F463736

General Info

Members Datasets Scaffolds Average Seq Length
560 270 560 157

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0000241|Ga0495630_0000241_27045_27677
Length 189
Sequence MAEETSLPAPLPPGAPALGPAPTGSVSVTAWSPGDDVVEVQRTPAPGPARSTWRTFRETARGLATTFGRMLEKPVTVEYPEEKTPVYPRFRGRHKLHRFENSDPTHPGLEKCVGCSLCAAACPADCIRVVAAENTPEQRVSAGERYAAVYEIMGHDYELSDYDRTDLIFTKEMLLAEPLERTPLRNEDE

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
67 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 8.39
Rhizosphere 84.46
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1009382 3300000546 Bacteria 1048
2 JGI25406J46586_10050918 3300003203 Bacteria 1389
3 JGI25407J50210_10002589 3300003373 Bacteria 4280
4 JGI25407J50210_10011634 3300003373 Bacteria 2250
5 JGI25407J50210_10067213 3300003373 Bacteria 896
6 JGI25407J50210_10070703 3300003373 Bacteria 871
7 Ga0070676_10312666 3300005328 Bacteria 1069
8 Ga0070683_100041692 3300005329 Bacteria 4225
9 Ga0070683_100075365 3300005329 Bacteria 3152
10 Ga0070683_100112293 3300005329 Bacteria 2572
11 Ga0070683_100144435 3300005329 Bacteria 2254
12 Ga0070683_100433275 3300005329 Bacteria 1254
13 Ga0070682_100234109 3300005337 Bacteria 1315
14 Ga0070682_100529067 3300005337 Bacteria 919
15 Ga0070660_100018264 3300005339 Bacteria 5122
16 Ga0070689_100962815 3300005340 Bacteria 758
17 Ga0070691_10372040 3300005341 Bacteria 799
18 Ga0070691_10525566 3300005341 Bacteria 688
19 Ga0070661_100425852 3300005344 Bacteria 1053
20 Ga0070668_100518838 3300005347 Bacteria 1034
21 Ga0070668_100544280 3300005347 Bacteria 1010
22 Ga0070675_100523814 3300005354 Bacteria 1070
23 Ga0070675_101091688 3300005354 Bacteria 734
24 Ga0070674_100045886 3300005356 Bacteria 2987
25 Ga0070674_101015221 3300005356 Bacteria 728
26 Ga0070659_100000176 3300005366 Bacteria 49062
27 Ga0070659_101053137 3300005366 Bacteria 716
28 Ga0070709_10209244 3300005434 Bacteria 1386
29 Ga0070714_100024259 3300005435 Bacteria 4990
30 Ga0070714_100203877 3300005435 Bacteria 1810
31 Ga0070714_100645410 3300005435 Bacteria 1019
32 Ga0070713_100182205 3300005436 Bacteria 1888
33 Ga0070710_10000013 3300005437 Bacteria 117825
34 Ga0070710_10114124 3300005437 Bacteria 1627
35 Ga0070710_10172111 3300005437 Bacteria 1350
36 Ga0070701_10279670 3300005438 Bacteria 1018
37 Ga0070705_100002829 3300005440 Bacteria 8643
38 Ga0070700_100383801 3300005441 Bacteria 1051
39 Ga0070663_100133658 3300005455 Bacteria 1887
40 Ga0070663_100242395 3300005455 Bacteria 1424
41 Ga0070663_100462463 3300005455 Bacteria 1048
42 Ga0070681_10747239 3300005458 Bacteria 895
43 Ga0070707_100483521 3300005468 Bacteria 1200
44 Ga0070679_100194392 3300005530 Bacteria 1997
45 Ga0070684_100231184 3300005535 Bacteria 1688
46 Ga0070684_100371567 3300005535 Bacteria 1316
47 Ga0070684_100374262 3300005535 Bacteria 1311
48 Ga0070684_100478395 3300005535 Bacteria 1152
49 Ga0068853_100007277 3300005539 Bacteria 8861
50 Ga0068853_100460679 3300005539 Bacteria 1197
51 Ga0070672_100000003 3300005543 Bacteria 159532
52 Ga0070672_100144097 3300005543 Bacteria 1967
53 Ga0070672_100272877 3300005543 Bacteria 1428
54 Ga0070686_101401166 3300005544 Bacteria 586
55 Ga0070665_100354044 3300005548 Bacteria 1474
56 Ga0070664_100348438 3300005564 Bacteria 1347
57 Ga0068854_100228203 3300005578 Bacteria 1477
58 Ga0068856_100063649 3300005614 Bacteria 3644
59 Ga0068856_100070161 3300005614 Bacteria 3466
60 Ga0068856_100070194 3300005614 Bacteria 3465
61 Ga0068856_100109916 3300005614 Bacteria 2753
62 Ga0068856_100215026 3300005614 Bacteria 1938
63 Ga0068852_100284457 3300005616 Bacteria 1595
64 Ga0068852_101592765 3300005616 Bacteria 675
65 Ga0068859_102032232 3300005617 Bacteria 635
66 Ga0068861_100306020 3300005719 Bacteria 1379
67 Ga0068861_101009679 3300005719 Bacteria 795
68 Ga0068870_10237015 3300005840 Bacteria 1124
69 Ga0068858_100000965 3300005842 Bacteria 29800
70 Ga0068862_100466465 3300005844 Bacteria 1193
71 Ga0081538_10000071 3300005981 Bacteria 96238
72 Ga0081538_10000179 3300005981 Bacteria 69107
73 Ga0081538_10000407 3300005981 Bacteria 48780
74 Ga0081538_10010091 3300005981 Bacteria 7776
75 Ga0081538_10013513 3300005981 Bacteria 6457
76 Ga0081538_10017788 3300005981 Bacteria 5374
77 Ga0081538_10018253 3300005981 Bacteria 5281
78 Ga0081538_10027796 3300005981 Bacteria 3909
79 Ga0081538_10027952 3300005981 Bacteria 3893
80 Ga0081538_10040647 3300005981 Bacteria 2963
81 Ga0081540_1000011 3300005983 Bacteria 191880
82 Ga0081539_10001489 3300005985 Bacteria 39599
83 Ga0081539_10095731 3300005985 Bacteria 1525
84 Ga0070717_10000061 3300006028 Bacteria 92257
85 Ga0070717_10003687 3300006028 Bacteria 11001
86 Ga0070717_10012078 3300006028 Bacteria 6580
87 Ga0075365_10058992 3300006038 Bacteria 2556
88 Ga0075363_100017229 3300006048 Bacteria 3579
89 Ga0075364_10065165 3300006051 Bacteria 2391
90 Ga0075364_10211054 3300006051 Bacteria 1317
91 Ga0070712_100000013 3300006175 Bacteria 109912
92 Ga0070712_100004498 3300006175 Bacteria 8608
93 Ga0070712_100019152 3300006175 Bacteria 4458
94 Ga0075367_10348364 3300006178 Bacteria 935
95 Ga0097621_100653754 3300006237 Bacteria 965
96 Ga0075428_100053301 3300006844 Bacteria 4431
97 Ga0075428_100069723 3300006844 Bacteria 3843
98 Ga0075430_100038180 3300006846 Bacteria 4069
99 Ga0075430_100042654 3300006846 Bacteria 3836
100 Ga0075430_100612229 3300006846 Bacteria 899
101 Ga0075433_10535846 3300006852 Bacteria 1030
102 Ga0075434_100123067 3300006871 Bacteria 2610
103 Ga0097620_102032250 3300006931 Bacteria 635
104 Ga0105251_10262849 3300009011 Bacteria 779
105 Ga0111539_10042751 3300009094 Bacteria 5438
106 Ga0111539_10528400 3300009094 Bacteria 1374
107 Ga0111539_10595763 3300009094 Bacteria 1287
108 Ga0111539_11029677 3300009094 Bacteria 957
109 Ga0105245_10000291 3300009098 Bacteria 47913
110 Ga0105245_10347948 3300009098 Bacteria 1467
111 Ga0105245_11004423 3300009098 Bacteria 879
112 Ga0105245_11456427 3300009098 Bacteria 735
113 Ga0105247_10306691 3300009101 Bacteria 1103
114 Ga0114129_10002397 3300009147 Bacteria 26039
115 Ga0114129_10012546 3300009147 Bacteria 12066
116 Ga0114129_10828735 3300009147 Bacteria 1178
117 Ga0114129_11012077 3300009147 Bacteria 1046
118 Ga0114129_11340976 3300009147 Bacteria 885
119 Ga0105243_10251034 3300009148 Bacteria 1579
120 Ga0105242_10440243 3300009176 Bacteria 1226
121 Ga0105248_10535320 3300009177 Bacteria 1321
122 Ga0105248_11905556 3300009177 Bacteria 675
123 Ga0105237_10000431 3300009545 Bacteria 59607
124 Ga0105249_10242192 3300009553 Bacteria 1784
125 Ga0105246_10246885 3300011119 Bacteria 1414
126 Ga0105246_10319824 3300011119 Bacteria 1260
127 Ga0157343_1009045 3300012488 Bacteria 729
128 Ga0157315_1033463 3300012508 Bacteria 616
129 Ga0163163_10301675 3300014325 Bacteria 1654
130 Ga0163163_11910526 3300014325 Bacteria 654
131 Ga0157376_10020056 3300014969 Bacteria 5164
132 Ga0213873_10009790 3300021358 Bacteria 2001
133 Ga0213873_10010189 3300021358 Bacteria 1976
134 Ga0213876_10011470 3300021384 Bacteria 4732
135 Ga0213876_10017207 3300021384 Bacteria 3816
136 Ga0213876_10085322 3300021384 Bacteria 1671
137 Ga0213876_10322653 3300021384 Bacteria 821
138 Ga0213875_10000272 3300021388 Bacteria 51129
139 Ga0213875_10007061 3300021388 Bacteria 5838
140 Ga0213875_10019586 3300021388 Bacteria 3256
141 Ga0207426_1040113 3300025302 Bacteria 1461
142 Ga0207692_10000003 3300025898 Bacteria 431531
143 Ga0207692_10034024 3300025898 Bacteria 2464
144 Ga0207688_10058047 3300025901 Bacteria 2177
145 Ga0207688_10324221 3300025901 Bacteria 945
146 Ga0207699_10120397 3300025906 Bacteria 1697
147 Ga0207699_10180438 3300025906 Bacteria 1419
148 Ga0207645_10079582 3300025907 Bacteria 2100
149 Ga0207645_10136002 3300025907 Bacteria 1600
150 Ga0207645_10160625 3300025907 Bacteria 1470
