F463665

General Info

Members Datasets Scaffolds Average Seq Length
560 223 1120 279

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10152405|Ga0075433_101524052
Length 297
Sequence MAIRSPFRLGPHGPRSGPGPRPPLLEEALGPGGPIIVLDQVSLAFDEKVILREISFTLKTGHTKIFLGASGAGKSTILRLILGLLKPDGGRIFVNGERVDDMSEDDLMRVRGDLGMVFQEGALFDSLTVRENVGYKLFEETDIPLEEVDRRVKEVLGFVGLAEFIDRMPSELSGGQRRRVAIARAMTAKPRILLYDEPTTGLDPITSLTIDEEIIKLRDLESVSSIVVTHQLRDAFFVAEHTAVRANGQLEFEKADPQKADEAEFIMLRDGAIAFEGNASELRAAAAKDQYLHAFLS

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.29
Nodule 0
Rhizoplane 2.86
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10152405 3300006852 Bacteria 2056
2 JGI24743J22301_10007993 3300001991 Bacteria 1846
3 Ga0065712_10001261 3300005290 Bacteria 7730
4 Ga0065712_10005947 3300005290 Bacteria 3035
5 Ga0065712_10068771 3300005290 Bacteria 9068
6 Ga0065712_10127498 3300005290 Bacteria 1589
7 Ga0065715_10006578 3300005293 Bacteria 5127
8 Ga0065715_10011218 3300005293 Bacteria 3824
9 Ga0065715_10102236 3300005293 Bacteria 3133
10 Ga0065715_10110068 3300005293 Bacteria 2637
11 Ga0065715_10110545 3300005293 Bacteria 2615
12 Ga0065715_10129863 3300005293 Bacteria 2036
13 Ga0065715_10132932 3300005293 Bacteria 1981
14 Ga0065715_10139912 3300005293 Bacteria 1869
15 Ga0065715_10209213 3300005293 Bacteria 1322
16 Ga0065715_10306705 3300005293 Bacteria 1025
17 Ga0065707_10001103 3300005295 Bacteria 7995
18 Ga0065707_10092306 3300005295 Bacteria 3790
19 Ga0065707_10244532 3300005295 Bacteria 1143
20 Ga0070683_100025255 3300005329 Bacteria 5333
21 Ga0070683_100036014 3300005329 Bacteria 4527
22 Ga0070683_100372422 3300005329 Bacteria 1360
23 Ga0070670_100013022 3300005331 Bacteria 7125
24 Ga0070670_100016157 3300005331 Bacteria 6406
25 Ga0070670_100021123 3300005331 Bacteria 5599
26 Ga0070670_100036919 3300005331 Bacteria 4204
27 Ga0070670_100129115 3300005331 Bacteria 2182
28 Ga0070670_100296209 3300005331 Bacteria 1414
29 Ga0068869_100100216 3300005334 Bacteria 2190
30 Ga0068869_100445826 3300005334 Bacteria 1072
31 Ga0070666_10177130 3300005335 Bacteria 1495
32 Ga0070666_10262339 3300005335 Bacteria 1225
33 Ga0070680_100158141 3300005336 Bacteria 1904
34 Ga0070682_100141566 3300005337 Bacteria 1640
35 Ga0068868_100029658 3300005338 Bacteria 4191
36 Ga0070660_100092874 3300005339 Bacteria 2382
37 Ga0070689_100112700 3300005340 Bacteria 2165
38 Ga0070687_100013680 3300005343 Bacteria 3623
39 Ga0070661_100032041 3300005344 Bacteria 3803
40 Ga0070668_100073152 3300005347 Bacteria 2672
41 Ga0070669_100003984 3300005353 Bacteria 10680
42 Ga0070669_100284128 3300005353 Bacteria 1327
43 Ga0070675_100060549 3300005354 Bacteria 3126
44 Ga0070675_100068997 3300005354 Bacteria 2928
45 Ga0070675_100087524 3300005354 Bacteria 2605
46 Ga0070675_100130006 3300005354 Bacteria 2145
47 Ga0070675_100300561 3300005354 Bacteria 1414
48 Ga0070675_100690783 3300005354 Bacteria 929
49 Ga0070671_100012298 3300005355 Bacteria 6890
50 Ga0070674_100053151 3300005356 Bacteria 2795
51 Ga0070674_100173531 3300005356 Bacteria 1646
52 Ga0070674_100325274 3300005356 Bacteria 1234
53 Ga0070673_100448593 3300005364 Bacteria 1160
54 Ga0070688_100059781 3300005365 Bacteria 2405
55 Ga0070659_100082458 3300005366 Bacteria 2569
56 Ga0070667_100042492 3300005367 Bacteria 3814
57 Ga0070667_100075166 3300005367 Bacteria 2884
58 Ga0070667_100144013 3300005367 Bacteria 2089
59 Ga0070667_100617160 3300005367 Bacteria 1000
60 Ga0070713_100010331 3300005436 Bacteria 6743
61 Ga0070701_10004391 3300005438 Bacteria 5702
62 Ga0070701_10120218 3300005438 Bacteria 1479
63 Ga0070700_100073078 3300005441 Bacteria 2194
64 Ga0070708_100169252 3300005445 Bacteria 2039
65 Ga0070708_100594742 3300005445 Bacteria 1043
66 Ga0070663_100295587 3300005455 Bacteria 1295
67 Ga0070663_100376279 3300005455 Bacteria 1155
68 Ga0070678_100103309 3300005456 Bacteria 2214
69 Ga0070678_100234919 3300005456 Bacteria 1530
70 Ga0070662_100206157 3300005457 Bacteria 1562
71 Ga0068867_100035372 3300005459 Bacteria 3622
72 Ga0070685_10204892 3300005466 Bacteria 1284
73 Ga0070706_100301920 3300005467 Bacteria 1494
74 Ga0070699_100039918 3300005518 Bacteria 4065
75 Ga0070679_100119869 3300005530 Bacteria 2616
76 Ga0070684_100000667 3300005535 Bacteria 23730
77 Ga0068853_100248049 3300005539 Unclassified 1633
78 Ga0068853_100463383 3300005539 Bacteria 1193
79 Ga0070665_100507779 3300005548 Bacteria 1217
80 Ga0070664_100003266 3300005564 Bacteria 13100
81 Ga0070664_100021712 3300005564 Bacteria 5295
82 Ga0070664_100047545 3300005564 Bacteria 3625
83 Ga0070664_100109358 3300005564 Bacteria 2411
84 Ga0070664_100130873 3300005564 Bacteria 2204
85 Ga0070664_100263404 3300005564 Bacteria 1551
86 Ga0070664_100688543 3300005564 Bacteria 952
87 Ga0070664_100767312 3300005564 Bacteria 901
88 Ga0068857_100450522 3300005577 Bacteria 1203
89 Ga0068854_100022317 3300005578 Bacteria 4309
90 Ga0068852_100264749 3300005616 Bacteria 1652
91 Ga0068859_100024255 3300005617 Bacteria 6086
92 Ga0068859_100375367 3300005617 Bacteria 1517
93 Ga0068859_100452618 3300005617 Bacteria 1380
94 Ga0068859_100682145 3300005617 Bacteria 1119
95 Ga0068864_100022530 3300005618 Bacteria 5282
96 Ga0068864_100274330 3300005618 Bacteria 1572
97 Ga0068861_100285998 3300005719 Bacteria 1422
98 Ga0068861_100470645 3300005719 Bacteria 1130
