6622 110 153 3.90.320.10
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6184 95 128 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2S9FTN5-F1-model_v4 DUF4191 domain-containing protein 1.001 108 195
AF-A0A2S9FTN5-F1-model_v4 DUF4191 domain-containing protein 0.9786 108 195
AF-A0A2S8MSL2-F1-model_v4 deleted 0.967 60 175
AF-A0A2S8MSL2-F1-model_v4 deleted 0.9509 60 175
AF-A0A348NU89-F1-model_v4 DUF4191 domain-containing protein 0.8694 47 182 GO:0016020

Feature Viewer

pLDDT pTM Quality
72.6 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map