151 Ga0207643_10086508 3300025908 Bacteria 1822
152 Ga0207643_10102101 3300025908 Bacteria 1682
153 Ga0207707_10492752 3300025912 Bacteria 1046
154 Ga0207707_10645192 3300025912 Bacteria 893
155 Ga0207671_10008739 3300025914 Bacteria 8536
156 Ga0207693_10000046 3300025915 Bacteria 100888
157 Ga0207693_10005251 3300025915 Bacteria 10836
158 Ga0207693_10053272 3300025915 Bacteria 3175
159 Ga0207693_10164820 3300025915 Bacteria 1744
160 Ga0207663_10341796 3300025916 Bacteria 1130
161 Ga0207657_10027772 3300025919 Bacteria 5176
162 Ga0207646_10387798 3300025922 Bacteria 1262
163 Ga0207687_10000058 3300025927 Bacteria 85860
164 Ga0207687_10081140 3300025927 Bacteria 2343
165 Ga0207687_10092662 3300025927 Bacteria 2207
166 Ga0207700_10063598 3300025928 Bacteria 2807
167 Ga0207664_10000142 3300025929 Bacteria 59306
168 Ga0207664_10002161 3300025929 Bacteria 12930
169 Ga0207664_10353808 3300025929 Bacteria 1300
170 Ga0207664_10416066 3300025929 Bacteria 1197
171 Ga0207664_10916239 3300025929 Bacteria 787
172 Ga0207644_10883955 3300025931 Bacteria 749
173 Ga0207690_10000054 3300025932 Bacteria 104097
174 Ga0207690_10118360 3300025932 Bacteria 1920
175 Ga0207706_10405994 3300025933 Bacteria 1181
176 Ga0207686_10302231 3300025934 Bacteria 1189
177 Ga0207709_10278172 3300025935 Bacteria 1235
178 Ga0207709_10650089 3300025935 Bacteria 839
179 Ga0207669_10072835 3300025937 Bacteria 2165
180 Ga0207669_10147377 3300025937 Bacteria 1643
181 Ga0207669_10610087 3300025937 Bacteria 888
182 Ga0207704_10634690 3300025938 Bacteria 878
183 Ga0207665_10037087 3300025939 Bacteria 3243
184 Ga0207665_10119163 3300025939 Bacteria 1863
185 Ga0207691_10000005 3300025940 Bacteria 163117
186 Ga0207691_10133625 3300025940 Bacteria 2190
187 Ga0207689_10058764 3300025942 Bacteria 3163
188 Ga0207661_10000333 3300025944 Bacteria 30072
189 Ga0207679_10227102 3300025945 Bacteria 1574
190 Ga0207667_10591581 3300025949 Bacteria 1119
191 Ga0207712_10863865 3300025961 Bacteria 798
192 Ga0207668_10417654 3300025972 Bacteria 1138
193 Ga0207640_11105562 3300025981 Bacteria 701
194 Ga0207703_10000028 3300026035 Bacteria 208682
195 Ga0207639_10673369 3300026041 Bacteria 958
196 Ga0207639_11312360 3300026041 Bacteria 679
197 Ga0207678_10273032 3300026067 Bacteria 1450
198 Ga0207678_10491017 3300026067 Bacteria 1070
199 Ga0207708_10070044 3300026075 Bacteria 2686
200 Ga0207702_10011624 3300026078 Bacteria 7335
201 Ga0207702_10012421 3300026078 Bacteria 7091
202 Ga0207702_10015114 3300026078 Bacteria 6400
203 Ga0207648_10468917 3300026089 Bacteria 1149
204 Ga0207674_10274332 3300026116 Bacteria 1634
205 Ga0207675_100530624 3300026118 Bacteria 1174
206 Ga0207675_100913857 3300026118 Bacteria 894
207 Ga0207683_11565745 3300026121 Bacteria 608
208 Ga0207698_10774021 3300026142 Bacteria 960
209 Ga0207698_10892693 3300026142 Bacteria 896
210 Ga0207698_11065918 3300026142 Bacteria 820
211 Ga0207698_11732683 3300026142 Bacteria 640
212 Ga0207428_10096979 3300027907 Bacteria 2282
213 Ga0207428_10362468 3300027907 Bacteria 1065
214 Ga0265337_1001176 3300028556 Bacteria 13342
215 Ga0265326_10000005 3300028558 Bacteria 257124
216 Ga0265326_10000280 3300028558 Bacteria 23495
217 Ga0265319_1000720 3300028563 Bacteria 21672
218 Ga0265319_1002481 3300028563 Bacteria 10046
219 Ga0265334_10000024 3300028573 Bacteria 118525
220 Ga0265318_10000545 3300028577 Bacteria 26811
221 Ga0265336_10000001 3300028666 Bacteria 916179
222 Ga0265336_10004085 3300028666 Bacteria 5561
223 Ga0265338_10000004 3300028800 Bacteria 644793
224 Ga0265338_10013188 3300028800 Bacteria 9353
225 Ga0265324_10002344 3300029957 Bacteria 9784
226 Ga0265324_10004390 3300029957 Bacteria 6398
227 Ga0265330_10144752 3300031235 Bacteria 1010
228 Ga0265320_10015630 3300031240 Bacteria 4285
229 Ga0265320_10088230 3300031240 Bacteria 1439
230 Ga0265340_10000002 3300031247 Bacteria 711693
231 Ga0265316_10141384 3300031344 Bacteria 1807
232 Ga0307408_100830101 3300031548 Bacteria 841
233 Ga0307408_101004891 3300031548 Bacteria 769
234 Ga0265314_10289985 3300031711 Bacteria 922
235 Ga0265342_10034055 3300031712 Bacteria 3127
236 Ga0316576_10008503 3300031727 Bacteria 6552
237 Ga0316578_10130525 3300031728 Bacteria 1512
238 Ga0307405_10281946 3300031731 Bacteria 1251
239 Ga0307405_10299726 3300031731 Bacteria 1219
240 Ga0307405_11274817 3300031731 Bacteria 638
241 Ga0307413_10009276 3300031824 Bacteria 4701
242 Ga0307413_10462427 3300031824 Bacteria 1010
243 Ga0307413_11035529 3300031824 Bacteria 705
244 Ga0307410_10062762 3300031852 Bacteria 2547
245 Ga0307410_10160270 3300031852 Bacteria 1685
246 Ga0307406_10296860 3300031901 Bacteria 1239
247 Ga0307406_10628516 3300031901 Bacteria 889
248 Ga0307406_11152700 3300031901 Bacteria 671
249 Ga0307407_10226374 3300031903 Bacteria 1267
250 Ga0307412_10285695 3300031911 Bacteria 1297
251 Ga0307412_10562385 3300031911 Bacteria 960
252 Ga0307409_100024476 3300031995 Bacteria 4211
253 Ga0307409_100098698 3300031995 Bacteria 2416
254 Ga0307409_100141890 3300031995 Bacteria 2071
255 Ga0307409_100290474 3300031995 Bacteria 1516
256 Ga0307409_100791698 3300031995 Bacteria 955
257 Ga0307416_100005103 3300032002 Bacteria 8013
258 Ga0307416_100055341 3300032002 Bacteria 3194
259 Ga0307416_100140542 3300032002 Bacteria 2194
260 Ga0307414_11287266 3300032004 Bacteria 678
261 Ga0307411_11131437 3300032005 Bacteria 707
262 Ga0307415_100000210 3300032126 Bacteria 25787
263 Ga0307415_100039378 3300032126 Bacteria 3123
264 Ga0307415_100078829 3300032126 Bacteria 2344
265 Ga0307415_100164602 3300032126 Bacteria 1723
266 Ga0373953_0017226 3300035117 Bacteria 2652
267 Ga0373954_0076123 3300035118 Bacteria 1599
268 Ga0373956_0160349 3300035119 Bacteria 1060
269 Ga0316574_0010654 3300035398 Bacteria 5202
270 Ga0316574_0017011 3300035398 Bacteria 4246
271 Ga0373935_0327093 3300035692 Bacteria 1089
272 Ga0373927_0481534 3300035695 Bacteria 820
273 Ga0373933_0140514 3300035724 Bacteria 1524
274 Ga0373937_0106785 3300036401 Bacteria 2603
275 Ga0373937_0168832 3300036401 Bacteria 2052
276 Ga0316584_0000780 3300036712 Bacteria 17849
277 Ga0395900_0002246 3300037418 Bacteria 21499
278 Ga0395898_0003455 3300037466 Bacteria 17662
279 Ga0395898_0130476 3300037466 Bacteria 2408
280 Ga0395898_0225747 3300037466 Bacteria 1786
281 Ga0395898_0406059 3300037466 Bacteria 1299
282 Ga0436364_0016190 3300037853 Bacteria 731
283 Ga0436364_0352676 3300037853 Bacteria 8177
284 Ga0436364_0404384 3300037853 Bacteria 639
285 Ga0436364_0654169 3300037853 Bacteria 627
286 Ga0436364_0685462 3300037853 Bacteria 704
287 Ga0436364_0914832 3300037853 Bacteria 694
288 Ga0436364_0928984 3300037853 Bacteria 782
289 Ga0436364_1025535 3300037853 Bacteria 2817
290 Ga0436364_1032176 3300037853 Bacteria 1527
291 Ga0436364_1126485 3300037853 Bacteria 7979
292 Ga0436364_1399768 3300037853 Bacteria 1604
293 Ga0395901_0286616 3300038443 Bacteria 1710
294 Ga0395901_0758215 3300038443 Bacteria 963
295 Ga0395901_1418992 3300038443 Bacteria 652
296 Ga0436365_0222826 3300039437 Bacteria 1454
297 Ga0436365_0342272 3300039437 Bacteria 1021
298 Ga0436365_0621293 3300039437 Bacteria 2759
299 Ga0436365_1242285 3300039437 Bacteria 623
300 Ga0436365_1606885 3300039437 Bacteria 988
301 Ga0436365_1760394 3300039437 Bacteria 2582
302 Ga0436365_1870410 3300039437 Bacteria 819
303 Ga0436360_0757767 3300039438 Bacteria 1242
304 Ga0436360_1332763 3300039438 Bacteria 872
305 Ga0436363_0767851 3300039450 Bacteria 1096
306 Ga0436363_1122649 3300039450 Bacteria 915
307 Ga0436363_1365624 3300039450 Bacteria 2011
308 Ga0436363_1397465 3300039450 Bacteria 605
309 Ga0436362_0404426 3300039453 Bacteria 1057
310 Ga0436362_0532171 3300039453 Bacteria 652
311 Ga0436362_0886733 3300039453 Bacteria 966
312 Ga0436362_0937259 3300039453 Bacteria 580