99 Ga0068851_10250928 3300005834 Bacteria 1004
100 Ga0068870_10050385 3300005840 Bacteria 2200
101 Ga0068870_10225230 3300005840 Bacteria 1150
102 Ga0068860_100090992 3300005843 Bacteria 2906
103 Ga0068862_100005656 3300005844 Bacteria 10431
104 Ga0081455_10114928 3300005937 Bacteria 2131
105 Ga0081538_10000009 3300005981 Bacteria 172017
106 Ga0081539_10019832 3300005985 Bacteria 4580
107 Ga0075365_10046005 3300006038 Bacteria 2865
108 Ga0075365_10110700 3300006038 Bacteria 1887
109 Ga0075365_10133582 3300006038 Bacteria 1718
110 Ga0075365_10169427 3300006038 Bacteria 1524
111 Ga0075368_10005380 3300006042 Bacteria 4400
112 Ga0075368_10029903 3300006042 Bacteria 2108
113 Ga0075368_10043632 3300006042 Bacteria 1767
114 Ga0075363_100205173 3300006048 Bacteria 1127
115 Ga0075364_10009642 3300006051 Bacteria 5801
116 Ga0075364_10010391 3300006051 Bacteria 5622
117 Ga0075364_10039105 3300006051 Bacteria 3074
118 Ga0075364_10068391 3300006051 Bacteria 2336
119 Ga0075364_10069819 3300006051 Bacteria 2312
120 Ga0075364_10170144 3300006051 Bacteria 1473
121 Ga0075362_10009695 3300006177 Bacteria 3734
122 Ga0075367_10009369 3300006178 Bacteria 5115
123 Ga0075367_10013762 3300006178 Bacteria 4362
124 Ga0075367_10022693 3300006178 Bacteria 3523
125 Ga0075367_10042448 3300006178 Bacteria 2661
126 Ga0075367_10093521 3300006178 Bacteria 1831
127 Ga0075366_10006239 3300006195 Bacteria 6514
128 Ga0075366_10016292 3300006195 Bacteria 4270
129 Ga0075366_10027608 3300006195 Bacteria 3331
130 Ga0075366_10056844 3300006195 Bacteria 2325
131 Ga0075366_10065039 3300006195 Bacteria 2169
132 Ga0075366_10065367 3300006195 Bacteria 2163
133 Ga0097621_100353180 3300006237 Bacteria 1308
134 Ga0075370_10000604 3300006353 Bacteria 13867
135 Ga0075370_10026538 3300006353 Bacteria 3209
136 Ga0075370_10054163 3300006353 Bacteria 2277
137 Ga0068871_100016573 3300006358 Bacteria 5554
138 Ga0075428_100001152 3300006844 Bacteria 28258
139 Ga0075428_100005960 3300006844 Bacteria 13542
140 Ga0075428_100006071 3300006844 Bacteria 13429
141 Ga0075428_100006815 3300006844 Bacteria 12709
142 Ga0075428_100009372 3300006844 Bacteria 10860
143 Ga0075428_100011336 3300006844 Bacteria 9919
144 Ga0075428_100532740 3300006844 Bacteria 1256
145 Ga0075428_100601790 3300006844 Bacteria 1174
146 Ga0075430_100003980 3300006846 Bacteria 12461
147 Ga0075430_100008296 3300006846 Bacteria 8773
148 Ga0075430_100011679 3300006846 Bacteria 7474
149 Ga0075430_100043012 3300006846 Bacteria 3819
150 Ga0075431_100003517 3300006847 Bacteria 15177
151 Ga0075431_100017814 3300006847 Bacteria 7221
152 Ga0075431_100021425 3300006847 Bacteria 6610
153 Ga0075431_100059163 3300006847 Bacteria 3955
154 Ga0075431_100059738 3300006847 Bacteria 3934
155 Ga0075431_100147623 3300006847 Unclassified 2423
156 Ga0075431_100619196 3300006847 Bacteria 1065
157 Ga0075433_10021512 3300006852 Bacteria 5409
158 Ga0075433_10049855 3300006852 Bacteria 3643
159 Ga0075433_10118500 3300006852 Unclassified 2350
160 Ga0075434_100010872 3300006871 Bacteria 8557
161 Ga0075434_100171859 3300006871 Bacteria 2187
162 Ga0075434_100273992 3300006871 Bacteria 1707
163 Ga0075429_100001876 3300006880 Bacteria 17415
164 Ga0075429_100028263 3300006880 Bacteria 4870
165 Ga0075429_100049419 3300006880 Bacteria 3657
166 Ga0075429_100070831 3300006880 Bacteria 3036
167 Ga0075429_100114161 3300006880 Bacteria 2361
168 Ga0075429_100280941 3300006880 Bacteria 1458
169 Ga0075429_100311953 3300006880 Bacteria 1377
170 Ga0068865_100186963 3300006881 Bacteria 1599
171 Ga0097620_100024256 3300006931 Bacteria 6086
172 Ga0097620_100375389 3300006931 Bacteria 1517
173 Ga0097620_100452607 3300006931 Bacteria 1380
174 Ga0097620_100682162 3300006931 Bacteria 1119
175 Ga0075435_100060026 3300007076 Bacteria 3083
176 Ga0075435_100394542 3300007076 Bacteria 1190
177 Ga0075435_100420400 3300007076 Bacteria 1151
178 Ga0105240_10074129 3300009093 Bacteria 4202
179 Ga0105240_10107878 3300009093 Bacteria 3375
180 Ga0111539_10000245 3300009094 Bacteria 65047
181 Ga0111539_10000335 3300009094 Bacteria 57807
182 Ga0111539_10012022 3300009094 Bacteria 10855
183 Ga0111539_10038610 3300009094 Bacteria 5761
184 Ga0111539_10051031 3300009094 Bacteria 4927
185 Ga0111539_10057966 3300009094 Bacteria 4596
186 Ga0111539_10111905 3300009094 Bacteria 3203
187 Ga0111539_10140982 3300009094 Bacteria 2822
188 Ga0111539_10203607 3300009094 Bacteria 2307
189 Ga0111539_10286187 3300009094 Bacteria 1918
190 Ga0111539_10405902 3300009094 Bacteria 1587
191 Ga0111539_10442549 3300009094 Bacteria 1513
192 Ga0111539_10492061 3300009094 Bacteria 1428
193 Ga0111539_10730465 3300009094 Bacteria 1153
194 Ga0111539_10896736 3300009094 Bacteria 1031
195 Ga0105245_10054107 3300009098 Bacteria 3604
196 Ga0105245_10160027 3300009098 Bacteria 2136
197 Ga0105247_10042190 3300009101 Bacteria 2793
198 Ga0114129_10001599 3300009147 Bacteria 30786
199 Ga0114129_10001632 3300009147 Bacteria 30462
200 Ga0114129_10004319 3300009147 Bacteria 20097
201 Ga0114129_10004642 3300009147 Bacteria 19389
202 Ga0114129_10006985 3300009147 Bacteria 16068
203 Ga0114129_10013863 3300009147 Bacteria 11485
204 Ga0114129_10020054 3300009147 Bacteria 9514
205 Ga0114129_10070670 3300009147 Bacteria 4867
206 Ga0114129_10099353 3300009147 Bacteria 4028
207 Ga0114129_10108264 3300009147 Bacteria 3837
