F463727

General Info

Members Datasets Scaffolds Average Seq Length
560 283 1120 128

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0016169|Ga0466963_0016169_2966_3391
Length 141
Sequence VPPEPRLTDEKEAGVGKEVVRTEAAPAPFQGAPYSQAIKANGFVFVSGQLGLKPGDTSFEGDVTTQTEQIFANLRAILDEAGSSLDQVVKTTVFLQDLGDFAAMNEVYARHIGSTPAARSTVEVAKLPSGALVEIEAIALL

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
166 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 2.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 6.07
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0016169 3300044694 Bacteria 4637
2 Ga0058863_11642451 3300004799 Bacteria 554
3 Ga0070658_10088567 3300005327 Bacteria 2549
4 Ga0070658_10223935 3300005327 Bacteria 1591
5 Ga0070658_10512162 3300005327 Bacteria 1037
6 Ga0070683_100033750 3300005329 Bacteria 4668
7 Ga0070683_100438791 3300005329 Bacteria 1246
8 Ga0070683_100937180 3300005329 Bacteria 831
9 Ga0070680_100034051 3300005336 Bacteria 4107
10 Ga0070680_100045002 3300005336 Bacteria 3587
11 Ga0070680_100505962 3300005336 Bacteria 1034
12 Ga0070680_100574793 3300005336 Bacteria 967
13 Ga0070682_100026553 3300005337 Bacteria 3467
14 Ga0070682_100370519 3300005337 Bacteria 1074
15 Ga0068868_100770352 3300005338 Bacteria 866
16 Ga0070660_100001690 3300005339 Bacteria 15140
17 Ga0070660_100022341 3300005339 Bacteria 4677
18 Ga0070660_100171465 3300005339 Bacteria 1753
19 Ga0070660_100235058 3300005339 Bacteria 1492
20 Ga0070660_100945481 3300005339 Bacteria 727
21 Ga0070661_100021426 3300005344 Bacteria 4615
22 Ga0070661_100051038 3300005344 Bacteria 3027
23 Ga0070661_100072486 3300005344 Bacteria 2534
24 Ga0070674_100613938 3300005356 Bacteria 920
25 Ga0070659_100018433 3300005366 Bacteria 5268
26 Ga0070659_100032737 3300005366 Bacteria 4034
27 Ga0070714_100073057 3300005435 Bacteria 2971
28 Ga0070714_100117315 3300005435 Bacteria 2364
29 Ga0070714_100162259 3300005435 Bacteria 2023
30 Ga0070714_100460353 3300005435 Bacteria 1209
31 Ga0070713_100490606 3300005436 Bacteria 1158
32 Ga0070710_10597148 3300005437 Bacteria 768
33 Ga0070710_10894195 3300005437 Bacteria 641
34 Ga0070694_100057695 3300005444 Unclassified 2640
35 Ga0070663_100805385 3300005455 Bacteria 806
36 Ga0070662_100027007 3300005457 Unclassified 3981
37 Ga0070681_10001213 3300005458 Bacteria 22417
38 Ga0070681_10019695 3300005458 Bacteria 6758
39 Ga0070681_10028524 3300005458 Bacteria 5612
40 Ga0070681_10189420 3300005458 Bacteria 1977
41 Ga0070681_10214824 3300005458 Bacteria 1840
42 Ga0070681_10446744 3300005458 Bacteria 1205
43 Ga0068867_100278118 3300005459 Bacteria 1372
44 Ga0070706_100374361 3300005467 Unclassified 1327
45 Ga0070707_100604557 3300005468 Bacteria 1059
46 Ga0070698_100322595 3300005471 Unclassified 1475
47 Ga0070698_101165176 3300005471 Bacteria 720
48 Ga0070679_100020490 3300005530 Bacteria 6448
49 Ga0070679_100064040 3300005530 Bacteria 3664
50 Ga0070679_100077468 3300005530 Bacteria 3314
51 Ga0070679_100113359 3300005530 Bacteria 2697
52 Ga0070679_100190685 3300005530 Bacteria 2019
53 Ga0070679_100720212 3300005530 Bacteria 940
54 Ga0070684_100274242 3300005535 Bacteria 1544
55 Ga0070684_100303229 3300005535 Bacteria 1466
56 Ga0070684_100435665 3300005535 Bacteria 1211
57 Ga0070697_100552079 3300005536 Bacteria 1010
58 Ga0068853_100171346 3300005539 Bacteria 1964
59 Ga0068853_100472086 3300005539 Bacteria 1182
60 Ga0068853_100701082 3300005539 Bacteria 966
61 Ga0068853_101045653 3300005539 Bacteria 787
62 Ga0070672_100469306 3300005543 Bacteria 1086
63 Ga0070696_100006574 3300005546 Bacteria 7761
64 Ga0070696_100766128 3300005546 Bacteria 792
65 Ga0070693_100268380 3300005547 Bacteria 1138
66 Ga0070693_100848266 3300005547 Bacteria 681
67 Ga0070665_100979172 3300005548 Bacteria 858
68 Ga0070665_101512256 3300005548 Bacteria 680
69 Ga0070704_101940830 3300005549 Bacteria 546
70 Ga0068855_100091007 3300005563 Bacteria 3519
71 Ga0068855_100185298 3300005563 Bacteria 2351
72 Ga0068855_100329495 3300005563 Bacteria 1686
73 Ga0068855_100353708 3300005563 Bacteria 1618
74 Ga0068855_101257717 3300005563 Bacteria 768
75 Ga0070664_101653439 3300005564 Bacteria 607
76 Ga0068857_100020406 3300005577 Bacteria 5827
77 Ga0068857_100557442 3300005577 Unclassified 1080
78 Ga0068857_100726463 3300005577 Bacteria 945
79 Ga0068856_100131499 3300005614 Bacteria 2507
80 Ga0068856_100175260 3300005614 Bacteria 2157
81 Ga0068856_100281809 3300005614 Unclassified 1679
82 Ga0068856_101526535 3300005614 Unclassified 682
83 Ga0068852_100021638 3300005616 Bacteria 5140
84 Ga0068852_100027110 3300005616 Bacteria 4665
85 Ga0068852_100628736 3300005616 Bacteria 1080
86 Ga0068866_10316843 3300005718 Bacteria 980
87 Ga0068861_100252259 3300005719 Bacteria 1506
88 Ga0068851_10164646 3300005834 Bacteria 1220
89 Ga0068862_101254609 3300005844 Unclassified 741
90 Ga0081455_10003417 3300005937 Bacteria 18253
91 Ga0081455_10017705 3300005937 Bacteria 6817
92 Ga0081538_10001394 3300005981 Bacteria 24783
93 Ga0081538_10002571 3300005981 Bacteria 17618
94 Ga0081538_10009862 3300005981 Bacteria 7899
95 Ga0081539_10007808 3300005985 Bacteria 9569
96 Ga0070717_10098754 3300006028 Unclassified 2476