313 Ga0436362_1146103 3300039453 Bacteria 1164
314 Ga0436362_1235307 3300039453 Bacteria 1524
315 Ga0436362_1284262 3300039453 Bacteria 875
316 Ga0451835_0435965 3300041492 Bacteria 629
317 Ga0451837_0462250 3300041494 Bacteria 1830
318 Ga0450905_050800 3300042142 Bacteria 676
319 Ga0439458_0016147 3300042157 Bacteria 1697
320 Ga0439460_0008285 3300042461 Bacteria 2624
321 Ga0466969_0011605 3300044656 Bacteria 4664
322 Ga0466969_0018129 3300044656 Bacteria 3672
323 Ga0466969_0177607 3300044656 Bacteria 975
324 Ga0466972_0109942 3300044658 Bacteria 1303
325 Ga0466965_0043396 3300044683 Bacteria 2220
326 Ga0466965_0136897 3300044683 Bacteria 1273
327 Ga0466965_0192936 3300044683 Bacteria 1078
328 Ga0466965_0226075 3300044683 Bacteria 998
329 Ga0466965_0230920 3300044683 Bacteria 988
330 Ga0466965_0287628 3300044683 Bacteria 889
331 Ga0466965_0346251 3300044683 Bacteria 813
332 Ga0466966_0021885 3300044684 Bacteria 4198
333 Ga0466966_0047650 3300044684 Bacteria 2732
334 Ga0466966_0066360 3300044684 Bacteria 2268
335 Ga0466966_0076645 3300044684 Bacteria 2088
336 Ga0466966_0301763 3300044684 Bacteria 962
337 Ga0466961_0047143 3300044693 Bacteria 2756
338 Ga0466961_0058041 3300044693 Bacteria 2462
339 Ga0466961_0192274 3300044693 Bacteria 1265
340 Ga0466961_0214478 3300044693 Bacteria 1188
341 Ga0466963_0011025 3300044694 Bacteria 5495
342 Ga0466963_0050355 3300044694 Bacteria 2757
343 Ga0466963_0076640 3300044694 Bacteria 2258
344 Ga0466963_0272501 3300044694 Bacteria 1189
345 Ga0466963_0447574 3300044694 Bacteria 911
346 Ga0466963_0771354 3300044694 Bacteria 678
347 Ga0466971_0009226 3300044719 Bacteria 4311
348 Ga0466971_0045137 3300044719 Bacteria 1979
349 Ga0466971_0172411 3300044719 Bacteria 1015
350 Ga0466971_0195441 3300044719 Bacteria 954
351 Ga0466971_0205893 3300044719 Bacteria 930
352 Ga0466971_0222452 3300044719 Bacteria 895
353 Ga0466968_0011878 3300044735 Bacteria 3399
354 Ga0466968_0118688 3300044735 Bacteria 1195
355 Ga0466968_0381574 3300044735 Bacteria 688
356 Ga0466970_0061603 3300044765 Bacteria 2011
357 Ga0466970_0191576 3300044765 Bacteria 1136
358 Ga0466957_0072911 3300044842 Bacteria 2127
359 Ga0466957_0135509 3300044842 Bacteria 1582
360 Ga0466957_0166676 3300044842 Bacteria 1433
361 Ga0466957_0166678 3300044842 Bacteria 1433
362 Ga0466960_0067172 3300044901 Bacteria 1775
363 Ga0466960_0123239 3300044901 Bacteria 1360
364 Ga0466960_0393531 3300044901 Bacteria 797
365 Ga0466959_0003771 3300045049 Bacteria 10040
366 Ga0466959_0004112 3300045049 Bacteria 9693
367 Ga0466959_0153288 3300045049 Bacteria 1623
368 Ga0466959_0243611 3300045049 Bacteria 1241
369 Ga0466959_0261227 3300045049 Bacteria 1192
370 Ga0466959_0338112 3300045049 Bacteria 1027
371 Ga0466959_0386428 3300045049 Bacteria 952
372 Ga0466958_0000997 3300045836 Bacteria 12813
373 Ga0466958_0004577 3300045836 Bacteria 7321
374 Ga0466958_0048392 3300045836 Bacteria 2569
375 Ga0466958_0049773 3300045836 Bacteria 2536
376 Ga0466958_0100361 3300045836 Bacteria 1799
377 Ga0466958_0131946 3300045836 Bacteria 1569
378 Ga0466958_0155265 3300045836 Bacteria 1444
379 Ga0466958_0211824 3300045836 Bacteria 1235
380 Ga0466958_0254331 3300045836 Bacteria 1124
381 Ga0466967_0021226 3300045976 Bacteria 5268
382 Ga0466967_0040122 3300045976 Bacteria 4029
383 Ga0466967_0047061 3300045976 Bacteria 3759
384 Ga0466967_0048788 3300045976 Bacteria 3700
385 Ga0466967_0141728 3300045976 Bacteria 2239
386 Ga0466967_0204753 3300045976 Bacteria 1870
387 Ga0466967_0302408 3300045976 Bacteria 1539
388 Ga0466967_0429957 3300045976 Bacteria 1288
389 Ga0466967_0943310 3300045976 Bacteria 858
390 Ga0495603_0000517 3300046455 Bacteria 21473
391 Ga0495590_0186382 3300046457 Bacteria 760
392 Ga0495651_0034931 3300046462 Bacteria 3917
393 Ga0495651_0143585 3300046462 Bacteria 1728
394 Ga0495653_0000536 3300046463 Bacteria 29053
395 Ga0495653_0040484 3300046463 Bacteria 3641
396 Ga0495582_0101034 3300046473 Bacteria 1615
397 Ga0495582_0552728 3300046473 Bacteria 666
398 Ga0495664_0067759 3300046477 Bacteria 2130
399 Ga0495664_0192772 3300046477 Bacteria 1235
400 Ga0495584_0205501 3300046491 Bacteria 1001
401 Ga0495585_0314073 3300046492 Bacteria 768
402 Ga0495596_0034379 3300046500 Bacteria 2013
403 Ga0495596_0065217 3300046500 Bacteria 1416
404 Ga0495606_0000131 3300046507 Bacteria 127298
405 Ga0495608_0024853 3300046511 Bacteria 4092
406 Ga0495618_0000046 3300046514 Bacteria 93942
407 Ga0495618_0056693 3300046514 Bacteria 2480
408 Ga0495618_0297666 3300046514 Bacteria 1003
409 Ga0495628_0102830 3300046516 Bacteria 2203
410 Ga0495630_0000241 3300046517 Bacteria 43800
411 Ga0495630_0042175 3300046517 Bacteria 3408
412 Ga0495630_0055845 3300046517 Bacteria 2959
413 Ga0495630_0402201 3300046517 Bacteria 1049
414 Ga0495643_0189844 3300046522 Bacteria 993
415 Ga0495644_0001319 3300046523 Bacteria 10171
416 Ga0495644_0004091 3300046523 Bacteria 5742
417 Ga0495666_0035807 3300046526 Bacteria 2418
418 Ga0495652_0182203 3300046529 Bacteria 1610
419 Ga0495640_0034277 3300046533 Bacteria 3601
420 Ga0495640_0210070 3300046533 Bacteria 1231
421 Ga0495645_0000119 3300046543 Bacteria 53463
422 Ga0495645_0124549 3300046543 Bacteria 1812
423 Ga0495667_0004071 3300046559 Bacteria 9822
424 Ga0495656_0011776 3300046615 Bacteria 3214
425 Ga0495656_0412458 3300046615 Bacteria 708
426 Ga0495635_0058257 3300046663 Bacteria 2657
427 Ga0495635_0103907 3300046663 Bacteria 1941
428 Ga0495588_0158694 3300046674 Bacteria 1196
429 Ga0495657_0000226 3300046675 Bacteria 50909
430 Ga0495657_0013252 3300046675 Bacteria 6089
431 Ga0495657_0211149 3300046675 Bacteria 1180
432 Ga0495623_0044060 3300046679 Bacteria 2836
433 Ga0495646_0063645 3300046680 Bacteria 2189
434 Ga0495624_0006180 3300046690 Bacteria 8515
435 Ga0495624_0198269 3300046690 Bacteria 1220
436 Ga0495624_0314789 3300046690 Bacteria 943
437 Ga0495589_0309723 3300046794 Bacteria 731
438 Ga0495600_0007772 3300046809 Bacteria 6564
439 Ga0495600_0073589 3300046809 Bacteria 2231
440 Ga0495604_0000148 3300047317 Bacteria 60608
441 Ga0495604_0029109 3300047317 Bacteria 4395
442 Ga0495604_0621131 3300047317 Bacteria 691
443 Ga0495674_0043084 3300047319 Bacteria 4020
444 Ga0495672_0004900 3300047320 Bacteria 10751
445 Ga0495672_0187465 3300047320 Bacteria 1043
446 Ga0495676_0461059 3300047321 Bacteria 837
447 Ga0495680_0003599 3300047322 Bacteria 15170
448 Ga0495680_0060244 3300047322 Bacteria 2927
449 Ga0495680_0367088 3300047322 Bacteria 999
450 Ga0495675_0018023 3300047444 Bacteria 4477
451 Ga0495675_0402829 3300047444 Bacteria 797
452 Ga0495679_021080 3300047446 Bacteria 2257
453 Ga0495673_0040040 3300047469 Bacteria 2121
454 Ga0495684_0011278 3300047471 Bacteria 6903
455 Ga0495684_0039252 3300047471 Bacteria 3629
456 Ga0495686_0114784 3300047472 Bacteria 1611
457 Ga0495602_0000008 3300048088 Bacteria 260157
458 Ga0495602_0051684 3300048088 Bacteria 3658
459 Ga0495602_0313034 3300048088 Bacteria 1145
460 Ga0496100_0000450 3300048903 Bacteria 19877
461 Ga0496100_0001847 3300048903 Bacteria 10591
462 Ga0496101_0001032 3300048904 Bacteria 16420
463 Ga0496101_1065677 3300048904 Bacteria 635
464 Ga0496102_0000040 3300048905 Bacteria 196737
465 Ga0496102_0228825 3300048905 Bacteria 1753
466 Ga0496103_0000294 3300048906 Bacteria 46122
467 Ga0496103_0265874 3300048906 Bacteria 1103
468 Ga0496104_0000006 3300048907 Bacteria 536446
469 Ga0496104_0019722 3300048907 Bacteria 6174
470 Ga0496104_0084417 3300048907 Bacteria 3030
471 Ga0496104_0392259 3300048907 Bacteria 1300
472 Ga0496105_0003897 3300048908 Bacteria 11154
473 Ga0496106_0043221 3300048909 Bacteria 3381
474 Ga0496106_1270385 3300048909 Bacteria 572
475 Ga0496108_0207973 3300048911 Bacteria 1698
476 Ga0496108_0237819 3300048911 Bacteria 1584
477 Ga0496108_0240109 3300048911 Bacteria 1576