208 Ga0114129_10289318 3300009147 Bacteria 2187
209 Ga0114129_10530416 3300009147 Bacteria 1534
210 Ga0105242_10746993 3300009176 Bacteria 963
211 Ga0105242_10863031 3300009176 Bacteria 902
212 Ga0105248_10037736 3300009177 Bacteria 5406
213 Ga0105248_10044446 3300009177 Bacteria 4981
214 Ga0105248_10055801 3300009177 Bacteria 4432
215 Ga0105248_10083856 3300009177 Bacteria 3585
216 Ga0105249_10000497 3300009553 Bacteria 36352
217 Ga0105249_10440999 3300009553 Bacteria 1339
218 Ga0105249_10515993 3300009553 Bacteria 1242
219 Ga0105249_10662708 3300009553 Bacteria 1102
220 Ga0105246_10374010 3300011119 Bacteria 1175
221 Ga0157374_10160474 3300013296 Bacteria 2189
222 Ga0157374_10251296 3300013296 Bacteria 1740
223 Ga0157374_10289991 3300013296 Bacteria 1617
224 Ga0163163_10024444 3300014325 Bacteria 5750
225 Ga0163163_10084297 3300014325 Bacteria 3184
226 Ga0157380_10011173 3300014326 Bacteria 6481
227 Ga0157380_10027839 3300014326 Bacteria 4303
228 Ga0157376_10301105 3300014969 Bacteria 1518
229 Ga0157376_10375814 3300014969 Bacteria 1367
230 Ga0163161_10449646 3300017792 Bacteria 1041
231 Ga0207697_10003836 3300025315 Bacteria 7340
232 Ga0207697_10018221 3300025315 Bacteria 2880
233 Ga0207688_10001110 3300025901 Bacteria 13814
234 Ga0207680_10102522 3300025903 Bacteria 1841
235 Ga0207680_10334157 3300025903 Bacteria 1062
236 Ga0207680_10351163 3300025903 Bacteria 1036
237 Ga0207643_10055962 3300025908 Bacteria 2243
238 Ga0207643_10165682 3300025908 Bacteria 1331
239 Ga0207684_10201973 3300025910 Bacteria 1715
240 Ga0207654_10246670 3300025911 Bacteria 1195
241 Ga0207707_10130416 3300025912 Bacteria 2199
242 Ga0207695_10201020 3300025913 Bacteria 1907
243 Ga0207660_10257799 3300025917 Bacteria 1378
244 Ga0207662_10010445 3300025918 Bacteria 5127
245 Ga0207657_10059892 3300025919 Bacteria 3269
246 Ga0207649_10028984 3300025920 Bacteria 3266
247 Ga0207649_10114588 3300025920 Bacteria 1807
248 Ga0207652_10065530 3300025921 Bacteria 3146
249 Ga0207646_10566688 3300025922 Bacteria 1020
250 Ga0207681_10002225 3300025923 Bacteria 12340
251 Ga0207650_10009862 3300025925 Bacteria 6533
252 Ga0207650_10051498 3300025925 Bacteria 3047
253 Ga0207650_10084926 3300025925 Bacteria 2407
254 Ga0207650_10088504 3300025925 Bacteria 2361
255 Ga0207650_10177806 3300025925 Bacteria 1695
256 Ga0207650_10511447 3300025925 Bacteria 1004
257 Ga0207659_10353286 3300025926 Bacteria 1220
258 Ga0207687_10274571 3300025927 Bacteria 1349
259 Ga0207706_10078261 3300025933 Bacteria 2908
260 Ga0207706_10367890 3300025933 Bacteria 1249
261 Ga0207709_10215937 3300025935 Unclassified 1380
262 Ga0207670_10065523 3300025936 Bacteria 2493
263 Ga0207669_10125410 3300025937 Bacteria 1753
264 Ga0207669_10181492 3300025937 Bacteria 1509
265 Ga0207704_10130218 3300025938 Bacteria 1741
266 Ga0207691_10039313 3300025940 Bacteria 4376
267 Ga0207661_10004326 3300025944 Bacteria 9937
268 Ga0207661_10228912 3300025944 Bacteria 1645
269 Ga0207679_10009669 3300025945 Bacteria 6182
270 Ga0207679_10027006 3300025945 Bacteria 3965
271 Ga0207679_10029646 3300025945 Bacteria 3812
272 Ga0207679_10162087 3300025945 Bacteria 1832
273 Ga0207679_10274714 3300025945 Bacteria 1443
274 Ga0207651_10082717 3300025960 Bacteria 2319
275 Ga0207712_10017191 3300025961 Bacteria 4694
276 Ga0207712_10350560 3300025961 Bacteria 1227
277 Ga0207712_10441159 3300025961 Bacteria 1102
278 Ga0207668_10053473 3300025972 Bacteria 2799
279 Ga0207658_10187933 3300025986 Bacteria 1715
280 Ga0207658_10192502 3300025986 Bacteria 1696
281 Ga0207658_10249450 3300025986 Bacteria 1508
282 Ga0207678_10050645 3300026067 Bacteria 3587
283 Ga0207678_10102239 3300026067 Bacteria 2446
284 Ga0207678_10171528 3300026067 Bacteria 1852
285 Ga0207708_10037368 3300026075 Bacteria 3700
286 Ga0207708_10042027 3300026075 Bacteria 3485
287 Ga0207708_10194728 3300026075 Bacteria 1615
288 Ga0207648_10005197 3300026089 Bacteria 13181
289 Ga0207648_10338338 3300026089 Bacteria 1355
290 Ga0207676_10070507 3300026095 Bacteria 2803
291 Ga0207676_10080692 3300026095 Bacteria 2641
292 Ga0207676_10125044 3300026095 Bacteria 2176
293 Ga0207676_10246117 3300026095 Bacteria 1607
294 Ga0207674_10023809 3300026116 Bacteria 6553
295 Ga0207675_100187558 3300026118 Bacteria 1983
296 Ga0209998_10041731 3300027717 Bacteria 1043
297 Ga0209813_10009185 3300027866 Bacteria 2521
298 Ga0209813_10024438 3300027866 Bacteria 1728
299 Ga0207428_10000502 3300027907 Bacteria 46709
300 Ga0207428_10005001 3300027907 Bacteria 12463
301 Ga0207428_10005394 3300027907 Bacteria 11926
302 Ga0207428_10033918 3300027907 Bacteria 4186
303 Ga0207428_10169583 3300027907 Unclassified 1653
304 Ga0207428_10358765 3300027907 Bacteria 1072
305 Ga0268266_10062316 3300028379 Bacteria 3218
306 Ga0268266_10437200 3300028379 Bacteria 1242
307 Ga0268265_10009837 3300028380 Bacteria 6455
308 Ga0307408_100011527 3300031548 Bacteria 5840
309 Ga0307408_100020021 3300031548 Bacteria 4510
310 Ga0307408_100075989 3300031548 Bacteria 2497
311 Ga0307408_100165383 3300031548 Bacteria 1761
312 Ga0307408_100174749 3300031548 Bacteria 1718
313 Ga0307408_100306119 3300031548 Bacteria 1333
314 Ga0307405_10136337 3300031731 Bacteria 1704
315 Ga0307405_10201087 3300031731 Bacteria 1447
316 Ga0307413_10081220 3300031824 Bacteria 2078