97 Ga0070717_10388728 3300006028 Bacteria 1252
98 Ga0075432_10014007 3300006058 Bacteria 2730
99 Ga0075431_100019830 3300006847 Bacteria 6865
100 Ga0075431_100030146 3300006847 Bacteria 5586
101 Ga0075433_10029740 3300006852 Bacteria 4657
102 Ga0075434_100171412 3300006871 Bacteria 2190
103 Ga0075436_100003202 3300006914 Bacteria 11222
104 Ga0075436_100182910 3300006914 Bacteria 1482
105 Ga0075435_100010364 3300007076 Bacteria 6815
106 Ga0105240_10031692 3300009093 Bacteria 6851
107 Ga0105240_10161333 3300009093 Bacteria 2662
108 Ga0105240_10172948 3300009093 Bacteria 2556
109 Ga0105240_10378908 3300009093 Unclassified 1598
110 Ga0105240_10425523 3300009093 Bacteria 1491
111 Ga0111539_10679345 3300009094 Bacteria 1199
112 Ga0111539_12460027 3300009094 Bacteria 604
113 Ga0105245_10065394 3300009098 Bacteria 3289
114 Ga0114129_10013910 3300009147 Bacteria 11464
115 Ga0114129_10063415 3300009147 Bacteria 5160
116 Ga0114129_10491828 3300009147 Bacteria 1603
117 Ga0105243_10326626 3300009148 Bacteria 1400
118 Ga0105241_10273177 3300009174 Bacteria 1441
119 Ga0105241_10808151 3300009174 Bacteria 864
120 Ga0105237_10026541 3300009545 Bacteria 5920
121 Ga0105237_10292201 3300009545 Bacteria 1632
122 Ga0105237_10292690 3300009545 Bacteria 1631
123 Ga0105238_10099897 3300009551 Bacteria 2885
124 Ga0105238_10107271 3300009551 Bacteria 2774
125 Ga0105238_11418896 3300009551 Bacteria 722
126 Ga0105239_10122381 3300010375 Bacteria 2890
127 Ga0105239_11452651 3300010375 Bacteria 792
128 Ga0105239_11536767 3300010375 Bacteria 769
129 Ga0157373_10083944 3300013100 Bacteria 2245
130 Ga0157373_10144709 3300013100 Bacteria 1672
131 Ga0157371_10301061 3300013102 Bacteria 1161
132 Ga0157371_10360904 3300013102 Bacteria 1059
133 Ga0157370_10078188 3300013104 Bacteria 3115
134 Ga0157370_10652390 3300013104 Bacteria 962
135 Ga0157369_10010462 3300013105 Bacteria 10568
136 Ga0157369_10031545 3300013105 Bacteria 5834
137 Ga0157369_10069558 3300013105 Bacteria 3781
138 Ga0157369_10174783 3300013105 Bacteria 2261
139 Ga0157374_10333174 3300013296 Bacteria 1506
140 Ga0157378_11298164 3300013297 Bacteria 769
141 Ga0163162_13114626 3300013306 Bacteria 532
142 Ga0157372_10032454 3300013307 Bacteria 5727
143 Ga0157372_10044755 3300013307 Bacteria 4906
144 Ga0157372_10097095 3300013307 Bacteria 3359
145 Ga0157372_10112520 3300013307 Bacteria 3119
146 Ga0157372_10209953 3300013307 Bacteria 2256
147 Ga0157372_11748530 3300013307 Bacteria 715
148 Ga0157372_13075497 3300013307 Unclassified 533
149 Ga0182008_10040616 3300014497 Bacteria 2322
150 Ga0182008_10922215 3300014497 Bacteria 515
151 Ga0157376_10226058 3300014969 Bacteria 1736
152 Ga0157376_11082971 3300014969 Bacteria 827
153 Ga0197907_11004893 3300020069 Bacteria 3370
154 Ga0197907_11437805 3300020069 Bacteria 921
155 Ga0206356_10102986 3300020070 Bacteria 2561
156 Ga0206356_10696300 3300020070 Bacteria 3762
157 Ga0206355_1163117 3300020076 Unclassified 722
158 Ga0206355_1516888 3300020076 Bacteria 613
159 Ga0206354_10446418 3300020081 Bacteria 1810
160 Ga0206354_11343095 3300020081 Unclassified 1004
161 Ga0206354_11470705 3300020081 Bacteria 1492
162 Ga0206353_10127946 3300020082 Bacteria 2432
163 Ga0206353_10712429 3300020082 Bacteria 4178
164 Ga0206353_11018008 3300020082 Bacteria 8062
165 Ga0206353_11205023 3300020082 Unclassified 1551
166 Ga0213873_10076801 3300021358 Bacteria 929
167 Ga0213871_10109586 3300021441 Bacteria 815
168 Ga0224712_10055919 3300022467 Bacteria 1554
169 Ga0207656_10408493 3300025321 Bacteria 683
170 Ga0207692_10323790 3300025898 Bacteria 944
171 Ga0207692_10489915 3300025898 Bacteria 779
172 Ga0207688_10552356 3300025901 Bacteria 724
173 Ga0207705_10030001 3300025909 Bacteria 3879
174 Ga0207705_10315719 3300025909 Bacteria 1200
175 Ga0207684_10123996 3300025910 Bacteria 2216
176 Ga0207654_10675305 3300025911 Bacteria 741
177 Ga0207707_10002380 3300025912 Bacteria 16951
178 Ga0207707_10004067 3300025912 Bacteria 12951
179 Ga0207707_10058142 3300025912 Bacteria 3365
180 Ga0207707_10070612 3300025912 Bacteria 3043
181 Ga0207707_10628215 3300025912 Bacteria 907
182 Ga0207707_11184599 3300025912 Bacteria 619
183 Ga0207695_10179936 3300025913 Bacteria 2035
184 Ga0207695_10214133 3300025913 Bacteria 1836
185 Ga0207695_10215922 3300025913 Bacteria 1827
186 Ga0207695_10347398 3300025913 Bacteria 1371
187 Ga0207695_10358403 3300025913 Bacteria 1345
188 Ga0207695_10668717 3300025913 Bacteria 919
189 Ga0207671_10048749 3300025914 Bacteria 3135
190 Ga0207671_10295302 3300025914 Unclassified 1280
191 Ga0207693_10249206 3300025915 Bacteria 1394
192 Ga0207663_10269976 3300025916 Bacteria 1260
193 Ga0207660_10005698 3300025917 Bacteria 8083
194 Ga0207660_10052192 3300025917 Bacteria 2910
195 Ga0207660_10080595 3300025917 Bacteria 2391
196 Ga0207657_10000941 3300025919 Bacteria 30830
197 Ga0207657_10015637 3300025919 Bacteria 7341
198 Ga0207657_10036100 3300025919 Bacteria 4426
199 Ga0207657_10268091 3300025919 Bacteria 1358
200 Ga0207657_11431844 3300025919 Bacteria 518
201 Ga0207649_10011602 3300025920 Bacteria 4864
202 Ga0207649_10084907 3300025920 Bacteria 2059
203 Ga0207649_10961722 3300025920 Bacteria 671
204 Ga0207652_10013345 3300025921 Bacteria 6653