478 Ga0496108_0706154 3300048911 Bacteria 874
479 Ga0496109_0024049 3300048912 Bacteria 5412
480 Ga0496109_0079467 3300048912 Bacteria 3022
481 Ga0496109_0143688 3300048912 Bacteria 2232
482 Ga0496109_0860021 3300048912 Bacteria 845
483 Ga0496109_0947864 3300048912 Bacteria 798
484 Ga0496110_0000064 3300048913 Bacteria 52955
485 Ga0496110_0013381 3300048913 Bacteria 6781
486 Ga0496110_0126687 3300048913 Bacteria 2304
487 Ga0496110_0194492 3300048913 Bacteria 1842
488 Ga0496111_0001334 3300048914 Bacteria 13908
489 Ga0496111_0020851 3300048914 Bacteria 4569
490 Ga0496111_0031475 3300048914 Bacteria 3779
491 Ga0496111_0107662 3300048914 Bacteria 2052
492 Ga0496111_0208442 3300048914 Bacteria 1452
493 Ga0496111_0312480 3300048914 Bacteria 1164
494 Ga0496112_0000095 3300048915 Bacteria 57431
495 Ga0496112_0005797 3300048915 Bacteria 10744
496 Ga0496112_0027041 3300048915 Bacteria 5530
497 Ga0496112_0068131 3300048915 Bacteria 3514
498 Ga0496112_0092407 3300048915 Bacteria 2995
499 Ga0496113_0012461 3300048916 Bacteria 5714
500 Ga0496113_0116927 3300048916 Bacteria 2081
501 Ga0496113_0307312 3300048916 Bacteria 1270
502 Ga0496114_0209018 3300048917 Bacteria 1711
503 Ga0496114_0398820 3300048917 Bacteria 1218
504 Ga0496115_0000059 3300048918 Bacteria 102022
505 Ga0496115_0000087 3300048918 Bacteria 86513
506 Ga0496115_0801771 3300048918 Bacteria 733
507 Ga0496126_0518979 3300048929 Bacteria 950
508 Ga0501034_0733961 3300049571 Bacteria 884
509 Ga0501034_0761102 3300049571 Bacteria 863
510 Ga0501038_0707220 3300049574 Bacteria 754
511 Ga0501039_0016828 3300049575 Bacteria 5604
512 Ga0501041_0554238 3300049577 Bacteria 733
513 Ga0501041_0767797 3300049577 Bacteria 618
514 Ga0501042_0029232 3300049578 Bacteria 3887
515 Ga0501043_0143188 3300049579 Bacteria 1872
516 Ga0501047_0061742 3300049581 Bacteria 3616
517 Ga0501048_0112200 3300049582 Bacteria 1925
518 Ga0501067_0193779 3300049583 Bacteria 1132
519 Ga0501070_0142308 3300049586 Bacteria 1980
520 Ga0501070_0698717 3300049586 Bacteria 802
521 Ga0501071_0066524 3300049587 Bacteria 2619
522 Ga0501072_0104145 3300049588 Bacteria 2256
523 Ga0501072_0213001 3300049588 Bacteria 1540
524 Ga0501074_0081338 3300049590 Bacteria 2323
525 Ga0501076_0082771 3300049592 Bacteria 2577
526 Ga0501080_0010012 3300049742 Bacteria 8666
527 Ga0501081_0260636 3300049743 Bacteria 1267
528 Ga0501035_0044250 3300049822 Bacteria 4010
529 Ga0501044_0421289 3300049823 Bacteria 1245
530 Ga0501045_0487914 3300049824 Bacteria 915
531 nmdc:mga00v17_266026_c1 3300050491 Bacteria 1113
532 nmdc:mga0yw44_12535_c1 3300050492 Bacteria 4424
533 nmdc:mga05p37_434549_c1 3300050507 Bacteria 1524
534 nmdc:mga05p37_44788_c1 3300050507 Bacteria 5443
535 nmdc:mga05p37_820_c1 3300050507 Bacteria 34830
536 nmdc:mga0qj67_1947_c1 3300050509 Bacteria 14696
537 nmdc:mga0qj67_41059_c1 3300050509 Bacteria 3638
538 nmdc:mga0qj67_514658_c1 3300050509 Bacteria 961
539 nmdc:mga08y16_342354_c1 3300050511 Bacteria 1537
540 nmdc:mga08y16_41805_c1 3300050511 Bacteria 4284
541 nmdc:mga08y16_522579_c1 3300050511 Bacteria 1203
542 nmdc:mga0n895_63547_c2 3300050512 Bacteria 2409
543 nmdc:mga0rr50_527346_c1 3300050513 Bacteria 1005
544 Ga0495601_0001916 3300053077 Bacteria 11637
545 Ga0495601_0145270 3300053077 Bacteria 1548
546 Ga0495601_0309082 3300053077 Bacteria 1029
547 Ga0495612_0000032 3300053078 Bacteria 78122
548 Ga0495612_0022179 3300053078 Bacteria 2545
549 Ga0495655_0019957 3300053083 Bacteria 1497
550 Ga0495655_0115122 3300053083 Bacteria 812
551 Ga0495595_0019745 3300053084 Bacteria 2927
552 Ga0495619_0000869 3300053085 Bacteria 19824
553 Ga0495619_0006706 3300053085 Bacteria 7284
554 Ga0495619_0014777 3300053085 Bacteria 4932
555 Ga0495619_0784379 3300053085 Bacteria 645
556 Ga0501084_0032987 3300054114 Bacteria 4332
557 Ga0501082_0271770 3300060353 Bacteria 1475
558 Ga0466962_0037952 3300061719 Bacteria 2307
559 Ga0466962_0308897 3300061719 Bacteria 783
560 Ga0530510_0110357 3300061734 Bacteria 2014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1365624 Ga0436363_1365624_1515_1988 134
2 3300044683 Ga0466965_0287628 Ga0466965_0287628_159_659 143
3 3300048918 Ga0496115_0801771 Ga0496115_0801771_199_699 143
4 3300044694 Ga0466963_0771354 Ga0466963_0771354_132_635 144
5 3300038443 Ga0395901_0758215 Ga0395901_0758215_11_520 145
6 3300037853 Ga0436364_0404384 Ga0436364_0404384_105_614 146
7 3300039437 Ga0436365_0621293 Ga0436365_0621293_1305_1814 146
8 3300048909 Ga0496106_1270385 Ga0496106_1270385_26_535 147
9 3300048918 Ga0496115_0000059 Ga0496115_0000059_67143_67724 147
10 3300005340 Ga0070689_100962815 Ga0070689_1009628152 148
11 3300031548 Ga0307408_101004891 Ga0307408_1010048911 148
12 3300048903 Ga0496100_0001847 Ga0496100_0001847_888_1475 148
13 3300048918 Ga0496115_0000087 Ga0496115_0000087_28587_29174 148
14 3300005329 Ga0070683_100144435 Ga0070683_1001444351 149
15 3300005356 Ga0070674_101015221 Ga0070674_1010152211 149
16 3300025932 Ga0207690_10118360 Ga0207690_101183603 149
17 3300049571 Ga0501034_0761102 Ga0501034_0761102_213_743 149
18 3300049579 Ga0501043_0143188 Ga0501043_0143188_575_1120 149
19 3300049581 Ga0501047_0061742 Ga0501047_0061742_81_611 149
20 3300049823 Ga0501044_0421289 Ga0501044_0421289_309_839 149
21 3300005354 Ga0070675_101091688 Ga0070675_1010916881 150
22 3300005438 Ga0070701_10279670 Ga0070701_102796702 150
23 3300005455 Ga0070663_100462463 Ga0070663_1004624632 150
24 3300005983 Ga0081540_1000011 Ga0081540_1000011187 150
25 3300006051 Ga0075364_10211054 Ga0075364_102110542 150
26 3300025942 Ga0207689_10058764 Ga0207689_100587643 150
27 3300005719 Ga0068861_100306020 Ga0068861_1003060202 151
28 3300006038 Ga0075365_10058992 Ga0075365_100589921 151
29 3300006048 Ga0075363_100017229 Ga0075363_1000172293 151
30 3300006051 Ga0075364_10065165 Ga0075364_100651653 151
31 3300006844 Ga0075428_100053301 Ga0075428_1000533012 151
32 3300006846 Ga0075430_100038180 Ga0075430_1000381803 151
33 3300009098 Ga0105245_11004423 Ga0105245_110044232 151
34 3300009147 Ga0114129_10002397 Ga0114129_1000239722 151
35 3300009147 Ga0114129_11340976 Ga0114129_113409762 151
36 3300012508 Ga0157315_1033463 Ga0157315_10334631 151
37 3300025908 Ga0207643_10102101 Ga0207643_101021012 151
38 3300026118 Ga0207675_100913857 Ga0207675_1009138572 151
39 3300031727 Ga0316576_10008503 Ga0316576_100085032 151
40 3300031728 Ga0316578_10130525 Ga0316578_101305252 151
41 3300032002 Ga0307416_100140542 Ga0307416_1001405422 151
42 3300035398 Ga0316574_0010654 Ga0316574_0010654_1113_1643 151
43 3300035398 Ga0316574_0017011 Ga0316574_0017011_1853_2383 151
44 3300036712 Ga0316584_0000780 Ga0316584_0000780_9087_9617 151
45 3300046491 Ga0495584_0205501 Ga0495584_0205501_253_789 151
46 3300046500 Ga0495596_0034379 Ga0495596_0034379_720_1256 151
47 3300046500 Ga0495596_0065217 Ga0495596_0065217_346_882 151
48 3300050491 nmdc:mga00v17_266026_c1 nmdc:mga00v17_266026_c1_431_961 151
49 3300050492 nmdc:mga0yw44_12535_c1 nmdc:mga0yw44_12535_c1_3736_4266 151
50 3300050507 nmdc:mga05p37_434549_c1 nmdc:mga05p37_434549_c1_878_1414 151
51 3300050507 nmdc:mga05p37_820_c1 nmdc:mga05p37_820_c1_24476_25012 151
52 3300050509 nmdc:mga0qj67_1947_c1 nmdc:mga0qj67_1947_c1_179_715 151
53 3300005339 Ga0070660_100018264 Ga0070660_1000182644 152
54 3300005354 Ga0070675_100523814 Ga0070675_1005238142 152
55 3300005366 Ga0070659_101053137 Ga0070659_1010531371 152
56 3300021358 Ga0213873_10010189 Ga0213873_100101891 152
57 3300021384 Ga0213876_10017207 Ga0213876_100172074 152
58 3300025901 Ga0207688_10058047 Ga0207688_100580472 152
59 3300025915 Ga0207693_10164820 Ga0207693_101648202 152
60 3300025919 Ga0207657_10027772 Ga0207657_100277724 152
61 3300025949 Ga0207667_10591581 Ga0207667_105915812 152