317 Ga0307413_10212335 3300031824 Bacteria 1407
318 Ga0307413_10308826 3300031824 Bacteria 1203
319 Ga0307410_10041835 3300031852 Bacteria 3024
320 Ga0307410_10082975 3300031852 Bacteria 2255
321 Ga0307410_10153306 3300031852 Bacteria 1718
322 Ga0307410_10181635 3300031852 Bacteria 1593
323 Ga0307410_10494741 3300031852 Bacteria 1005
324 Ga0307406_10081643 3300031901 Bacteria 2150
325 Ga0307406_10136215 3300031901 Bacteria 1731
326 Ga0307406_10146324 3300031901 Bacteria 1680
327 Ga0307406_10311835 3300031901 Bacteria 1213
328 Ga0307407_10039127 3300031903 Bacteria 2635
329 Ga0307412_10005411 3300031911 Bacteria 7165
330 Ga0307412_10157131 3300031911 Bacteria 1685
331 Ga0307412_10237421 3300031911 Bacteria 1408
332 Ga0307412_10368136 3300031911 Bacteria 1159
333 Ga0307409_100002371 3300031995 Bacteria 9804
334 Ga0307409_100008338 3300031995 Bacteria 6282
335 Ga0307409_100045214 3300031995 Bacteria 3322
336 Ga0307409_100050102 3300031995 Bacteria 3187
337 Ga0307409_100222569 3300031995 Unclassified 1705
338 Ga0307409_100232973 3300031995 Bacteria 1671
339 Ga0307416_100009635 3300032002 Bacteria 6336
340 Ga0307416_100013606 3300032002 Bacteria 5539
341 Ga0307416_100051254 3300032002 Bacteria 3295
342 Ga0307416_100104428 3300032002 Bacteria 2477
343 Ga0307416_100116224 3300032002 Bacteria 2371
344 Ga0307416_100382657 3300032002 Bacteria 1438
345 Ga0307414_10001901 3300032004 Bacteria 10804
346 Ga0307414_10210759 3300032004 Bacteria 1588
347 Ga0307411_10018884 3300032005 Bacteria 3968
348 Ga0307411_10066374 3300032005 Bacteria 2424
349 Ga0307411_10069396 3300032005 Bacteria 2380
350 Ga0307411_10084578 3300032005 Bacteria 2195
351 Ga0307411_10096856 3300032005 Bacteria 2075
352 Ga0307411_10098253 3300032005 Bacteria 2063
353 Ga0307411_10207353 3300032005 Bacteria 1510
354 Ga0307415_100018496 3300032126 Bacteria 4210
355 Ga0307415_100510147 3300032126 Bacteria 1053
356 Ga0307415_100533622 3300032126 Bacteria 1032
357 Ga0373935_0407022 3300035692 Bacteria 978
358 Ga0373937_0003124 3300036401 Bacteria 13859
359 Ga0373925_0020528 3300037068 Bacteria 4810
360 Ga0436365_0997585 3300039437 Bacteria 1628
361 Ga0439461_0024767 3300041410 Unclassified 1215
362 Ga0451853_2232392 3300041512 Bacteria 2443
363 Ga0451853_2889744 3300041512 Bacteria 1164
364 Ga0439449_0097719 3300042007 Bacteria 1085
365 Ga0439456_047627 3300042013 Bacteria 935
366 Ga0450920_019181 3300042122 Bacteria 1313
367 Ga0450923_023940 3300042125 Bacteria 1208
368 Ga0439446_0037160 3300042156 Bacteria 1425
369 Ga0450908_005070 3300042184 Bacteria 2526
370 Ga0439435_0035156 3300042436 Bacteria 1380
371 Ga0439464_0009217 3300042439 Bacteria 2595
372 Ga0439464_0015977 3300042439 Bacteria 2028
373 Ga0450918_012104 3300042531 Bacteria 1504
374 Ga0451576_0103871 3300045051 Bacteria 2956
375 Ga0495592_0169502 3300046454 Bacteria 1496
376 Ga0495603_0094890 3300046455 Bacteria 1743
377 Ga0495594_0043298 3300046499 Bacteria 2468
378 Ga0495594_0134432 3300046499 Bacteria 1401
379 Ga0495608_0032432 3300046511 Bacteria 3531
380 Ga0495608_0219012 3300046511 Bacteria 1195
381 Ga0495628_0098701 3300046516 Bacteria 2256
382 Ga0495643_0011562 3300046522 Bacteria 5368
383 Ga0495652_0271633 3300046529 Bacteria 1246
384 Ga0495658_0167104 3300046683 Bacteria 1360
385 Ga0495613_0055960 3300046689 Bacteria 2897
386 Ga0495670_0219823 3300046691 Unclassified 1009
387 Ga0496100_0535728 3300048903 Bacteria 905
388 Ga0496104_0015776 3300048907 Bacteria 6852
389 Ga0496104_0360717 3300048907 Bacteria 1366
390 Ga0496105_0037625 3300048908 Bacteria 3985
391 Ga0496106_0048506 3300048909 Bacteria 3198
392 Ga0496106_0181118 3300048909 Bacteria 1673
393 Ga0496108_0007540 3300048911 Bacteria 8818
394 Ga0496108_0452304 3300048911 Bacteria 1122
395 Ga0496108_0495812 3300048911 Bacteria 1067
396 Ga0496109_0003491 3300048912 Bacteria 13133
397 Ga0496109_0177474 3300048912 Bacteria 2000
398 Ga0496110_0009444 3300048913 Bacteria 7899
399 Ga0496111_0043166 3300048914 Bacteria 3240
400 Ga0496112_0011168 3300048915 Bacteria 8189
401 Ga0496112_0079577 3300048915 Bacteria 3242
402 Ga0496112_0347921 3300048915 Bacteria 1425
403 Ga0501031_0311255 3300049568 Bacteria 1020
404 Ga0501034_0037229 3300049571 Bacteria 4926
405 Ga0501036_0114326 3300049572 Bacteria 2281
406 Ga0501036_0178096 3300049572 Bacteria 1790
407 Ga0501039_0030038 3300049575 Bacteria 4188
408 Ga0501039_0038106 3300049575 Bacteria 3714
409 Ga0501039_0057855 3300049575 Bacteria 3002
410 Ga0501039_0167231 3300049575 Bacteria 1729
411 Ga0501040_0047602 3300049576 Bacteria 2928
412 Ga0501040_0093939 3300049576 Bacteria 2086
413 Ga0501041_0369492 3300049577 Bacteria 907
414 Ga0501042_0070039 3300049578 Bacteria 2509
415 Ga0501042_0085157 3300049578 Bacteria 2266
416 Ga0501042_0092877 3300049578 Bacteria 2167
417 Ga0501046_0275144 3300049580 Bacteria 1234
418 Ga0501048_0044663 3300049582 Bacteria 3167
419 Ga0501048_0115198 3300049582 Bacteria 1899
420 Ga0501048_0191151 3300049582 Bacteria 1450
421 Ga0501067_0018783 3300049583 Bacteria 3827
422 Ga0501068_0064249 3300049584 Bacteria 2234
423 Ga0501069_0203892 3300049585 Bacteria 1146
424 Ga0501071_0011755 3300049587 Bacteria 5908
425 Ga0501071_0037626 3300049587 Bacteria 3455
426 Ga0501071_0056429 3300049587 Bacteria 2837
427 Ga0501071_0060876 3300049587 Bacteria 2734