205 Ga0207652_10015888 3300025921 Bacteria 6134
206 Ga0207652_10089158 3300025921 Bacteria 2708
207 Ga0207652_10194972 3300025921 Bacteria 1822
208 Ga0207652_10353530 3300025921 Bacteria 1326
209 Ga0207652_10415308 3300025921 Bacteria 1214
210 Ga0207652_10713084 3300025921 Bacteria 894
211 Ga0207652_10783856 3300025921 Bacteria 847
212 Ga0207646_10495842 3300025922 Bacteria 1100
213 Ga0207694_10425852 3300025924 Bacteria 1106
214 Ga0207694_11144898 3300025924 Bacteria 658
215 Ga0207700_10063726 3300025928 Bacteria 2805
216 Ga0207700_10627164 3300025928 Bacteria 958
217 Ga0207700_11711726 3300025928 Bacteria 554
218 Ga0207664_10130737 3300025929 Bacteria 2113
219 Ga0207664_11278613 3300025929 Bacteria 653
220 Ga0207644_10242666 3300025931 Bacteria 1435
221 Ga0207644_11049889 3300025931 Bacteria 684
222 Ga0207690_10047800 3300025932 Bacteria 2841
223 Ga0207690_10058247 3300025932 Bacteria 2612
224 Ga0207690_11054060 3300025932 Unclassified 677
225 Ga0207706_10098015 3300025933 Bacteria 2579
226 Ga0207669_10523411 3300025937 Bacteria 952
227 Ga0207665_10563025 3300025939 Unclassified 887
228 Ga0207665_11192258 3300025939 Bacteria 607
229 Ga0207661_10373260 3300025944 Bacteria 1290
230 Ga0207661_11205696 3300025944 Bacteria 696
231 Ga0207667_10132535 3300025949 Bacteria 2567
232 Ga0207667_10276298 3300025949 Bacteria 1717
233 Ga0207667_10682890 3300025949 Bacteria 1030
234 Ga0207651_10472006 3300025960 Bacteria 1080
235 Ga0207677_10111891 3300026023 Bacteria 2035
236 Ga0207639_10050133 3300026041 Bacteria 3169
237 Ga0207639_10766603 3300026041 Bacteria 898
238 Ga0207639_11658673 3300026041 Bacteria 599
239 Ga0207639_11743204 3300026041 Bacteria 583
240 Ga0207678_10285869 3300026067 Bacteria 1416
241 Ga0207702_10056397 3300026078 Bacteria 3335
242 Ga0207702_10174955 3300026078 Bacteria 1971
243 Ga0207702_10495237 3300026078 Bacteria 1191
244 Ga0207648_10058328 3300026089 Bacteria 3367
245 Ga0207674_10011122 3300026116 Bacteria 10120
246 Ga0207674_10027334 3300026116 Bacteria 6037
247 Ga0207698_10104284 3300026142 Bacteria 2359
248 Ga0207698_10510112 3300026142 Bacteria 1172
249 Ga0207698_10594544 3300026142 Bacteria 1090
250 Ga0207698_11170739 3300026142 Bacteria 782
251 Ga0207698_12180109 3300026142 Bacteria 567
252 Ga0207428_10168586 3300027907 Bacteria 1659
253 Ga0268266_10130749 3300028379 Bacteria 2245
254 Ga0268266_10793382 3300028379 Bacteria 915
255 Ga0265326_10120053 3300028558 Bacteria 747
256 Ga0265334_10190745 3300028573 Unclassified 714
257 Ga0265318_10203818 3300028577 Bacteria 723
258 Ga0265322_10009978 3300028654 Bacteria 2753
259 Ga0265322_10024275 3300028654 Bacteria 1734
260 Ga0265336_10055131 3300028666 Bacteria 1196
261 Ga0265338_10008039 3300028800 Bacteria 12898
262 Ga0265338_10067734 3300028800 Bacteria 3081
263 Ga0265330_10043012 3300031235 Bacteria 2000
264 Ga0265332_10482780 3300031238 Bacteria 513
265 Ga0265320_10418198 3300031240 Bacteria 592
266 Ga0265325_10029335 3300031241 Unclassified 2958
267 Ga0265329_10015251 3300031242 Bacteria 2688
268 Ga0265340_10268325 3300031247 Bacteria 759
269 Ga0265339_10028816 3300031249 Bacteria 3155
270 Ga0265331_10041649 3300031250 Bacteria 2231
271 Ga0265327_10038149 3300031251 Bacteria 2624
272 Ga0265316_10101442 3300031344 Bacteria 2186
273 Ga0307408_100577410 3300031548 Unclassified 996
274 Ga0265313_10040859 3300031595 Bacteria 2289
275 Ga0316579_10232702 3300031691 Bacteria 891
276 Ga0265314_10052842 3300031711 Bacteria 2821
277 Ga0265314_10092432 3300031711 Bacteria 1967
278 Ga0316578_10292853 3300031728 Bacteria 974
279 Ga0307405_10015635 3300031731 Bacteria 4117
280 Ga0307405_10242742 3300031731 Bacteria 1335
281 Ga0316577_10004435 3300031733 Bacteria 7243
282 Ga0307410_10347050 3300031852 Bacteria 1185
283 Ga0307407_10407998 3300031903 Bacteria 976
284 Ga0307412_10437436 3300031911 Bacteria 1074
285 Ga0307412_10873494 3300031911 Bacteria 786
286 Ga0307409_100050166 3300031995 Bacteria 3186
287 Ga0307409_100625045 3300031995 Bacteria 1067
288 Ga0307416_100055497 3300032002 Bacteria 3191
289 Ga0307416_100119374 3300032002 Bacteria 2345
290 Ga0307414_10179895 3300032004 Bacteria 1700
291 Ga0307415_100066535 3300032126 Bacteria 2515
292 Ga0307415_100400549 3300032126 Bacteria 1171
293 Ga0373934_0315311 3300035086 Bacteria 649
294 Ga0373944_0008916 3300035089 Bacteria 2712
295 Ga0373923_0128342 3300035111 Bacteria 1138
296 Ga0373936_0024762 3300035113 Bacteria 2345
297 Ga0373945_0035629 3300035116 Bacteria 1779
298 Ga0373956_0031806 3300035119 Bacteria 2314
299 Ga0373943_0023697 3300035170 Bacteria 2855
300 Ga0373946_0105424 3300035171 Bacteria 1269
301 Ga0373924_0306859 3300035410 Bacteria 705
302 Ga0373935_0208102 3300035692 Bacteria 1354
303 Ga0373927_0096105 3300035695 Bacteria 1926
304 Ga0373947_0032833 3300035725 Bacteria 3061
305 Ga0373937_0072225 3300036401 Bacteria 3182
306 Ga0316584_0025252 3300036712 Bacteria 4356
307 Ga0373925_0040730 3300037068 Bacteria 3440
308 Ga0395899_0022780 3300037312 Bacteria 4746
309 Ga0395899_0103349 3300037312 Bacteria 2055
310 Ga0395899_0106526 3300037312 Bacteria 2019
311 Ga0395900_0025932 3300037418 Bacteria 6002
312 Ga0395900_0136023 3300037418 Bacteria 2518