62 3300031911 Ga0307412_10562385 Ga0307412_105623851 152
63 3300039453 Ga0436362_1146103 Ga0436362_1146103_287_817 152
64 3300041494 Ga0451837_0462250 Ga0451837_0462250_835_1365 152
65 3300048915 Ga0496112_0092407 Ga0496112_0092407_2416_2946 152
66 3300005337 Ga0070682_100529067 Ga0070682_1005290671 153
67 3300005344 Ga0070661_100425852 Ga0070661_1004258522 153
68 3300005347 Ga0070668_100544280 Ga0070668_1005442802 153
69 3300005530 Ga0070679_100194392 Ga0070679_1001943922 153
70 3300005535 Ga0070684_100231184 Ga0070684_1002311843 153
71 3300005535 Ga0070684_100371567 Ga0070684_1003715672 153
72 3300005539 Ga0068853_100460679 Ga0068853_1004606792 153
73 3300005543 Ga0070672_100272877 Ga0070672_1002728772 153
74 3300005548 Ga0070665_100354044 Ga0070665_1003540443 153
75 3300005564 Ga0070664_100348438 Ga0070664_1003484382 153
76 3300005578 Ga0068854_100228203 Ga0068854_1002282032 153
77 3300005614 Ga0068856_100215026 Ga0068856_1002150262 153
78 3300005616 Ga0068852_101592765 Ga0068852_1015927652 153
79 3300005719 Ga0068861_101009679 Ga0068861_1010096792 153
80 3300005840 Ga0068870_10237015 Ga0068870_102370152 153
81 3300005844 Ga0068862_100466465 Ga0068862_1004664652 153
82 3300009098 Ga0105245_10347948 Ga0105245_103479482 153
83 3300009101 Ga0105247_10306691 Ga0105247_103066912 153
84 3300009148 Ga0105243_10251034 Ga0105243_102510342 153
85 3300009553 Ga0105249_10242192 Ga0105249_102421922 153
86 3300011119 Ga0105246_10319824 Ga0105246_103198242 153
87 3300012488 Ga0157343_1009045 Ga0157343_10090451 153
88 3300014325 Ga0163163_11910526 Ga0163163_119105261 153
89 3300025302 Ga0207426_1040113 Ga0207426_10401132 153
90 3300025901 Ga0207688_10324221 Ga0207688_103242211 153
91 3300025908 Ga0207643_10086508 Ga0207643_100865083 153
92 3300025927 Ga0207687_10081140 Ga0207687_100811404 153
93 3300025927 Ga0207687_10092662 Ga0207687_100926624 153
94 3300025931 Ga0207644_10883955 Ga0207644_108839552 153
95 3300025934 Ga0207686_10302231 Ga0207686_103022312 153
96 3300025935 Ga0207709_10278172 Ga0207709_102781721 153
97 3300025937 Ga0207669_10610087 Ga0207669_106100872 153
98 3300025938 Ga0207704_10634690 Ga0207704_106346902 153
99 3300025940 Ga0207691_10133625 Ga0207691_101336252 153
100 3300025945 Ga0207679_10227102 Ga0207679_102271022 153
101 3300025972 Ga0207668_10417654 Ga0207668_104176542 153
102 3300025981 Ga0207640_11105562 Ga0207640_111055622 153
103 3300026041 Ga0207639_10673369 Ga0207639_106733691 153
104 3300026041 Ga0207639_11312360 Ga0207639_113123601 153
105 3300026142 Ga0207698_10892693 Ga0207698_108926932 153
106 3300026142 Ga0207698_11732683 Ga0207698_117326831 153
107 3300031995 Ga0307409_100098698 Ga0307409_1000986983 153
108 3300031995 Ga0307409_100791698 Ga0307409_1007916982 153
109 3300037466 Ga0395898_0225747 Ga0395898_0225747_545_1093 153
110 3300037853 Ga0436364_0928984 Ga0436364_0928984_231_758 153
111 3300044683 Ga0466965_0136897 Ga0466965_0136897_476_1003 153
112 3300044684 Ga0466966_0021885 Ga0466966_0021885_1821_2354 153
113 3300044719 Ga0466971_0222452 Ga0466971_0222452_50_577 153
114 3300044901 Ga0466960_0067172 Ga0466960_0067172_455_985 153
115 3300045836 Ga0466958_0004577 Ga0466958_0004577_6154_6684 153
116 3300045836 Ga0466958_0049773 Ga0466958_0049773_1086_1616 153
117 3300045836 Ga0466958_0155265 Ga0466958_0155265_588_1118 153
118 3300045836 Ga0466958_0254331 Ga0466958_0254331_255_782 153
119 3300045976 Ga0466967_0021226 Ga0466967_0021226_13_558 153
120 3300045976 Ga0466967_0040122 Ga0466967_0040122_632_1159 153
121 3300045976 Ga0466967_0048788 Ga0466967_0048788_1688_2218 153
122 3300045976 Ga0466967_0141728 Ga0466967_0141728_423_953 153
123 3300046543 Ga0495645_0000119 Ga0495645_0000119_41645_42175 153
124 3300046809 Ga0495600_0007772 Ga0495600_0007772_4108_4674 153
125 3300048906 Ga0496103_0265874 Ga0496103_0265874_271_807 153
126 3300048907 Ga0496104_0019722 Ga0496104_0019722_469_1005 153
127 3300048908 Ga0496105_0003897 Ga0496105_0003897_629_1165 153
128 3300048909 Ga0496106_0043221 Ga0496106_0043221_1289_1825 153
129 3300048911 Ga0496108_0207973 Ga0496108_0207973_775_1311 153
130 3300048911 Ga0496108_0237819 Ga0496108_0237819_757_1287 153
131 3300048911 Ga0496108_0240109 Ga0496108_0240109_934_1464 153
132 3300048912 Ga0496109_0024049 Ga0496109_0024049_1512_2048 153
133 3300048912 Ga0496109_0079467 Ga0496109_0079467_1463_1993 153
134 3300048913 Ga0496110_0126687 Ga0496110_0126687_465_995 153
135 3300048914 Ga0496111_0107662 Ga0496111_0107662_373_909 153
136 3300048914 Ga0496111_0312480 Ga0496111_0312480_543_1073 153
137 3300048915 Ga0496112_0068131 Ga0496112_0068131_1263_1793 153
138 3300048916 Ga0496113_0012461 Ga0496113_0012461_4796_5332 153
139 3300048917 Ga0496114_0398820 Ga0496114_0398820_367_903 153
140 3300048929 Ga0496126_0518979 Ga0496126_0518979_310_840 153
141 3300049571 Ga0501034_0733961 Ga0501034_0733961_83_613 153
142 3300049574 Ga0501038_0707220 Ga0501038_0707220_53_583 153
143 3300049575 Ga0501039_0016828 Ga0501039_0016828_4309_4839 153
144 3300049577 Ga0501041_0554238 Ga0501041_0554238_148_678 153
145 3300049577 Ga0501041_0767797 Ga0501041_0767797_34_564 153
146 3300049582 Ga0501048_0112200 Ga0501048_0112200_744_1274 153
147 3300049586 Ga0501070_0698717 Ga0501070_0698717_90_620 153
148 3300049592 Ga0501076_0082771 Ga0501076_0082771_1759_2289 153
149 3300049822 Ga0501035_0044250 Ga0501035_0044250_1832_2362 153
150 3300049824 Ga0501045_0487914 Ga0501045_0487914_74_604 153
151 3300050513 nmdc:mga0rr50_527346_c1 nmdc:mga0rr50_527346_c1_321_857 153
152 3300053083 Ga0495655_0115122 Ga0495655_0115122_211_750 153
153 3300060353 Ga0501082_0271770 Ga0501082_0271770_804_1334 153
154 3300061719 Ga0466962_0308897 Ga0466962_0308897_123_650 153
155 3300061734 Ga0530510_0110357 Ga0530510_0110357_941_1471 153
156 3300003203 JGI25406J46586_10050918 JGI25406J46586_100509182 154
157 3300003373 JGI25407J50210_10002589 JGI25407J50210_100025893 154
158 3300003373 JGI25407J50210_10011634 JGI25407J50210_100116343 154
159 3300005329 Ga0070683_100075365 Ga0070683_1000753652 154
160 3300005341 Ga0070691_10525566 Ga0070691_105255661 154
161 3300005356 Ga0070674_100045886 Ga0070674_1000458863 154
162 3300005455 Ga0070663_100242395 Ga0070663_1002423952 154
163 3300005544 Ga0070686_101401166 Ga0070686_1014011661 154
164 3300005981 Ga0081538_10000071 Ga0081538_1000007150 154
165 3300005981 Ga0081538_10013513 Ga0081538_100135134 154
166 3300005981 Ga0081538_10027796 Ga0081538_100277962 154
167 3300005981 Ga0081538_10040647 Ga0081538_100406474 154
168 3300005985 Ga0081539_10001489 Ga0081539_1000148927 154
169 3300006871 Ga0075434_100123067 Ga0075434_1001230673 154
170 3300009094 Ga0111539_11029677 Ga0111539_110296772 154
171 3300009176 Ga0105242_10440243 Ga0105242_104402432 154
172 3300009177 Ga0105248_10535320 Ga0105248_105353202 154
173 3300009177 Ga0105248_11905556 Ga0105248_119055561 154
174 3300011119 Ga0105246_10246885 Ga0105246_102468852 154
175 3300014325 Ga0163163_10301675 Ga0163163_103016752 154
176 3300021384 Ga0213876_10011470 Ga0213876_100114704 154
177 3300021388 Ga0213875_10019586 Ga0213875_100195862 154
178 3300025907 Ga0207645_10136002 Ga0207645_101360022 154
179 3300025907 Ga0207645_10160625 Ga0207645_101606252 154
180 3300025935 Ga0207709_10650089 Ga0207709_106500892 154
181 3300025937 Ga0207669_10072835 Ga0207669_100728352 154
182 3300026067 Ga0207678_10273032 Ga0207678_102730322 154
183 3300026121 Ga0207683_11565745 Ga0207683_115657451 154
184 3300026142 Ga0207698_10774021 Ga0207698_107740211 154
185 3300031824 Ga0307413_10009276 Ga0307413_100092763 154
186 3300031824 Ga0307413_10462427 Ga0307413_104624272 154
187 3300031901 Ga0307406_10296860 Ga0307406_102968602 154
188 3300031901 Ga0307406_10628516 Ga0307406_106285162 154
189 3300031901 Ga0307406_11152700 Ga0307406_111527001 154