428 Ga0501071_0093832 3300049587 Bacteria 2207
429 Ga0501071_0103639 3300049587 Bacteria 2099
430 Ga0501071_0190514 3300049587 Bacteria 1538
431 Ga0501072_0059992 3300049588 Bacteria 3000
432 Ga0501072_0071555 3300049588 Bacteria 2740
433 Ga0501072_0078497 3300049588 Bacteria 2614
434 Ga0501072_0443566 3300049588 Bacteria 1028
435 Ga0501073_0028410 3300049589 Bacteria 3997
436 Ga0501073_0053538 3300049589 Bacteria 2825
437 Ga0501074_0037296 3300049590 Bacteria 3524
438 Ga0501074_0128644 3300049590 Bacteria 1812
439 Ga0501075_0063103 3300049591 Bacteria 2793
440 Ga0501075_0422452 3300049591 Bacteria 1016
441 Ga0501076_0003930 3300049592 Bacteria 10485
442 Ga0501076_0043598 3300049592 Bacteria 3536
443 Ga0501076_0053204 3300049592 Bacteria 3208
444 Ga0501076_0071010 3300049592 Bacteria 2785
445 Ga0501076_0119467 3300049592 Bacteria 2134
446 Ga0501076_0226439 3300049592 Bacteria 1528
447 Ga0501076_0377962 3300049592 Bacteria 1164
448 Ga0501077_0035971 3300049593 Bacteria 3154
449 Ga0501079_0051266 3300049741 Bacteria 3186
450 Ga0501079_0095211 3300049741 Bacteria 2308
451 Ga0501079_0123808 3300049741 Bacteria 2011
452 Ga0501080_0124028 3300049742 Bacteria 2393
453 Ga0501080_0416653 3300049742 Bacteria 1207
454 Ga0501081_0011380 3300049743 Bacteria 5823
455 Ga0501081_0370858 3300049743 Bacteria 1057
456 Ga0501283_013358 3300049779 Bacteria 1244
457 Ga0501035_0387942 3300049822 Bacteria 1164
458 Ga0501035_0553379 3300049822 Bacteria 942
459 Ga0501045_0005929 3300049824 Bacteria 8451
460 Ga0501045_0050350 3300049824 Bacteria 3039
461 Ga0501045_0095497 3300049824 Bacteria 2199
462 Ga0501045_0189880 3300049824 Bacteria 1531
463 nmdc:mga03683_1699_c1 3300050489 Bacteria 6634
464 nmdc:mga00v17_139672_c1 3300050491 Bacteria 1553
465 nmdc:mga00v17_61039_c1 3300050491 Bacteria 2317
466 nmdc:mga00v17_81770_c1 3300050491 Bacteria 2018
467 nmdc:mga0k408_13971_c2 3300050493 Bacteria 3627
468 nmdc:mga0k408_16817_c1 3300050493 Bacteria 4066
469 nmdc:mga0k408_23331_c1 3300050493 Bacteria 3488
470 nmdc:mga0k408_37746_c1 3300050493 Bacteria 2774
471 nmdc:mga0k408_3800_c1 3300050493 Bacteria 8002
472 nmdc:mga06z11_102074_c1 3300050494 Bacteria 1575
473 nmdc:mga06z11_121913_c1 3300050494 Bacteria 1455
474 nmdc:mga06z11_12857_c1 3300050494 Bacteria 3653
475 nmdc:mga06z11_40709_c1 3300050494 Bacteria 2321
476 nmdc:mga06z11_58921_c1 3300050494 Bacteria 1994
477 nmdc:mga06z11_7970_c1 3300050494 Bacteria 4389
478 nmdc:mga04h51_3916_c1 3300050495 Bacteria 3662
479 nmdc:mga04h51_71965_c1 3300050495 Bacteria 1209
480 nmdc:mga07m45_3412_c1 3300050496 Bacteria 7659
481 nmdc:mga07m45_40185_c1 3300050496 Bacteria 2617
482 nmdc:mga07m45_47483_c1 3300050496 Bacteria 2414
483 nmdc:mga07m45_64223_c1 3300050496 Bacteria 2083
484 nmdc:mga05p37_104576_c1 3300050507 Bacteria 3483
485 nmdc:mga05p37_118428_c1 3300050507 Bacteria 3254
486 nmdc:mga05p37_141863_c2 3300050507 Bacteria 1635
487 nmdc:mga05p37_1592_c1 3300050507 Bacteria 26358
488 nmdc:mga05p37_1985_c1 3300050507 Bacteria 19185
489 nmdc:mga05p37_20406_c1 3300050507 Bacteria 8016
490 nmdc:mga05p37_39340_c1 3300050507 Bacteria 5806
491 nmdc:mga05p37_578340_c1 3300050507 Bacteria 1273
492 nmdc:mga05p37_7067_c1 3300050507 Bacteria 13232
493 nmdc:mga05p37_882514_c1 3300050507 Bacteria 967
494 nmdc:mga05p37_90205_c1 3300050507 Bacteria 3778
495 nmdc:mga05p37_9299_c1 3300050507 Bacteria 11624
496 nmdc:mga09592_102037_c1 3300050508 Bacteria 2458
497 nmdc:mga09592_103418_c1 3300050508 Bacteria 2440
498 nmdc:mga09592_11539_c1 3300050508 Bacteria 7190
499 nmdc:mga09592_129773_c1 3300050508 Bacteria 2168
500 nmdc:mga09592_3626_c1 3300050508 Bacteria 12461
501 nmdc:mga0qj67_10037_c1 3300050509 Bacteria 7064
502 nmdc:mga0qj67_22551_c1 3300050509 Bacteria 4837
503 nmdc:mga0qj67_57837_c1 3300050509 Bacteria 3074
504 nmdc:mga06r32_114403_c1 3300050510 Bacteria 2656
505 nmdc:mga06r32_19340_c1 3300050510 Bacteria 6249
506 nmdc:mga06r32_27532_c1 3300050510 Bacteria 5311
507 nmdc:mga06r32_43362_c1 3300050510 Bacteria 4280
508 nmdc:mga06r32_5351_c1 3300050510 Bacteria 11558
509 nmdc:mga08y16_1200_c1 3300050511 Bacteria 25574
510 nmdc:mga08y16_14251_c1 3300050511 Bacteria 8367
511 nmdc:mga08y16_154502_c1 3300050511 Bacteria 2385
512 nmdc:mga08y16_1582_c1 3300050511 Bacteria 22965
513 nmdc:mga08y16_189187_c1 3300050511 Bacteria 2135
514 nmdc:mga08y16_450913_c1 3300050511 Bacteria 1312
515 nmdc:mga08y16_51572_c1 3300050511 Bacteria 4304
516 nmdc:mga08y16_579578_c1 3300050511 Bacteria 1133
517 nmdc:mga08y16_6164_c1 3300050511 Bacteria 12581
518 nmdc:mga08y16_81343_c1 3300050511 Bacteria 3377
519 nmdc:mga08y16_839293_c1 3300050511 Bacteria 909
520 nmdc:mga0n895_17522_c1 3300050512 Bacteria 6603
521 nmdc:mga0n895_60499_c1 3300050512 Bacteria 3737
522 nmdc:mga0n895_8277_c1 3300050512 Bacteria 8994
523 nmdc:mga0rr50_22095_c1 3300050513 Bacteria 4359
524 nmdc:mga0rr50_392075_c1 3300050513 Bacteria 1172
525 nmdc:mga0rr50_504416_c1 3300050513 Bacteria 1029
526 nmdc:mga0rr50_57027_c1 3300050513 Bacteria 2920
527 nmdc:mga08x19_56108_c1 3300050514 Bacteria 2541
528 nmdc:mga0a205_150108_c1 3300050515 Bacteria 1914
529 nmdc:mga0a205_177510_c1 3300050515 Unclassified 2025
530 nmdc:mga0a205_246316_c1 3300050515 Bacteria 1667
531 nmdc:mga0a205_2481_c1 3300050515 Bacteria 16269
532 nmdc:mga0a205_29990_c1 3300050515 Bacteria 5206