313 Ga0395900_0244942 3300037418 Bacteria 1796
314 Ga0395900_0720648 3300037418 Bacteria 930
315 Ga0395900_0790972 3300037418 Unclassified 877
316 Ga0395900_0809482 3300037418 Unclassified 864
317 Ga0395900_1181010 3300037418 Bacteria 681
318 Ga0395898_0001509 3300037466 Bacteria 32076
319 Ga0395898_0015618 3300037466 Bacteria 7783
320 Ga0395898_0037016 3300037466 Bacteria 4843
321 Ga0395898_0057222 3300037466 Bacteria 3800
322 Ga0395898_0246927 3300037466 Unclassified 1702
323 Ga0395898_0252200 3300037466 Bacteria 1683
324 Ga0395898_0264044 3300037466 Bacteria 1642
325 Ga0395898_0332057 3300037466 Bacteria 1450
326 Ga0395905_0277156 3300037471 Bacteria 1563
327 Ga0395905_0724249 3300037471 Bacteria 897
328 Ga0395905_0916081 3300037471 Bacteria 779
329 Ga0395905_1440960 3300037471 Bacteria 593
330 Ga0316581_0026247 3300037588 Bacteria 1737
331 Ga0395901_0013306 3300038443 Bacteria 8357
332 Ga0395901_0026765 3300038443 Bacteria 5921
333 Ga0395901_0072237 3300038443 Bacteria 3597
334 Ga0395901_0089425 3300038443 Bacteria 3223
335 Ga0395901_0095509 3300038443 Bacteria 3115
336 Ga0395901_0694019 3300038443 Bacteria 1016
337 Ga0395901_0860830 3300038443 Bacteria 891
338 Ga0395901_1640137 3300038443 Bacteria 596
339 Ga0395901_1699216 3300038443 Bacteria 582
340 Ga0400484_29757 3300038725 Bacteria 1961
341 Ga0400486_03983 3300038742 Bacteria 1763
342 Ga0400483_251327 3300039062 Bacteria 1173
343 Ga0436365_1053663 3300039437 Bacteria 579
344 Ga0436360_0832770 3300039438 Bacteria 888
345 Ga0436363_0036898 3300039450 Bacteria 1432
346 Ga0436362_0452855 3300039453 Bacteria 1051
347 Ga0436362_1226930 3300039453 Bacteria 1819
348 Ga0451798_1037597 3300041458 Bacteria 658
349 Ga0451853_0474052 3300041512 Bacteria 1741
350 Ga0451853_3639505 3300041512 Bacteria 511
351 Ga0439463_171203 3300042016 Bacteria 563
352 Ga0466969_0123892 3300044656 Bacteria 1202
353 Ga0466965_0692906 3300044683 Bacteria 584
354 Ga0466966_0008410 3300044684 Bacteria 6827
355 Ga0466966_0044991 3300044684 Bacteria 2823
356 Ga0466961_0103619 3300044693 Bacteria 1791
357 Ga0466961_0360402 3300044693 Archaea 884
358 Ga0466963_0008626 3300044694 Bacteria 6117
359 Ga0466963_0132572 3300044694 Bacteria 1722
360 Ga0466963_0152871 3300044694 Bacteria 1603
361 Ga0466963_0156473 3300044694 Bacteria 1585
362 Ga0466963_0530752 3300044694 Bacteria 831
363 Ga0466963_0545400 3300044694 Bacteria 819
364 Ga0466964_0002988 3300044706 Bacteria 6122
365 Ga0466964_0006486 3300044706 Bacteria 4364
366 Ga0466964_0236026 3300044706 Bacteria 895
367 Ga0466964_0426807 3300044706 Bacteria 698
368 Ga0466971_0196846 3300044719 Bacteria 950
369 Ga0466968_0233348 3300044735 Unclassified 869
370 Ga0466970_0060996 3300044765 Bacteria 2020
371 Ga0466957_0105107 3300044842 Bacteria 1784
372 Ga0466957_0264180 3300044842 Bacteria 1148
373 Ga0466957_1441055 3300044842 Bacteria 502
374 Ga0466960_0111491 3300044901 Bacteria 1422
375 Ga0466960_0801977 3300044901 Bacteria 570
376 Ga0466959_0044210 3300045049 Bacteria 3282
377 Ga0466959_0078361 3300045049 Bacteria 2383
378 Ga0466959_0318982 3300045049 Archaea 1062
379 Ga0466959_0527990 3300045049 Bacteria 797
380 Ga0466958_0018805 3300045836 Bacteria 4014
381 Ga0466958_0149672 3300045836 Bacteria 1472
382 Ga0466958_0959878 3300045836 Bacteria 558
383 Ga0466967_0010340 3300045976 Bacteria 6994
384 Ga0466967_0012620 3300045976 Bacteria 6477
385 Ga0466967_0032047 3300045976 Bacteria 4433
386 Ga0466967_0034051 3300045976 Bacteria 4319
387 Ga0466967_0044118 3300045976 Bacteria 3865
388 Ga0466967_0057855 3300045976 Bacteria 3424
389 Ga0466967_0065551 3300045976 Bacteria 3233
390 Ga0466967_0156571 3300045976 Bacteria 2135
391 Ga0466967_0188303 3300045976 Bacteria 1949
392 Ga0466967_0216122 3300045976 Bacteria 1820
393 Ga0466967_0419891 3300045976 Bacteria 1303
394 Ga0466967_1961613 3300045976 Bacteria 582
395 Ga0495592_0097804 3300046454 Bacteria 2095
396 Ga0495603_0394417 3300046455 Bacteria 793
397 Ga0495629_0288316 3300046459 Bacteria 1126
398 Ga0495641_0016828 3300046461 Bacteria 3835
399 Ga0495641_0100714 3300046461 Bacteria 1289
400 Ga0495651_0030925 3300046462 Bacteria 4175
401 Ga0495651_0171274 3300046462 Bacteria 1546
402 Ga0495580_0761772 3300046472 Bacteria 630
403 Ga0495582_0519499 3300046473 Bacteria 688
404 Ga0495607_0163347 3300046501 Bacteria 1130
405 Ga0495608_0059820 3300046511 Bacteria 2508
406 Ga0495618_0125717 3300046514 Bacteria 1642
407 Ga0495628_0247990 3300046516 Bacteria 1330
408 Ga0495628_0648092 3300046516 Bacteria 750
409 Ga0495630_0073747 3300046517 Bacteria 2570
410 Ga0495630_0078650 3300046517 Bacteria 2487
411 Ga0495630_0194624 3300046517 Bacteria 1547
412 Ga0495630_0470881 3300046517 Bacteria 963
413 Ga0495644_0147218 3300046523 Bacteria 901
414 Ga0495652_0096733 3300046529 Bacteria 2403
415 Ga0495652_0828106 3300046529 Bacteria 615
416 Ga0495665_0206430 3300046531 Bacteria 1018
417 Ga0495586_0290658 3300046535 Bacteria 936
418 Ga0495587_0500167 3300046536 Bacteria 672
419 Ga0495587_0684343 3300046536 Bacteria 563
420 Ga0495609_0202283 3300046538 Bacteria 830
421 Ga0495645_0481268 3300046543 Bacteria 779
422 Ga0495645_0889361 3300046543 Bacteria 529