190 3300031995 Ga0307409_100024476 Ga0307409_1000244764 154
191 3300031995 Ga0307409_100290474 Ga0307409_1002904742 154
192 3300032002 Ga0307416_100005103 Ga0307416_1000051033 154
193 3300032004 Ga0307414_11287266 Ga0307414_112872662 154
194 3300037466 Ga0395898_0130476 Ga0395898_0130476_772_1305 154
195 3300037853 Ga0436364_0654169 Ga0436364_0654169_38_571 154
196 3300037853 Ga0436364_0914832 Ga0436364_0914832_53_586 154
197 3300037853 Ga0436364_1025535 Ga0436364_1025535_188_736 154
198 3300037853 Ga0436364_1399768 Ga0436364_1399768_754_1290 154
199 3300038443 Ga0395901_0286616 Ga0395901_0286616_640_1173 154
200 3300038443 Ga0395901_1418992 Ga0395901_1418992_19_552 154
201 3300039437 Ga0436365_1870410 Ga0436365_1870410_98_634 154
202 3300039438 Ga0436360_0757767 Ga0436360_0757767_697_1227 154
203 3300044658 Ga0466972_0109942 Ga0466972_0109942_327_857 154
204 3300044683 Ga0466965_0192936 Ga0466965_0192936_208_741 154
205 3300044683 Ga0466965_0346251 Ga0466965_0346251_53_583 154
206 3300044684 Ga0466966_0047650 Ga0466966_0047650_1900_2433 154
207 3300044694 Ga0466963_0076640 Ga0466963_0076640_1470_2000 154
208 3300044719 Ga0466971_0045137 Ga0466971_0045137_351_881 154
209 3300044735 Ga0466968_0118688 Ga0466968_0118688_286_819 154
210 3300044842 Ga0466957_0166678 Ga0466957_0166678_316_849 154
211 3300044901 Ga0466960_0123239 Ga0466960_0123239_503_1033 154
212 3300045049 Ga0466959_0261227 Ga0466959_0261227_295_825 154
213 3300045836 Ga0466958_0131946 Ga0466958_0131946_610_1143 154
214 3300045976 Ga0466967_0429957 Ga0466967_0429957_674_1204 154
215 3300045976 Ga0466967_0943310 Ga0466967_0943310_315_845 154
216 3300046473 Ga0495582_0101034 Ga0495582_0101034_1065_1601 154
217 3300047320 Ga0495672_0187465 Ga0495672_0187465_236_766 154
218 3300048915 Ga0496112_0027041 Ga0496112_0027041_3550_4080 154
219 3300049583 Ga0501067_0193779 Ga0501067_0193779_13_546 154
220 3300049590 Ga0501074_0081338 Ga0501074_0081338_768_1304 154
221 3300049742 Ga0501080_0010012 Ga0501080_0010012_6855_7391 154
222 3300050511 nmdc:mga08y16_342354_c1 nmdc:mga08y16_342354_c1_755_1288 154
223 3300050511 nmdc:mga08y16_522579_c1 nmdc:mga08y16_522579_c1_465_998 154
224 3300050512 nmdc:mga0n895_63547_c2 nmdc:mga0n895_63547_c2_1603_2151 154
225 3300003373 JGI25407J50210_10067213 JGI25407J50210_100672131 155
226 3300003373 JGI25407J50210_10070703 JGI25407J50210_100707031 155
227 3300005329 Ga0070683_100041692 Ga0070683_1000416925 155
228 3300005329 Ga0070683_100112293 Ga0070683_1001122934 155
229 3300005435 Ga0070714_100645410 Ga0070714_1006454102 155
230 3300005455 Ga0070663_100133658 Ga0070663_1001336582 155
231 3300005468 Ga0070707_100483521 Ga0070707_1004835212 155
232 3300005535 Ga0070684_100374262 Ga0070684_1003742622 155
233 3300005535 Ga0070684_100478395 Ga0070684_1004783952 155
234 3300005614 Ga0068856_100063649 Ga0068856_1000636494 155
235 3300005614 Ga0068856_100070161 Ga0068856_1000701613 155
236 3300005614 Ga0068856_100070194 Ga0068856_1000701944 155
237 3300005981 Ga0081538_10000179 Ga0081538_1000017967 155
238 3300005981 Ga0081538_10010091 Ga0081538_100100916 155
239 3300005981 Ga0081538_10017788 Ga0081538_100177883 155
240 3300005981 Ga0081538_10018253 Ga0081538_100182534 155
241 3300005981 Ga0081538_10027952 Ga0081538_100279522 155
242 3300005985 Ga0081539_10095731 Ga0081539_100957311 155
243 3300006028 Ga0070717_10003687 Ga0070717_100036875 155
244 3300006175 Ga0070712_100004498 Ga0070712_1000044984 155
245 3300006178 Ga0075367_10348364 Ga0075367_103483642 155
246 3300006237 Ga0097621_100653754 Ga0097621_1006537542 155
247 3300006844 Ga0075428_100069723 Ga0075428_1000697233 155
248 3300006846 Ga0075430_100042654 Ga0075430_1000426543 155
249 3300009011 Ga0105251_10262849 Ga0105251_102628492 155
250 3300009094 Ga0111539_10042751 Ga0111539_100427514 155
251 3300009098 Ga0105245_10000291 Ga0105245_1000029121 155
252 3300009147 Ga0114129_10012546 Ga0114129_100125468 155
253 3300009147 Ga0114129_10828735 Ga0114129_108287352 155
254 3300021384 Ga0213876_10322653 Ga0213876_103226531 155
255 3300025898 Ga0207692_10034024 Ga0207692_100340242 155
256 3300025912 Ga0207707_10492752 Ga0207707_104927521 155
257 3300025915 Ga0207693_10005251 Ga0207693_100052513 155
258 3300025922 Ga0207646_10387798 Ga0207646_103877982 155
259 3300025927 Ga0207687_10000058 Ga0207687_1000005850 155
260 3300025929 Ga0207664_10416066 Ga0207664_104160662 155
261 3300025944 Ga0207661_10000333 Ga0207661_1000033325 155
262 3300026067 Ga0207678_10491017 Ga0207678_104910172 155
263 3300026078 Ga0207702_10011624 Ga0207702_100116246 155
264 3300026078 Ga0207702_10015114 Ga0207702_100151146 155
265 3300026116 Ga0207674_10274332 Ga0207674_102743322 155
266 3300027907 Ga0207428_10096979 Ga0207428_100969792 155
267 3300031731 Ga0307405_10281946 Ga0307405_102819462 155
268 3300031731 Ga0307405_10299726 Ga0307405_102997262 155
269 3300031824 Ga0307413_11035529 Ga0307413_110355292 155
270 3300031852 Ga0307410_10062762 Ga0307410_100627624 155
271 3300031903 Ga0307407_10226374 Ga0307407_102263743 155
272 3300031911 Ga0307412_10285695 Ga0307412_102856951 155
273 3300031995 Ga0307409_100141890 Ga0307409_1001418903 155
274 3300032002 Ga0307416_100055341 Ga0307416_1000553414 155
275 3300032126 Ga0307415_100000210 Ga0307415_10000021025 155
276 3300032126 Ga0307415_100078829 Ga0307415_1000788292 155
277 3300032126 Ga0307415_100164602 Ga0307415_1001646023 155
278 3300036401 Ga0373937_0106785 Ga0373937_0106785_697_1239 155
279 3300037418 Ga0395900_0002246 Ga0395900_0002246_19769_20302 155
280 3300037466 Ga0395898_0003455 Ga0395898_0003455_7418_7951 155
281 3300037853 Ga0436364_0685462 Ga0436364_0685462_38_574 155
282 3300039437 Ga0436365_1242285 Ga0436365_1242285_38_571 155
283 3300039437 Ga0436365_1606885 Ga0436365_1606885_428_961 155
284 3300039450 Ga0436363_1122649 Ga0436363_1122649_177_710 155
285 3300039450 Ga0436363_1397465 Ga0436363_1397465_26_568 155
286 3300039453 Ga0436362_0937259 Ga0436362_0937259_18_554 155
287 3300041492 Ga0451835_0435965 Ga0451835_0435965_36_569 155
288 3300044656 Ga0466969_0011605 Ga0466969_0011605_3684_4217 155
289 3300044656 Ga0466969_0018129 Ga0466969_0018129_1142_1675 155
290 3300044683 Ga0466965_0043396 Ga0466965_0043396_151_684 155
291 3300044683 Ga0466965_0226075 Ga0466965_0226075_270_803 155
292 3300044683 Ga0466965_0230920 Ga0466965_0230920_374_907 155
293 3300044684 Ga0466966_0066360 Ga0466966_0066360_1558_2094 155
294 3300044684 Ga0466966_0076645 Ga0466966_0076645_704_1237 155
295 3300044684 Ga0466966_0301763 Ga0466966_0301763_263_796 155
296 3300044693 Ga0466961_0047143 Ga0466961_0047143_1794_2330 155
297 3300044693 Ga0466961_0058041 Ga0466961_0058041_569_1102 155
298 3300044693 Ga0466961_0214478 Ga0466961_0214478_387_923 155
299 3300044694 Ga0466963_0011025 Ga0466963_0011025_2231_2764 155
300 3300044694 Ga0466963_0272501 Ga0466963_0272501_25_561 155
301 3300044694 Ga0466963_0447574 Ga0466963_0447574_262_795 155
302 3300044719 Ga0466971_0009226 Ga0466971_0009226_484_1020 155
303 3300044719 Ga0466971_0172411 Ga0466971_0172411_95_628 155
304 3300044719 Ga0466971_0195441 Ga0466971_0195441_208_741 155
305 3300044719 Ga0466971_0205893 Ga0466971_0205893_305_841 155
306 3300044735 Ga0466968_0011878 Ga0466968_0011878_1057_1590 155
307 3300044765 Ga0466970_0061603 Ga0466970_0061603_360_893 155
308 3300044765 Ga0466970_0191576 Ga0466970_0191576_454_987 155
309 3300044842 Ga0466957_0072911 Ga0466957_0072911_1552_2085 155
310 3300044842 Ga0466957_0135509 Ga0466957_0135509_221_754 155
311 3300044901 Ga0466960_0393531 Ga0466960_0393531_98_631 155
312 3300045049 Ga0466959_0003771 Ga0466959_0003771_4344_4877 155
313 3300045049 Ga0466959_0004112 Ga0466959_0004112_5519_6052 155
314 3300045049 Ga0466959_0153288 Ga0466959_0153288_908_1441 155