533 nmdc:mga0a205_375158_c1 3300050515 Bacteria 1288
534 Ga0495601_0038561 3300053077 Bacteria 2989
535 Ga0495619_0213046 3300053085 Bacteria 1338
536 Ga0501084_0024318 3300054114 Bacteria 5052
537 Ga0501084_0042720 3300054114 Bacteria 3792
538 Ga0501084_0057831 3300054114 Bacteria 3244
539 Ga0501084_0369979 3300054114 Bacteria 1211
540 Ga0501084_0563411 3300054114 Bacteria 963
541 Ga0590071_000130 3300059421 Bacteria 21062
542 Ga0590071_001778 3300059421 Bacteria 5564
543 Ga0590071_001779 3300059421 Bacteria 5563
544 Ga0590071_011698 3300059421 Bacteria 2053
545 Ga0590074_000812 3300059423 Bacteria 4821
546 Ga0590074_006337 3300059423 Bacteria 1965
547 Ga0590075_000665 3300059424 Bacteria 9117
548 Ga0590075_001098 3300059424 Bacteria 6973
549 Ga0590075_001371 3300059424 Bacteria 6115
550 Ga0590077_000064 3300059426 Bacteria 26586
551 Ga0590077_000469 3300059426 Bacteria 11331
552 Ga0590077_000611 3300059426 Bacteria 9673
553 Ga0590077_020613 3300059426 Bacteria 1400
554 Ga0501082_0041558 3300060353 Bacteria 3964
555 Ga0501082_0110366 3300060353 Bacteria 2381
556 Ga0501082_0142529 3300060353 Bacteria 2080
557 Ga0501082_0160277 3300060353 Bacteria 1955
558 Ga0501082_0248991 3300060353 Bacteria 1546
559 Ga0530510_0008981 3300061734 Bacteria 7004
560 Ga0530510_0276881 3300061734 Bacteria 1253
561 Ga0075433_10152405
562 JGI24743J22301_10007993
563 Ga0065712_10001261
564 Ga0065712_10005947
565 Ga0065712_10068771
566 Ga0065712_10127498
567 Ga0065715_10006578
568 Ga0065715_10011218
569 Ga0065715_10102236
570 Ga0065715_10110068
571 Ga0065715_10110545
572 Ga0065715_10129863
573 Ga0065715_10132932
574 Ga0065715_10139912
575 Ga0065715_10209213
576 Ga0065715_10306705
577 Ga0065707_10001103
578 Ga0065707_10092306
579 Ga0065707_10244532
580 Ga0070683_100025255
581 Ga0070683_100036014
582 Ga0070683_100372422
583 Ga0070670_100013022
584 Ga0070670_100016157
585 Ga0070670_100021123
586 Ga0070670_100036919
587 Ga0070670_100129115
588 Ga0070670_100296209
589 Ga0068869_100100216
590 Ga0068869_100445826
591 Ga0070666_10177130
592 Ga0070666_10262339
593 Ga0070680_100158141
594 Ga0070682_100141566
595 Ga0068868_100029658
596 Ga0070660_100092874
597 Ga0070689_100112700
598 Ga0070687_100013680
599 Ga0070661_100032041
600 Ga0070668_100073152
601 Ga0070669_100003984
602 Ga0070669_100284128
603 Ga0070675_100060549
604 Ga0070675_100068997
605 Ga0070675_100087524
606 Ga0070675_100130006
607 Ga0070675_100300561
608 Ga0070675_100690783
609 Ga0070671_100012298
610 Ga0070674_100053151
611 Ga0070674_100173531
612 Ga0070674_100325274
613 Ga0070673_100448593
614 Ga0070688_100059781
615 Ga0070659_100082458
616 Ga0070667_100042492
617 Ga0070667_100075166
618 Ga0070667_100144013
619 Ga0070667_100617160
620 Ga0070713_100010331
621 Ga0070701_10004391
622 Ga0070701_10120218
623 Ga0070700_100073078
624 Ga0070708_100169252
625 Ga0070708_100594742
626 Ga0070663_100295587
627 Ga0070663_100376279
628 Ga0070678_100103309
629 Ga0070678_100234919
630 Ga0070662_100206157
631 Ga0068867_100035372
632 Ga0070685_10204892
633 Ga0070706_100301920
634 Ga0070699_100039918
635 Ga0070679_100119869
636 Ga0070684_100000667
637 Ga0068853_100248049
638 Ga0068853_100463383
639 Ga0070665_100507779
640 Ga0070664_100003266
641 Ga0070664_100021712
642 Ga0070664_100047545
643 Ga0070664_100109358
644 Ga0070664_100130873
645 Ga0070664_100263404
646 Ga0070664_100688543
647 Ga0070664_100767312
648 Ga0068857_100450522
649 Ga0068854_100022317
650 Ga0068852_100264749
651 Ga0068859_100024255
652 Ga0068859_100375367
653 Ga0068859_100452618
654 Ga0068859_100682145
655 Ga0068864_100022530
656 Ga0068864_100274330
657 Ga0068861_100285998
658 Ga0068861_100470645
659 Ga0068851_10250928
660 Ga0068870_10050385
661 Ga0068870_10225230
662 Ga0068860_100090992
663 Ga0068862_100005656
664 Ga0081455_10114928
665 Ga0081538_10000009
666 Ga0081539_10019832
667 Ga0075365_10046005
668 Ga0075365_10110700
669 Ga0075365_10133582
670 Ga0075365_10169427
671 Ga0075368_10005380
672 Ga0075368_10029903
673 Ga0075368_10043632
674 Ga0075363_100205173
675 Ga0075364_10009642
676 Ga0075364_10010391
677 Ga0075364_10039105
678 Ga0075364_10068391
679 Ga0075364_10069819
680 Ga0075364_10170144
681 Ga0075362_10009695
682 Ga0075367_10009369
683 Ga0075367_10013762
684 Ga0075367_10022693
685 Ga0075367_10042448
686 Ga0075367_10093521
687 Ga0075366_10006239
688 Ga0075366_10016292
689 Ga0075366_10027608
690 Ga0075366_10056844
691 Ga0075366_10065039
692 Ga0075366_10065367
693 Ga0097621_100353180
694 Ga0075370_10000604
695 Ga0075370_10026538
696 Ga0075370_10054163
697 Ga0068871_100016573
698 Ga0075428_100001152
699 Ga0075428_100005960
700 Ga0075428_100006071
701 Ga0075428_100006815
702 Ga0075428_100009372
703 Ga0075428_100011336
704 Ga0075428_100532740
705 Ga0075428_100601790
706 Ga0075430_100003980
707 Ga0075430_100008296
708 Ga0075430_100011679
709 Ga0075430_100043012
710 Ga0075431_100003517
711 Ga0075431_100017814
712 Ga0075431_100021425
713 Ga0075431_100059163
714 Ga0075431_100059738
715 Ga0075431_100147623
716 Ga0075431_100619196
717 Ga0075433_10021512
718 Ga0075433_10049855
719 Ga0075433_10118500
720 Ga0075434_100010872
721 Ga0075434_100171859
722 Ga0075434_100273992
723 Ga0075429_100001876
724 Ga0075429_100028263
725 Ga0075429_100049419
726 Ga0075429_100070831
727 Ga0075429_100114161
728 Ga0075429_100280941