423 Ga0495667_0018185 3300046559 Bacteria 4747
424 Ga0495667_0080344 3300046559 Bacteria 2120
425 Ga0495656_0033704 3300046615 Bacteria 2092
426 Ga0495656_0333984 3300046615 Bacteria 783
427 Ga0495656_0619266 3300046615 Bacteria 580
428 Ga0495635_0041535 3300046663 Bacteria 3176
429 Ga0495635_0069407 3300046663 Bacteria 2416
430 Ga0495659_0014703 3300046664 Bacteria 2567
431 Ga0495657_0019426 3300046675 Bacteria 4901
432 Ga0495657_0124226 3300046675 Bacteria 1623
433 Ga0495657_0754344 3300046675 Bacteria 558
434 Ga0495599_0064369 3300046678 Bacteria 2290
435 Ga0495599_0280386 3300046678 Bacteria 1010
436 Ga0495623_0034882 3300046679 Bacteria 3225
437 Ga0495646_0076061 3300046680 Bacteria 1967
438 Ga0495647_0443454 3300046681 Bacteria 600
439 Ga0495658_0129130 3300046683 Bacteria 1536
440 Ga0495613_0213558 3300046689 Bacteria 1356
441 Ga0495613_0380473 3300046689 Bacteria 965
442 Ga0495624_0334573 3300046690 Unclassified 911
443 Ga0495670_0369529 3300046691 Bacteria 773
444 Ga0495600_0079454 3300046809 Bacteria 2141
445 Ga0495581_0895538 3300047315 Bacteria 507
446 Ga0495604_0016420 3300047317 Bacteria 5918
447 Ga0495674_0147909 3300047319 Bacteria 1971
448 Ga0495674_1002372 3300047319 Bacteria 640
449 Ga0495676_0079305 3300047321 Bacteria 2497
450 Ga0495675_0000878 3300047444 Bacteria 18381
451 Ga0495679_131551 3300047446 Bacteria 679
452 Ga0495593_0136924 3300047673 Bacteria 1241
453 Ga0495602_0034296 3300048088 Bacteria 4750
454 Ga0495602_0730684 3300048088 Unclassified 670
455 Ga0495602_0853030 3300048088 Bacteria 609
456 Ga0496100_0001575 3300048903 Bacteria 11237
457 Ga0496101_0012361 3300048904 Bacteria 5696
458 Ga0496102_0028906 3300048905 Bacteria 4955
459 Ga0496102_0190888 3300048905 Bacteria 1930
460 Ga0496102_1871669 3300048905 Bacteria 517
461 Ga0496103_0027576 3300048906 Bacteria 3442
462 Ga0496103_0040177 3300048906 Bacteria 2875
463 Ga0496104_0106695 3300048907 Bacteria 2684
464 Ga0496104_0521011 3300048907 Bacteria 1100
465 Ga0496105_0002629 3300048908 Bacteria 13070
466 Ga0496105_0176697 3300048908 Bacteria 1749
467 Ga0496106_0046554 3300048909 Bacteria 3261
468 Ga0496107_0007782 3300048910 Bacteria 7401
469 Ga0496108_0002961 3300048911 Bacteria 13659
470 Ga0496109_0002273 3300048912 Bacteria 15968
471 Ga0496109_1350187 3300048912 Bacteria 649
472 Ga0496110_0020062 3300048913 Bacteria 5637
473 Ga0496111_0018266 3300048914 Bacteria 4856
474 Ga0496112_0021620 3300048915 Bacteria 6119
475 Ga0496112_0034838 3300048915 Bacteria 4900
476 Ga0496112_0069286 3300048915 Bacteria 3484
477 Ga0496112_0451509 3300048915 Unclassified 1223
478 Ga0496112_0566850 3300048915 Bacteria 1069
479 Ga0496112_1347531 3300048915 Bacteria 629
480 Ga0496113_0023190 3300048916 Bacteria 4400
481 Ga0496113_0043795 3300048916 Bacteria 3314
482 Ga0496113_0912415 3300048916 Bacteria 694
483 Ga0496113_1408915 3300048916 Bacteria 540
484 Ga0496114_0001536 3300048917 Bacteria 17490
485 Ga0496114_0175987 3300048917 Bacteria 1867
486 Ga0496114_0281349 3300048917 Bacteria 1467
487 Ga0496115_0002513 3300048918 Bacteria 13172
488 Ga0496115_0027148 3300048918 Bacteria 4475
489 Ga0501032_0079306 3300049569 Bacteria 2186
490 Ga0501036_0132522 3300049572 Bacteria 2103
491 Ga0501036_0326571 3300049572 Bacteria 1282
492 Ga0501037_0515612 3300049573 Bacteria 810
493 Ga0501038_0216287 3300049574 Bacteria 1531
494 Ga0501041_0442125 3300049577 Bacteria 825
495 Ga0501042_0052565 3300049578 Bacteria 2906
496 Ga0501042_0893092 3300049578 Bacteria 647
497 Ga0501047_0197494 3300049581 Bacteria 1873
498 Ga0501047_1283304 3300049581 Bacteria 546
499 Ga0501048_0281979 3300049582 Bacteria 1181
500 Ga0501048_1062854 3300049582 Unclassified 582
501 Ga0501067_0000684 3300049583 Bacteria 18236
502 Ga0501067_0002811 3300049583 Bacteria 9574
503 Ga0501069_0012725 3300049585 Bacteria 4479
504 Ga0501069_0018820 3300049585 Bacteria 3729
505 Ga0501069_0058169 3300049585 Bacteria 2156
506 Ga0501069_0609690 3300049585 Bacteria 655
507 Ga0501069_0654886 3300049585 Bacteria 632
508 Ga0501070_0000187 3300049586 Bacteria 58257
509 Ga0501070_0142723 3300049586 Bacteria 1977
510 Ga0501070_0153334 3300049586 Bacteria 1900
511 Ga0501070_0669368 3300049586 Bacteria 823
512 Ga0501071_0036022 3300049587 Bacteria 3528
513 Ga0501071_0082787 3300049587 Bacteria 2350
514 Ga0501072_0085769 3300049588 Bacteria 2498
515 Ga0501073_0616378 3300049589 Bacteria 749
516 Ga0501073_0795168 3300049589 Bacteria 652
517 Ga0501074_0175005 3300049590 Bacteria 1531
518 Ga0501074_0460738 3300049590 Bacteria 901
519 Ga0501075_0252109 3300049591 Bacteria 1345
520 Ga0501076_0009703 3300049592 Bacteria 7110
521 Ga0501076_0392152 3300049592 Bacteria 1141
522 Ga0501079_0218637 3300049741 Bacteria 1488
523 Ga0501080_0169043 3300049742 Bacteria 2017
524 Ga0501080_0530814 3300049742 Bacteria 1049
525 Ga0501080_0952958 3300049742 Bacteria 746
526 Ga0501081_0480977 3300049743 Bacteria 924
527 Ga0501035_0122951 3300049822 Bacteria 2267
528 Ga0501035_0147449 3300049822 Bacteria 2043
529 Ga0501035_0452191 3300049822 Bacteria 1062
530 Ga0501035_0804202 3300049822 Bacteria 751
531 Ga0501044_0320902 3300049823 Bacteria 1473
532 Ga0501044_1476526 3300049823 Bacteria 545