315 3300045049 Ga0466959_0338112 Ga0466959_0338112_197_733 155
316 3300045049 Ga0466959_0386428 Ga0466959_0386428_90_626 155
317 3300045836 Ga0466958_0000997 Ga0466958_0000997_9355_9888 155
318 3300045836 Ga0466958_0048392 Ga0466958_0048392_588_1124 155
319 3300045836 Ga0466958_0211824 Ga0466958_0211824_415_948 155
320 3300045976 Ga0466967_0047061 Ga0466967_0047061_473_1006 155
321 3300045976 Ga0466967_0204753 Ga0466967_0204753_892_1425 155
322 3300045976 Ga0466967_0302408 Ga0466967_0302408_348_881 155
323 3300046455 Ga0495603_0000517 Ga0495603_0000517_20408_20950 155
324 3300046477 Ga0495664_0192772 Ga0495664_0192772_60_593 155
325 3300046514 Ga0495618_0000046 Ga0495618_0000046_37466_38014 155
326 3300046514 Ga0495618_0297666 Ga0495618_0297666_293_826 155
327 3300046517 Ga0495630_0055845 Ga0495630_0055845_2322_2855 155
328 3300046523 Ga0495644_0001319 Ga0495644_0001319_5616_6158 155
329 3300046533 Ga0495640_0210070 Ga0495640_0210070_52_594 155
330 3300046663 Ga0495635_0058257 Ga0495635_0058257_1732_2274 155
331 3300046675 Ga0495657_0211149 Ga0495657_0211149_488_1024 155
332 3300046690 Ga0495624_0198269 Ga0495624_0198269_375_917 155
333 3300046690 Ga0495624_0314789 Ga0495624_0314789_178_711 155
334 3300047317 Ga0495604_0000148 Ga0495604_0000148_31029_31592 155
335 3300047317 Ga0495604_0621131 Ga0495604_0621131_43_576 155
336 3300047320 Ga0495672_0004900 Ga0495672_0004900_8318_8851 155
337 3300047322 Ga0495680_0060244 Ga0495680_0060244_2124_2657 155
338 3300047322 Ga0495680_0367088 Ga0495680_0367088_418_960 155
339 3300047444 Ga0495675_0402829 Ga0495675_0402829_35_601 155
340 3300048088 Ga0495602_0313034 Ga0495602_0313034_367_957 155
341 3300048904 Ga0496101_1065677 Ga0496101_1065677_33_608 155
342 3300048905 Ga0496102_0000040 Ga0496102_0000040_40656_41204 155
343 3300048905 Ga0496102_0228825 Ga0496102_0228825_635_1171 155
344 3300048906 Ga0496103_0000294 Ga0496103_0000294_40672_41220 155
345 3300048907 Ga0496104_0000006 Ga0496104_0000006_420359_420892 155
346 3300048907 Ga0496104_0392259 Ga0496104_0392259_50_586 155
347 3300048912 Ga0496109_0860021 Ga0496109_0860021_20_556 155
348 3300048912 Ga0496109_0947864 Ga0496109_0947864_157_699 155
349 3300048913 Ga0496110_0000064 Ga0496110_0000064_532_1065 155
350 3300048913 Ga0496110_0013381 Ga0496110_0013381_316_858 155
351 3300048914 Ga0496111_0001334 Ga0496111_0001334_5756_6289 155
352 3300048914 Ga0496111_0020851 Ga0496111_0020851_3548_4090 155
353 3300048916 Ga0496113_0307312 Ga0496113_0307312_657_1193 155
354 3300048917 Ga0496114_0209018 Ga0496114_0209018_139_675 155
355 3300049578 Ga0501042_0029232 Ga0501042_0029232_1685_2230 155
356 3300049587 Ga0501071_0066524 Ga0501071_0066524_795_1340 155
357 3300049588 Ga0501072_0104145 Ga0501072_0104145_1676_2221 155
358 3300049588 Ga0501072_0213001 Ga0501072_0213001_561_1103 155
359 3300049743 Ga0501081_0260636 Ga0501081_0260636_285_827 155
360 3300050507 nmdc:mga05p37_44788_c1 nmdc:mga05p37_44788_c1_1287_1820 155
361 3300050509 nmdc:mga0qj67_41059_c1 nmdc:mga0qj67_41059_c1_738_1280 155
362 3300050511 nmdc:mga08y16_41805_c1 nmdc:mga08y16_41805_c1_2116_2649 155
363 3300053077 Ga0495601_0001916 Ga0495601_0001916_1472_2014 155
364 3300053077 Ga0495601_0145270 Ga0495601_0145270_59_592 155
365 3300053078 Ga0495612_0022179 Ga0495612_0022179_1220_1774 155
366 3300053083 Ga0495655_0019957 Ga0495655_0019957_282_815 155
367 3300053085 Ga0495619_0000869 Ga0495619_0000869_17622_18164 155
368 3300053085 Ga0495619_0014777 Ga0495619_0014777_4102_4644 155
369 3300053085 Ga0495619_0784379 Ga0495619_0784379_67_603 155
370 3300061719 Ga0466962_0037952 Ga0466962_0037952_1185_1721 155
371 3300005328 Ga0070676_10312666 Ga0070676_103126661 156
372 3300005329 Ga0070683_100433275 Ga0070683_1004332751 156
373 3300005341 Ga0070691_10372040 Ga0070691_103720401 156
374 3300005347 Ga0070668_100518838 Ga0070668_1005188382 156
375 3300005434 Ga0070709_10209244 Ga0070709_102092442 156
376 3300005435 Ga0070714_100203877 Ga0070714_1002038773 156
377 3300005436 Ga0070713_100182205 Ga0070713_1001822052 156
378 3300005437 Ga0070710_10114124 Ga0070710_101141242 156
379 3300005441 Ga0070700_100383801 Ga0070700_1003838012 156
380 3300005458 Ga0070681_10747239 Ga0070681_107472391 156
381 3300005539 Ga0068853_100007277 Ga0068853_1000072774 156
382 3300005543 Ga0070672_100144097 Ga0070672_1001440972 156
383 3300005616 Ga0068852_100284457 Ga0068852_1002844572 156
384 3300005617 Ga0068859_102032232 Ga0068859_1020322321 156
385 3300005842 Ga0068858_100000965 Ga0068858_10000096528 156
386 3300005981 Ga0081538_10000407 Ga0081538_1000040721 156
387 3300006028 Ga0070717_10012078 Ga0070717_100120784 156
388 3300006175 Ga0070712_100019152 Ga0070712_1000191524 156
389 3300006846 Ga0075430_100612229 Ga0075430_1006122292 156
390 3300006931 Ga0097620_102032250 Ga0097620_1020322501 156
391 3300009094 Ga0111539_10528400 Ga0111539_105284002 156
392 3300009094 Ga0111539_10595763 Ga0111539_105957632 156
393 3300009098 Ga0105245_11456427 Ga0105245_114564271 156
394 3300009147 Ga0114129_11012077 Ga0114129_110120772 156
395 3300009545 Ga0105237_10000431 Ga0105237_1000043159 156
396 3300021358 Ga0213873_10009790 Ga0213873_100097904 156
397 3300021384 Ga0213876_10085322 Ga0213876_100853222 156
398 3300021388 Ga0213875_10000272 Ga0213875_100002724 156
399 3300021388 Ga0213875_10007061 Ga0213875_100070614 156
400 3300025906 Ga0207699_10120397 Ga0207699_101203972 156
401 3300025906 Ga0207699_10180438 Ga0207699_101804382 156
402 3300025907 Ga0207645_10079582 Ga0207645_100795823 156
403 3300025912 Ga0207707_10645192 Ga0207707_106451921 156
404 3300025914 Ga0207671_10008739 Ga0207671_100087396 156
405 3300025915 Ga0207693_10053272 Ga0207693_100532722 156
406 3300025916 Ga0207663_10341796 Ga0207663_103417962 156
407 3300025928 Ga0207700_10063598 Ga0207700_100635983 156
408 3300025929 Ga0207664_10002161 Ga0207664_100021613 156
409 3300025929 Ga0207664_10353808 Ga0207664_103538082 156
410 3300025933 Ga0207706_10405994 Ga0207706_104059942 156
411 3300025937 Ga0207669_10147377 Ga0207669_101473772 156
412 3300025939 Ga0207665_10037087 Ga0207665_100370873 156
413 3300026035 Ga0207703_10000028 Ga0207703_10000028197 156
414 3300026075 Ga0207708_10070044 Ga0207708_100700442 156
415 3300026118 Ga0207675_100530624 Ga0207675_1005306242 156
416 3300026142 Ga0207698_11065918 Ga0207698_110659182 156
417 3300027907 Ga0207428_10362468 Ga0207428_103624682 156
418 3300028556 Ga0265337_1001176 Ga0265337_10011765 156
419 3300028558 Ga0265326_10000280 Ga0265326_1000028017 156
420 3300028563 Ga0265319_1000720 Ga0265319_100072018 156
421 3300028577 Ga0265318_10000545 Ga0265318_100005454 156
422 3300028666 Ga0265336_10000001 Ga0265336_10000001303 156
423 3300028800 Ga0265338_10000004 Ga0265338_10000004578 156
424 3300029957 Ga0265324_10004390 Ga0265324_100043904 156
425 3300031235 Ga0265330_10144752 Ga0265330_101447522 156
426 3300031240 Ga0265320_10088230 Ga0265320_100882302 156
427 3300031247 Ga0265340_10000002 Ga0265340_10000002578 156
428 3300031344 Ga0265316_10141384 Ga0265316_101413842 156
429 3300031548 Ga0307408_100830101 Ga0307408_1008301011 156
430 3300031711 Ga0265314_10289985 Ga0265314_102899852 156
431 3300031712 Ga0265342_10034055 Ga0265342_100340554 156
432 3300031852 Ga0307410_10160270 Ga0307410_101602702 156
433 3300032005 Ga0307411_11131437 Ga0307411_111314371 156
434 3300035117 Ga0373953_0017226 Ga0373953_0017226_1179_1715 156
435 3300035118 Ga0373954_0076123 Ga0373954_0076123_45_581 156
436 3300035119 Ga0373956_0160349 Ga0373956_0160349_210_746 156
437 3300035692 Ga0373935_0327093 Ga0373935_0327093_270_806 156
438 3300035724 Ga0373933_0140514 Ga0373933_0140514_922_1458 156
439 3300036401 Ga0373937_0168832 Ga0373937_0168832_213_749 156