729 Ga0075429_100311953
730 Ga0068865_100186963
731 Ga0097620_100024256
732 Ga0097620_100375389
733 Ga0097620_100452607
734 Ga0097620_100682162
735 Ga0075435_100060026
736 Ga0075435_100394542
737 Ga0075435_100420400
738 Ga0105240_10074129
739 Ga0105240_10107878
740 Ga0111539_10000245
741 Ga0111539_10000335
742 Ga0111539_10012022
743 Ga0111539_10038610
744 Ga0111539_10051031
745 Ga0111539_10057966
746 Ga0111539_10111905
747 Ga0111539_10140982
748 Ga0111539_10203607
749 Ga0111539_10286187
750 Ga0111539_10405902
751 Ga0111539_10442549
752 Ga0111539_10492061
753 Ga0111539_10730465
754 Ga0111539_10896736
755 Ga0105245_10054107
756 Ga0105245_10160027
757 Ga0105247_10042190
758 Ga0114129_10001599
759 Ga0114129_10001632
760 Ga0114129_10004319
761 Ga0114129_10004642
762 Ga0114129_10006985
763 Ga0114129_10013863
764 Ga0114129_10020054
765 Ga0114129_10070670
766 Ga0114129_10099353
767 Ga0114129_10108264
768 Ga0114129_10289318
769 Ga0114129_10530416
770 Ga0105242_10746993
771 Ga0105242_10863031
772 Ga0105248_10037736
773 Ga0105248_10044446
774 Ga0105248_10055801
775 Ga0105248_10083856
776 Ga0105249_10000497
777 Ga0105249_10440999
778 Ga0105249_10515993
779 Ga0105249_10662708
780 Ga0105246_10374010
781 Ga0157374_10160474
782 Ga0157374_10251296
783 Ga0157374_10289991
784 Ga0163163_10024444
785 Ga0163163_10084297
786 Ga0157380_10011173
787 Ga0157380_10027839
788 Ga0157376_10301105
789 Ga0157376_10375814
790 Ga0163161_10449646
791 Ga0207697_10003836
792 Ga0207697_10018221
793 Ga0207688_10001110
794 Ga0207680_10102522
795 Ga0207680_10334157
796 Ga0207680_10351163
797 Ga0207643_10055962
798 Ga0207643_10165682
799 Ga0207684_10201973
800 Ga0207654_10246670
801 Ga0207707_10130416
802 Ga0207695_10201020
803 Ga0207660_10257799
804 Ga0207662_10010445
805 Ga0207657_10059892
806 Ga0207649_10028984
807 Ga0207649_10114588
808 Ga0207652_10065530
809 Ga0207646_10566688
810 Ga0207681_10002225
811 Ga0207650_10009862
812 Ga0207650_10051498
813 Ga0207650_10084926
814 Ga0207650_10088504
815 Ga0207650_10177806
816 Ga0207650_10511447
817 Ga0207659_10353286
818 Ga0207687_10274571
819 Ga0207706_10078261
820 Ga0207706_10367890
821 Ga0207709_10215937
822 Ga0207670_10065523
823 Ga0207669_10125410
824 Ga0207669_10181492
825 Ga0207704_10130218
826 Ga0207691_10039313
827 Ga0207661_10004326
828 Ga0207661_10228912
829 Ga0207679_10009669
830 Ga0207679_10027006
831 Ga0207679_10029646
832 Ga0207679_10162087
833 Ga0207679_10274714
834 Ga0207651_10082717
835 Ga0207712_10017191
836 Ga0207712_10350560
837 Ga0207712_10441159
838 Ga0207668_10053473
839 Ga0207658_10187933
840 Ga0207658_10192502
841 Ga0207658_10249450
842 Ga0207678_10050645
843 Ga0207678_10102239
844 Ga0207678_10171528
845 Ga0207708_10037368
846 Ga0207708_10042027
847 Ga0207708_10194728
848 Ga0207648_10005197
849 Ga0207648_10338338
850 Ga0207676_10070507
851 Ga0207676_10080692
852 Ga0207676_10125044
853 Ga0207676_10246117
854 Ga0207674_10023809
855 Ga0207675_100187558
856 Ga0209998_10041731
857 Ga0209813_10009185
858 Ga0209813_10024438
859 Ga0207428_10000502
860 Ga0207428_10005001
861 Ga0207428_10005394
862 Ga0207428_10033918
863 Ga0207428_10169583
864 Ga0207428_10358765
865 Ga0268266_10062316
866 Ga0268266_10437200
867 Ga0268265_10009837
868 Ga0307408_100011527
869 Ga0307408_100020021
870 Ga0307408_100075989
871 Ga0307408_100165383
872 Ga0307408_100174749
873 Ga0307408_100306119
874 Ga0307405_10136337
875 Ga0307405_10201087
876 Ga0307413_10081220
877 Ga0307413_10212335
878 Ga0307413_10308826
879 Ga0307410_10041835
880 Ga0307410_10082975
881 Ga0307410_10153306
882 Ga0307410_10181635
883 Ga0307410_10494741
884 Ga0307406_10081643
885 Ga0307406_10136215
886 Ga0307406_10146324
887 Ga0307406_10311835
888 Ga0307407_10039127
889 Ga0307412_10005411
890 Ga0307412_10157131
891 Ga0307412_10237421
892 Ga0307412_10368136
893 Ga0307409_100002371
894 Ga0307409_100008338
895 Ga0307409_100045214
896 Ga0307409_100050102
897 Ga0307409_100222569
898 Ga0307409_100232973
899 Ga0307416_100009635
900 Ga0307416_100013606
901 Ga0307416_100051254
902 Ga0307416_100104428
903 Ga0307416_100116224
904 Ga0307416_100382657
905 Ga0307414_10001901
906 Ga0307414_10210759
907 Ga0307411_10018884
908 Ga0307411_10066374
909 Ga0307411_10069396
910 Ga0307411_10084578
911 Ga0307411_10096856
912 Ga0307411_10098253
913 Ga0307411_10207353
914 Ga0307415_100018496
915 Ga0307415_100510147
916 Ga0307415_100533622
917 Ga0373935_0407022
918 Ga0373937_0003124
919 Ga0373925_0020528
920 Ga0436365_0997585
921 Ga0439461_0024767
922 Ga0451853_2232392
923 Ga0451853_2889744
924 Ga0439449_0097719
925 Ga0439456_047627
926 Ga0450920_019181
927 Ga0450923_023940
928 Ga0439446_0037160
929 Ga0450908_005070
930 Ga0439435_0035156
931 Ga0439464_0009217
932 Ga0439464_0015977
933 Ga0450918_012104
934 Ga0451576_0103871
935 Ga0495592_0169502
936 Ga0495603_0094890
937 Ga0495594_0043298
938 Ga0495594_0134432
939 Ga0495608_0032432
940 Ga0495608_0219012
941 Ga0495628_0098701
942 Ga0495643_0011562
943 Ga0495652_0271633
944 Ga0495658_0167104
945 Ga0495613_0055960
946 Ga0495670_0219823
947 Ga0496100_0535728
948 Ga0496104_0015776
949 Ga0496104_0360717
950 Ga0496105_0037625
951 Ga0496106_0048506
952 Ga0496106_0181118
953 Ga0496108_0007540
954 Ga0496108_0452304
955 Ga0496108_0495812
956 Ga0496109_0003491
957 Ga0496109_0177474
958 Ga0496110_0009444