533 Ga0501045_0146858 3300049824 Bacteria 1754
534 Ga0501045_0707106 3300049824 Bacteria 743
535 nmdc:mga05p37_158265_c1 3300050507 Bacteria 2767
536 nmdc:mga05p37_370701_c1 3300050507 Bacteria 1680
537 nmdc:mga05p37_3867_c1 3300050507 Bacteria 17516
538 nmdc:mga06r32_7530_c1 3300050510 Bacteria 9790
539 nmdc:mga08y16_369514_c1 3300050511 Bacteria 1471
540 nmdc:mga08y16_913319_c1 3300050511 Unclassified 863
541 nmdc:mga0n895_50752_c1 3300050512 Bacteria 4068
542 nmdc:mga0rr50_47113_c1 3300050513 Bacteria 3178
543 nmdc:mga08x19_274270_c1 3300050514 Bacteria 1168
544 nmdc:mga08x19_647245_c1 3300050514 Bacteria 750
545 nmdc:mga0a205_11415_c1 3300050515 Bacteria 8177
546 Ga0495601_0333691 3300053077 Bacteria 987
547 Ga0495601_0582926 3300053077 Bacteria 718
548 Ga0495612_0055294 3300053078 Bacteria 1636
549 Ga0495595_0229808 3300053084 Bacteria 927
550 Ga0495619_0011353 3300053085 Bacteria 5609
551 Ga0495619_0255452 3300053085 Bacteria 1214
552 Ga0500628_177704 3300053129 Bacteria 607
553 Ga0587073_0134221 3300059492 Unclassified 683
554 Ga0501082_1098231 3300060353 Unclassified 695
555 Ga0466962_0429468 3300061719 Bacteria 664
556 Ga0466962_0752678 3300061719 Bacteria 501
557 Ga0530510_0038486 3300061734 Bacteria 3453
558 Ga0530510_0236104 3300061734 Bacteria 1361
559 Ga0530510_0825775 3300061734 Bacteria 707
560 Ga0530510_1026686 3300061734 Bacteria 631
561 Ga0466963_0016169
562 Ga0058863_11642451
563 Ga0070658_10088567
564 Ga0070658_10223935
565 Ga0070658_10512162
566 Ga0070683_100033750
567 Ga0070683_100438791
568 Ga0070683_100937180
569 Ga0070680_100034051
570 Ga0070680_100045002
571 Ga0070680_100505962
572 Ga0070680_100574793
573 Ga0070682_100026553
574 Ga0070682_100370519
575 Ga0068868_100770352
576 Ga0070660_100001690
577 Ga0070660_100022341
578 Ga0070660_100171465
579 Ga0070660_100235058
580 Ga0070660_100945481
581 Ga0070661_100021426
582 Ga0070661_100051038
583 Ga0070661_100072486
584 Ga0070674_100613938
585 Ga0070659_100018433
586 Ga0070659_100032737
587 Ga0070714_100073057
588 Ga0070714_100117315
589 Ga0070714_100162259
590 Ga0070714_100460353
591 Ga0070713_100490606
592 Ga0070710_10597148
593 Ga0070710_10894195
594 Ga0070694_100057695
595 Ga0070663_100805385
596 Ga0070662_100027007
597 Ga0070681_10001213
598 Ga0070681_10019695
599 Ga0070681_10028524
600 Ga0070681_10189420
601 Ga0070681_10214824
602 Ga0070681_10446744
603 Ga0068867_100278118
604 Ga0070706_100374361
605 Ga0070707_100604557
606 Ga0070698_100322595
607 Ga0070698_101165176
608 Ga0070679_100020490
609 Ga0070679_100064040
610 Ga0070679_100077468
611 Ga0070679_100113359
612 Ga0070679_100190685
613 Ga0070679_100720212
614 Ga0070684_100274242
615 Ga0070684_100303229
616 Ga0070684_100435665
617 Ga0070697_100552079
618 Ga0068853_100171346
619 Ga0068853_100472086
620 Ga0068853_100701082
621 Ga0068853_101045653
622 Ga0070672_100469306
623 Ga0070696_100006574
624 Ga0070696_100766128
625 Ga0070693_100268380
626 Ga0070693_100848266
627 Ga0070665_100979172
628 Ga0070665_101512256
629 Ga0070704_101940830
630 Ga0068855_100091007
631 Ga0068855_100185298
632 Ga0068855_100329495
633 Ga0068855_100353708
634 Ga0068855_101257717
635 Ga0070664_101653439
636 Ga0068857_100020406
637 Ga0068857_100557442
638 Ga0068857_100726463
639 Ga0068856_100131499
640 Ga0068856_100175260
641 Ga0068856_100281809
642 Ga0068856_101526535
643 Ga0068852_100021638
644 Ga0068852_100027110
645 Ga0068852_100628736
646 Ga0068866_10316843
647 Ga0068861_100252259
648 Ga0068851_10164646
649 Ga0068862_101254609
650 Ga0081455_10003417
651 Ga0081455_10017705
652 Ga0081538_10001394
653 Ga0081538_10002571
654 Ga0081538_10009862
655 Ga0081539_10007808
656 Ga0070717_10098754
657 Ga0070717_10388728
658 Ga0075432_10014007
659 Ga0075431_100019830
660 Ga0075431_100030146
661 Ga0075433_10029740
662 Ga0075434_100171412
663 Ga0075436_100003202
664 Ga0075436_100182910
665 Ga0075435_100010364
666 Ga0105240_10031692
667 Ga0105240_10161333
668 Ga0105240_10172948
669 Ga0105240_10378908
670 Ga0105240_10425523
671 Ga0111539_10679345
672 Ga0111539_12460027
673 Ga0105245_10065394
674 Ga0114129_10013910
675 Ga0114129_10063415
676 Ga0114129_10491828
677 Ga0105243_10326626
678 Ga0105241_10273177
679 Ga0105241_10808151
680 Ga0105237_10026541
681 Ga0105237_10292201
682 Ga0105237_10292690
683 Ga0105238_10099897
684 Ga0105238_10107271
685 Ga0105238_11418896
686 Ga0105239_10122381
687 Ga0105239_11452651
688 Ga0105239_11536767
689 Ga0157373_10083944
690 Ga0157373_10144709
691 Ga0157371_10301061
692 Ga0157371_10360904
693 Ga0157370_10078188
694 Ga0157370_10652390
695 Ga0157369_10010462
696 Ga0157369_10031545
697 Ga0157369_10069558
698 Ga0157369_10174783
699 Ga0157374_10333174
700 Ga0157378_11298164
701 Ga0163162_13114626
702 Ga0157372_10032454
703 Ga0157372_10044755
704 Ga0157372_10097095
705 Ga0157372_10112520
706 Ga0157372_10209953
707 Ga0157372_11748530
708 Ga0157372_13075497
709 Ga0182008_10040616
710 Ga0182008_10922215
711 Ga0157376_10226058
712 Ga0157376_11082971
713 Ga0197907_11004893
714 Ga0197907_11437805
715 Ga0206356_10102986
716 Ga0206356_10696300
717 Ga0206355_1163117
718 Ga0206355_1516888
719 Ga0206354_10446418
720 Ga0206354_11343095
721 Ga0206354_11470705
722 Ga0206353_10127946