440 3300037466 Ga0395898_0406059 Ga0395898_0406059_732_1268 156
441 3300037853 Ga0436364_0352676 Ga0436364_0352676_2999_3535 156
442 3300037853 Ga0436364_1032176 Ga0436364_1032176_677_1213 156
443 3300037853 Ga0436364_1126485 Ga0436364_1126485_3737_4273 156
444 3300039437 Ga0436365_0222826 Ga0436365_0222826_496_1071 156
445 3300039437 Ga0436365_0342272 Ga0436365_0342272_54_590 156
446 3300039437 Ga0436365_1760394 Ga0436365_1760394_468_1004 156
447 3300039438 Ga0436360_1332763 Ga0436360_1332763_76_612 156
448 3300039450 Ga0436363_0767851 Ga0436363_0767851_21_557 156
449 3300039453 Ga0436362_0532171 Ga0436362_0532171_35_571 156
450 3300039453 Ga0436362_0886733 Ga0436362_0886733_367_903 156
451 3300039453 Ga0436362_1235307 Ga0436362_1235307_725_1261 156
452 3300039453 Ga0436362_1284262 Ga0436362_1284262_51_587 156
453 3300042142 Ga0450905_050800 Ga0450905_050800_86_625 156
454 3300042157 Ga0439458_0016147 Ga0439458_0016147_323_862 156
455 3300042461 Ga0439460_0008285 Ga0439460_0008285_1789_2328 156
456 3300044656 Ga0466969_0177607 Ga0466969_0177607_327_863 156
457 3300044693 Ga0466961_0192274 Ga0466961_0192274_22_558 156
458 3300044694 Ga0466963_0050355 Ga0466963_0050355_548_1084 156
459 3300044735 Ga0466968_0381574 Ga0466968_0381574_19_555 156
460 3300044842 Ga0466957_0166676 Ga0466957_0166676_455_991 156
461 3300045049 Ga0466959_0243611 Ga0466959_0243611_438_977 156
462 3300045836 Ga0466958_0100361 Ga0466958_0100361_997_1536 156
463 3300046457 Ga0495590_0186382 Ga0495590_0186382_213_749 156
464 3300046462 Ga0495651_0034931 Ga0495651_0034931_1418_1954 156
465 3300046462 Ga0495651_0143585 Ga0495651_0143585_63_680 156
466 3300046463 Ga0495653_0000536 Ga0495653_0000536_20135_20752 156
467 3300046463 Ga0495653_0040484 Ga0495653_0040484_1355_1891 156
468 3300046477 Ga0495664_0067759 Ga0495664_0067759_1452_1988 156
469 3300046492 Ga0495585_0314073 Ga0495585_0314073_80_616 156
470 3300046507 Ga0495606_0000131 Ga0495606_0000131_103636_104193 156
471 3300046511 Ga0495608_0024853 Ga0495608_0024853_3182_3718 156
472 3300046514 Ga0495618_0056693 Ga0495618_0056693_919_1455 156
473 3300046516 Ga0495628_0102830 Ga0495628_0102830_111_647 156
474 3300046517 Ga0495630_0042175 Ga0495630_0042175_1359_1904 156
475 3300046522 Ga0495643_0189844 Ga0495643_0189844_114_650 156
476 3300046529 Ga0495652_0182203 Ga0495652_0182203_91_627 156
477 3300046533 Ga0495640_0034277 Ga0495640_0034277_1407_1943 156
478 3300046543 Ga0495645_0124549 Ga0495645_0124549_1130_1666 156
479 3300046559 Ga0495667_0004071 Ga0495667_0004071_2665_3201 156
480 3300046663 Ga0495635_0103907 Ga0495635_0103907_940_1476 156
481 3300046675 Ga0495657_0013252 Ga0495657_0013252_4496_5032 156
482 3300046679 Ga0495623_0044060 Ga0495623_0044060_932_1468 156
483 3300046680 Ga0495646_0063645 Ga0495646_0063645_1050_1586 156
484 3300046794 Ga0495589_0309723 Ga0495589_0309723_72_608 156
485 3300046809 Ga0495600_0073589 Ga0495600_0073589_1614_2150 156
486 3300047317 Ga0495604_0029109 Ga0495604_0029109_2131_2667 156
487 3300047319 Ga0495674_0043084 Ga0495674_0043084_2581_3117 156
488 3300047322 Ga0495680_0003599 Ga0495680_0003599_466_1002 156
489 3300047444 Ga0495675_0018023 Ga0495675_0018023_1649_2185 156
490 3300047446 Ga0495679_021080 Ga0495679_021080_1219_1764 156
491 3300047471 Ga0495684_0011278 Ga0495684_0011278_4886_5503 156
492 3300047471 Ga0495684_0039252 Ga0495684_0039252_1125_1661 156
493 3300048088 Ga0495602_0051684 Ga0495602_0051684_1951_2487 156
494 3300048907 Ga0496104_0084417 Ga0496104_0084417_1808_2344 156
495 3300048911 Ga0496108_0706154 Ga0496108_0706154_284_820 156
496 3300048913 Ga0496110_0194492 Ga0496110_0194492_429_965 156
497 3300048915 Ga0496112_0005797 Ga0496112_0005797_2412_2948 156
498 3300049586 Ga0501070_0142308 Ga0501070_0142308_705_1274 156
499 3300050509 nmdc:mga0qj67_514658_c1 nmdc:mga0qj67_514658_c1_135_674 156
500 3300053077 Ga0495601_0309082 Ga0495601_0309082_185_721 156
501 3300053078 Ga0495612_0000032 Ga0495612_0000032_34968_35585 156
502 3300053084 Ga0495595_0019745 Ga0495595_0019745_414_950 156
503 3300053085 Ga0495619_0006706 Ga0495619_0006706_1720_2256 156
504 3300054114 Ga0501084_0032987 Ga0501084_0032987_3335_3874 156
505 3300000546 LJNas_1009382 LJNas_10093822 157
506 3300005337 Ga0070682_100234109 Ga0070682_1002341092 157
507 3300005366 Ga0070659_100000176 Ga0070659_10000017632 157
508 3300005435 Ga0070714_100024259 Ga0070714_1000242592 157
509 3300005437 Ga0070710_10000013 Ga0070710_1000001319 157
510 3300005437 Ga0070710_10172111 Ga0070710_101721112 157
511 3300005440 Ga0070705_100002829 Ga0070705_1000028295 157
512 3300005543 Ga0070672_100000003 Ga0070672_10000000382 157
513 3300005614 Ga0068856_100109916 Ga0068856_1001099164 157
514 3300006028 Ga0070717_10000061 Ga0070717_1000006133 157
515 3300006175 Ga0070712_100000013 Ga0070712_100000013102 157
516 3300006852 Ga0075433_10535846 Ga0075433_105358462 157
517 3300014969 Ga0157376_10020056 Ga0157376_100200565 157
518 3300025898 Ga0207692_10000003 Ga0207692_10000003159 157
519 3300025915 Ga0207693_10000046 Ga0207693_100000463 157
520 3300025929 Ga0207664_10000142 Ga0207664_100001424 157
521 3300025929 Ga0207664_10916239 Ga0207664_109162391 157
522 3300025932 Ga0207690_10000054 Ga0207690_100000544 157
523 3300025939 Ga0207665_10119163 Ga0207665_101191632 157
524 3300025940 Ga0207691_10000005 Ga0207691_1000000582 157
525 3300025961 Ga0207712_10863865 Ga0207712_108638652 157
526 3300026078 Ga0207702_10012421 Ga0207702_100124214 157
527 3300026089 Ga0207648_10468917 Ga0207648_104689172 157
528 3300028558 Ga0265326_10000005 Ga0265326_1000000578 157
529 3300028563 Ga0265319_1002481 Ga0265319_10024813 157
530 3300028573 Ga0265334_10000024 Ga0265334_1000002474 157
531 3300028666 Ga0265336_10004085 Ga0265336_100040853 157
532 3300028800 Ga0265338_10013188 Ga0265338_100131888 157
533 3300029957 Ga0265324_10002344 Ga0265324_100023443 157
534 3300031240 Ga0265320_10015630 Ga0265320_100156303 157
535 3300031731 Ga0307405_11274817 Ga0307405_112748171 157
536 3300032126 Ga0307415_100039378 Ga0307415_1000393782 157
537 3300035695 Ga0373927_0481534 Ga0373927_0481534_174_728 157
538 3300037853 Ga0436364_0016190 Ga0436364_0016190_57_611 157
539 3300039453 Ga0436362_0404426 Ga0436362_0404426_168_743 157
540 3300046473 Ga0495582_0552728 Ga0495582_0552728_92_631 157
541 3300046517 Ga0495630_0000241 Ga0495630_0000241_27045_27677 157
542 3300046517 Ga0495630_0402201 Ga0495630_0402201_238_789 157
543 3300046523 Ga0495644_0004091 Ga0495644_0004091_3617_4168 157
544 3300046526 Ga0495666_0035807 Ga0495666_0035807_979_1533 157
545 3300046615 Ga0495656_0011776 Ga0495656_0011776_1992_2543 157
546 3300046615 Ga0495656_0412458 Ga0495656_0412458_39_587 157
547 3300046674 Ga0495588_0158694 Ga0495588_0158694_321_860 157
548 3300046675 Ga0495657_0000226 Ga0495657_0000226_27066_27698 157
549 3300046690 Ga0495624_0006180 Ga0495624_0006180_6580_7149 157
550 3300047321 Ga0495676_0461059 Ga0495676_0461059_177_731 157
551 3300047469 Ga0495673_0040040 Ga0495673_0040040_775_1326 157
552 3300047472 Ga0495686_0114784 Ga0495686_0114784_263_814 157
553 3300048088 Ga0495602_0000008 Ga0495602_0000008_203345_203941 157
554 3300048903 Ga0496100_0000450 Ga0496100_0000450_5022_5564 157
555 3300048904 Ga0496101_0001032 Ga0496101_0001032_7419_7961 157
556 3300048912 Ga0496109_0143688 Ga0496109_0143688_229_768 157
557 3300048914 Ga0496111_0031475 Ga0496111_0031475_756_1298 157
558 3300048914 Ga0496111_0208442 Ga0496111_0208442_562_1101 157
559 3300048915 Ga0496112_0000095 Ga0496112_0000095_25316_25858 157
560 3300048916 Ga0496113_0116927 Ga0496113_0116927_1292_1849 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

108

128

0.95

Feature Viewer

pLDDT pTM Quality
52.85 0.22 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map