959 Ga0496111_0043166
960 Ga0496112_0011168
961 Ga0496112_0079577
962 Ga0496112_0347921
963 Ga0501031_0311255
964 Ga0501034_0037229
965 Ga0501036_0114326
966 Ga0501036_0178096
967 Ga0501039_0030038
968 Ga0501039_0038106
969 Ga0501039_0057855
970 Ga0501039_0167231
971 Ga0501040_0047602
972 Ga0501040_0093939
973 Ga0501041_0369492
974 Ga0501042_0070039
975 Ga0501042_0085157
976 Ga0501042_0092877
977 Ga0501046_0275144
978 Ga0501048_0044663
979 Ga0501048_0115198
980 Ga0501048_0191151
981 Ga0501067_0018783
982 Ga0501068_0064249
983 Ga0501069_0203892
984 Ga0501071_0011755
985 Ga0501071_0037626
986 Ga0501071_0056429
987 Ga0501071_0060876
988 Ga0501071_0093832
989 Ga0501071_0103639
990 Ga0501071_0190514
991 Ga0501072_0059992
992 Ga0501072_0071555
993 Ga0501072_0078497
994 Ga0501072_0443566
995 Ga0501073_0028410
996 Ga0501073_0053538
997 Ga0501074_0037296
998 Ga0501074_0128644
999 Ga0501075_0063103
1000 Ga0501075_0422452
1001 Ga0501076_0003930
1002 Ga0501076_0043598
1003 Ga0501076_0053204
1004 Ga0501076_0071010
1005 Ga0501076_0119467
1006 Ga0501076_0226439
1007 Ga0501076_0377962
1008 Ga0501077_0035971
1009 Ga0501079_0051266
1010 Ga0501079_0095211
1011 Ga0501079_0123808
1012 Ga0501080_0124028
1013 Ga0501080_0416653
1014 Ga0501081_0011380
1015 Ga0501081_0370858
1016 Ga0501283_013358
1017 Ga0501035_0387942
1018 Ga0501035_0553379
1019 Ga0501045_0005929
1020 Ga0501045_0050350
1021 Ga0501045_0095497
1022 Ga0501045_0189880
1023 nmdc:mga03683_1699_c1
1024 nmdc:mga00v17_139672_c1
1025 nmdc:mga00v17_61039_c1
1026 nmdc:mga00v17_81770_c1
1027 nmdc:mga0k408_13971_c2
1028 nmdc:mga0k408_16817_c1
1029 nmdc:mga0k408_23331_c1
1030 nmdc:mga0k408_37746_c1
1031 nmdc:mga0k408_3800_c1
1032 nmdc:mga06z11_102074_c1
1033 nmdc:mga06z11_121913_c1
1034 nmdc:mga06z11_12857_c1
1035 nmdc:mga06z11_40709_c1
1036 nmdc:mga06z11_58921_c1
1037 nmdc:mga06z11_7970_c1
1038 nmdc:mga04h51_3916_c1
1039 nmdc:mga04h51_71965_c1
1040 nmdc:mga07m45_3412_c1
1041 nmdc:mga07m45_40185_c1
1042 nmdc:mga07m45_47483_c1
1043 nmdc:mga07m45_64223_c1
1044 nmdc:mga05p37_104576_c1
1045 nmdc:mga05p37_118428_c1
1046 nmdc:mga05p37_141863_c2
1047 nmdc:mga05p37_1592_c1
1048 nmdc:mga05p37_1985_c1
1049 nmdc:mga05p37_20406_c1
1050 nmdc:mga05p37_39340_c1
1051 nmdc:mga05p37_578340_c1
1052 nmdc:mga05p37_7067_c1
1053 nmdc:mga05p37_882514_c1
1054 nmdc:mga05p37_90205_c1
1055 nmdc:mga05p37_9299_c1
1056 nmdc:mga09592_102037_c1
1057 nmdc:mga09592_103418_c1
1058 nmdc:mga09592_11539_c1
1059 nmdc:mga09592_129773_c1
1060 nmdc:mga09592_3626_c1
1061 nmdc:mga0qj67_10037_c1
1062 nmdc:mga0qj67_22551_c1
1063 nmdc:mga0qj67_57837_c1
1064 nmdc:mga06r32_114403_c1
1065 nmdc:mga06r32_19340_c1
1066 nmdc:mga06r32_27532_c1
1067 nmdc:mga06r32_43362_c1
1068 nmdc:mga06r32_5351_c1
1069 nmdc:mga08y16_1200_c1
1070 nmdc:mga08y16_14251_c1
1071 nmdc:mga08y16_154502_c1
1072 nmdc:mga08y16_1582_c1
1073 nmdc:mga08y16_189187_c1
1074 nmdc:mga08y16_450913_c1
1075 nmdc:mga08y16_51572_c1
1076 nmdc:mga08y16_579578_c1
1077 nmdc:mga08y16_6164_c1
1078 nmdc:mga08y16_81343_c1
1079 nmdc:mga08y16_839293_c1
1080 nmdc:mga0n895_17522_c1
1081 nmdc:mga0n895_60499_c1
1082 nmdc:mga0n895_8277_c1
1083 nmdc:mga0rr50_22095_c1
1084 nmdc:mga0rr50_392075_c1
1085 nmdc:mga0rr50_504416_c1
1086 nmdc:mga0rr50_57027_c1
1087 nmdc:mga08x19_56108_c1
1088 nmdc:mga0a205_150108_c1
1089 nmdc:mga0a205_177510_c1
1090 nmdc:mga0a205_246316_c1
1091 nmdc:mga0a205_2481_c1
1092 nmdc:mga0a205_29990_c1
1093 nmdc:mga0a205_375158_c1
1094 Ga0495601_0038561
1095 Ga0495619_0213046
1096 Ga0501084_0024318
1097 Ga0501084_0042720
1098 Ga0501084_0057831
1099 Ga0501084_0369979
1100 Ga0501084_0563411
1101 Ga0590071_000130
1102 Ga0590071_001778
1103 Ga0590071_001779
1104 Ga0590071_011698
1105 Ga0590074_000812
1106 Ga0590074_006337
1107 Ga0590075_000665
1108 Ga0590075_001098
1109 Ga0590075_001371
1110 Ga0590077_000064
1111 Ga0590077_000469
1112 Ga0590077_000611
1113 Ga0590077_020613
1114 Ga0501082_0041558
1115 Ga0501082_0110366
1116 Ga0501082_0142529
1117 Ga0501082_0160277
1118 Ga0501082_0248991
1119 Ga0530510_0008981
1120 Ga0530510_0276881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9432 22 266
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.94 21 266
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9234 21 266
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9224 23 262
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9216 21 267
ID Description Score Start End Superfamily
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 23 266 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9317 21 284 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9287 21 266 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9202 22 266 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9188 24 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A831UKK4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9438 22 181 GO:0005524
GO:0016887
AF-A0A2I1LMG1-F1-model_v4 deleted 0.9415 24 266
AF-A0A7G5ZMI2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9355 22 274 GO:0005524
GO:0016887
GO:0046677
AF-E6W5K9-F1-model_v4 ABC transporter related protein 0.9353 24 266 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7I7QNW9-F1-model_v4 Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein 0.9282 20 273 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Map