723 Ga0206353_10712429
724 Ga0206353_11018008
725 Ga0206353_11205023
726 Ga0213873_10076801
727 Ga0213871_10109586
728 Ga0224712_10055919
729 Ga0207656_10408493
730 Ga0207692_10323790
731 Ga0207692_10489915
732 Ga0207688_10552356
733 Ga0207705_10030001
734 Ga0207705_10315719
735 Ga0207684_10123996
736 Ga0207654_10675305
737 Ga0207707_10002380
738 Ga0207707_10004067
739 Ga0207707_10058142
740 Ga0207707_10070612
741 Ga0207707_10628215
742 Ga0207707_11184599
743 Ga0207695_10179936
744 Ga0207695_10214133
745 Ga0207695_10215922
746 Ga0207695_10347398
747 Ga0207695_10358403
748 Ga0207695_10668717
749 Ga0207671_10048749
750 Ga0207671_10295302
751 Ga0207693_10249206
752 Ga0207663_10269976
753 Ga0207660_10005698
754 Ga0207660_10052192
755 Ga0207660_10080595
756 Ga0207657_10000941
757 Ga0207657_10015637
758 Ga0207657_10036100
759 Ga0207657_10268091
760 Ga0207657_11431844
761 Ga0207649_10011602
762 Ga0207649_10084907
763 Ga0207649_10961722
764 Ga0207652_10013345
765 Ga0207652_10015888
766 Ga0207652_10089158
767 Ga0207652_10194972
768 Ga0207652_10353530
769 Ga0207652_10415308
770 Ga0207652_10713084
771 Ga0207652_10783856
772 Ga0207646_10495842
773 Ga0207694_10425852
774 Ga0207694_11144898
775 Ga0207700_10063726
776 Ga0207700_10627164
777 Ga0207700_11711726
778 Ga0207664_10130737
779 Ga0207664_11278613
780 Ga0207644_10242666
781 Ga0207644_11049889
782 Ga0207690_10047800
783 Ga0207690_10058247
784 Ga0207690_11054060
785 Ga0207706_10098015
786 Ga0207669_10523411
787 Ga0207665_10563025
788 Ga0207665_11192258
789 Ga0207661_10373260
790 Ga0207661_11205696
791 Ga0207667_10132535
792 Ga0207667_10276298
793 Ga0207667_10682890
794 Ga0207651_10472006
795 Ga0207677_10111891
796 Ga0207639_10050133
797 Ga0207639_10766603
798 Ga0207639_11658673
799 Ga0207639_11743204
800 Ga0207678_10285869
801 Ga0207702_10056397
802 Ga0207702_10174955
803 Ga0207702_10495237
804 Ga0207648_10058328
805 Ga0207674_10011122
806 Ga0207674_10027334
807 Ga0207698_10104284
808 Ga0207698_10510112
809 Ga0207698_10594544
810 Ga0207698_11170739
811 Ga0207698_12180109
812 Ga0207428_10168586
813 Ga0268266_10130749
814 Ga0268266_10793382
815 Ga0265326_10120053
816 Ga0265334_10190745
817 Ga0265318_10203818
818 Ga0265322_10009978
819 Ga0265322_10024275
820 Ga0265336_10055131
821 Ga0265338_10008039
822 Ga0265338_10067734
823 Ga0265330_10043012
824 Ga0265332_10482780
825 Ga0265320_10418198
826 Ga0265325_10029335
827 Ga0265329_10015251
828 Ga0265340_10268325
829 Ga0265339_10028816
830 Ga0265331_10041649
831 Ga0265327_10038149
832 Ga0265316_10101442
833 Ga0307408_100577410
834 Ga0265313_10040859
835 Ga0316579_10232702
836 Ga0265314_10052842
837 Ga0265314_10092432
838 Ga0316578_10292853
839 Ga0307405_10015635
840 Ga0307405_10242742
841 Ga0316577_10004435
842 Ga0307410_10347050
843 Ga0307407_10407998
844 Ga0307412_10437436
845 Ga0307412_10873494
846 Ga0307409_100050166
847 Ga0307409_100625045
848 Ga0307416_100055497
849 Ga0307416_100119374
850 Ga0307414_10179895
851 Ga0307415_100066535
852 Ga0307415_100400549
853 Ga0373934_0315311
854 Ga0373944_0008916
855 Ga0373923_0128342
856 Ga0373936_0024762
857 Ga0373945_0035629
858 Ga0373956_0031806
859 Ga0373943_0023697
860 Ga0373946_0105424
861 Ga0373924_0306859
862 Ga0373935_0208102
863 Ga0373927_0096105
864 Ga0373947_0032833
865 Ga0373937_0072225
866 Ga0316584_0025252
867 Ga0373925_0040730
868 Ga0395899_0022780
869 Ga0395899_0103349
870 Ga0395899_0106526
871 Ga0395900_0025932
872 Ga0395900_0136023
873 Ga0395900_0244942
874 Ga0395900_0720648
875 Ga0395900_0790972
876 Ga0395900_0809482
877 Ga0395900_1181010
878 Ga0395898_0001509
879 Ga0395898_0015618
880 Ga0395898_0037016
881 Ga0395898_0057222
882 Ga0395898_0246927
883 Ga0395898_0252200
884 Ga0395898_0264044
885 Ga0395898_0332057
886 Ga0395905_0277156
887 Ga0395905_0724249
888 Ga0395905_0916081
889 Ga0395905_1440960
890 Ga0316581_0026247
891 Ga0395901_0013306
892 Ga0395901_0026765
893 Ga0395901_0072237
894 Ga0395901_0089425
895 Ga0395901_0095509
896 Ga0395901_0694019
897 Ga0395901_0860830
898 Ga0395901_1640137
899 Ga0395901_1699216
900 Ga0400484_29757
901 Ga0400486_03983
902 Ga0400483_251327
903 Ga0436365_1053663
904 Ga0436360_0832770
905 Ga0436363_0036898
906 Ga0436362_0452855
907 Ga0436362_1226930
908 Ga0451798_1037597
909 Ga0451853_0474052
910 Ga0451853_3639505
911 Ga0439463_171203
912 Ga0466969_0123892
913 Ga0466965_0692906
914 Ga0466966_0008410
915 Ga0466966_0044991
916 Ga0466961_0103619
917 Ga0466961_0360402
918 Ga0466963_0008626
919 Ga0466963_0132572
920 Ga0466963_0152871
921 Ga0466963_0156473
922 Ga0466963_0530752
923 Ga0466963_0545400
924 Ga0466964_0002988
925 Ga0466964_0006486
926 Ga0466964_0236026
927 Ga0466964_0426807
928 Ga0466971_0196846
929 Ga0466968_0233348
930 Ga0466970_0060996
931 Ga0466957_0105107
932 Ga0466957_0264180
933 Ga0466957_1441055
934 Ga0466960_0111491
935 Ga0466960_0801977
936 Ga0466959_0044210
937 Ga0466959_0078361
938 Ga0466959_0318982
939 Ga0466959_0527990
940 Ga0466958_0018805
941 Ga0466958_0149672
942 Ga0466958_0959878
943 Ga0466967_0010340
944 Ga0466967_0012620
945 Ga0466967_0032047
946 Ga0466967_0034051
947 Ga0466967_0044118
948 Ga0466967_0057855
949 Ga0466967_0065551
950 Ga0466967_0156571
951 Ga0466967_0188303
952 Ga0466967_0216122
953 Ga0466967_0419891
954 Ga0466967_1961613
955 Ga0495592_0097804
956 Ga0495603_0394417
957 Ga0495629_0288316
958 Ga0495641_0016828
959 Ga0495641_0100714
960 Ga0495651_0030925
961 Ga0495651_0171274
962 Ga0495580_0761772
963 Ga0495582_0519499
964 Ga0495607_0163347
965 Ga0495608_0059820
966 Ga0495618_0125717
967 Ga0495628_0247990
968 Ga0495628_0648092
969 Ga0495630_0073747
970 Ga0495630_0078650
971 Ga0495630_0194624
972 Ga0495630_0470881
973 Ga0495644_0147218
974 Ga0495652_0096733
975 Ga0495652_0828106
976 Ga0495665_0206430
977 Ga0495586_0290658
978 Ga0495587_0500167
979 Ga0495587_0684343
980 Ga0495609_0202283
981 Ga0495645_0481268
982 Ga0495645_0889361
983 Ga0495667_0018185
984 Ga0495667_0080344
985 Ga0495656_0033704
986 Ga0495656_0333984
987 Ga0495656_0619266
988 Ga0495635_0041535
989 Ga0495635_0069407
990 Ga0495659_0014703
991 Ga0495657_0019426
992 Ga0495657_0124226
993 Ga0495657_0754344
994 Ga0495599_0064369
995 Ga0495599_0280386
996 Ga0495623_0034882
997 Ga0495646_0076061
998 Ga0495647_0443454
999 Ga0495658_0129130
1000 Ga0495613_0213558
1001 Ga0495613_0380473
1002 Ga0495624_0334573
1003 Ga0495670_0369529
1004 Ga0495600_0079454
1005 Ga0495581_0895538
1006 Ga0495604_0016420
1007 Ga0495674_0147909
1008 Ga0495674_1002372
1009 Ga0495676_0079305
1010 Ga0495675_0000878
1011 Ga0495679_131551
1012 Ga0495593_0136924
1013 Ga0495602_0034296
1014 Ga0495602_0730684
1015 Ga0495602_0853030
1016 Ga0496100_0001575
1017 Ga0496101_0012361
1018 Ga0496102_0028906
1019 Ga0496102_0190888
1020 Ga0496102_1871669
1021 Ga0496103_0027576
1022 Ga0496103_0040177
1023 Ga0496104_0106695
1024 Ga0496104_0521011
1025 Ga0496105_0002629
1026 Ga0496105_0176697
1027 Ga0496106_0046554
1028 Ga0496107_0007782
1029 Ga0496108_0002961
1030 Ga0496109_0002273
1031 Ga0496109_1350187
1032 Ga0496110_0020062
1033 Ga0496111_0018266
1034 Ga0496112_0021620
1035 Ga0496112_0034838
1036 Ga0496112_0069286
1037 Ga0496112_0451509
1038 Ga0496112_0566850
1039 Ga0496112_1347531
1040 Ga0496113_0023190
1041 Ga0496113_0043795
1042 Ga0496113_0912415
1043 Ga0496113_1408915
1044 Ga0496114_0001536
1045 Ga0496114_0175987
1046 Ga0496114_0281349
1047 Ga0496115_0002513
1048 Ga0496115_0027148
1049 Ga0501032_0079306
1050 Ga0501036_0132522
1051 Ga0501036_0326571
1052 Ga0501037_0515612
1053 Ga0501038_0216287
1054 Ga0501041_0442125
1055 Ga0501042_0052565
1056 Ga0501042_0893092
1057 Ga0501047_0197494
1058 Ga0501047_1283304
1059 Ga0501048_0281979
1060 Ga0501048_1062854
1061 Ga0501067_0000684
1062 Ga0501067_0002811
1063 Ga0501069_0012725
1064 Ga0501069_0018820
1065 Ga0501069_0058169
1066 Ga0501069_0609690
1067 Ga0501069_0654886
1068 Ga0501070_0000187
1069 Ga0501070_0142723
1070 Ga0501070_0153334
1071 Ga0501070_0669368
1072 Ga0501071_0036022
1073 Ga0501071_0082787
1074 Ga0501072_0085769
1075 Ga0501073_0616378
1076 Ga0501073_0795168
1077 Ga0501074_0175005
1078 Ga0501074_0460738
1079 Ga0501075_0252109
1080 Ga0501076_0009703
1081 Ga0501076_0392152
1082 Ga0501079_0218637
1083 Ga0501080_0169043
1084 Ga0501080_0530814
1085 Ga0501080_0952958
1086 Ga0501081_0480977
1087 Ga0501035_0122951
1088 Ga0501035_0147449
1089 Ga0501035_0452191
1090 Ga0501035_0804202
1091 Ga0501044_0320902
1092 Ga0501044_1476526
1093 Ga0501045_0146858
1094 Ga0501045_0707106
1095 nmdc:mga05p37_158265_c1
1096 nmdc:mga05p37_370701_c1
1097 nmdc:mga05p37_3867_c1
1098 nmdc:mga06r32_7530_c1
1099 nmdc:mga08y16_369514_c1
1100 nmdc:mga08y16_913319_c1
1101 nmdc:mga0n895_50752_c1
1102 nmdc:mga0rr50_47113_c1
1103 nmdc:mga08x19_274270_c1
1104 nmdc:mga08x19_647245_c1
1105 nmdc:mga0a205_11415_c1
1106 Ga0495601_0333691
1107 Ga0495601_0582926
1108 Ga0495612_0055294
1109 Ga0495595_0229808
1110 Ga0495619_0011353
1111 Ga0495619_0255452
1112 Ga0500628_177704
1113 Ga0587073_0134221
1114 Ga0501082_1098231
1115 Ga0466962_0429468
1116 Ga0466962_0752678
1117 Ga0530510_0038486
1118 Ga0530510_0236104
1119 Ga0530510_0825775
1120 Ga0530510_1026686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

22

141

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.981 4 127
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9788 4 128
1x25-assembly2.cif.gz_B crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811) 0.9768 3 127
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9759 2 127
1oni-assembly2.cif.gz_D crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family 0.9758 2 127
ID Description Score Start End Superfamily
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9769 2 127 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9711 21 128 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9683 2 127 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9674 4 128 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9635 1 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A538L8Q5-F1-model_v4 RidA family protein 0.9981 2 128 GO:0005829
GO:0019239
AF-A0A7V9SBW6-F1-model_v4 RidA family protein 0.9857 2 127 GO:0005829
GO:0019239
AF-A0A7C4N7C6-F1-model_v4 RidA family protein 0.9856 2 128 GO:0005829
GO:0019239
AF-A0A2V7H642-F1-model_v4 Deaminase 0.9847 2 127 GO:0005829
GO:0019239
AF-A0A7C7LN84-F1-model_v4 RidA family protein 0.9846 2 126 GO:0005829
GO:0019239

Map