F463624

General Info

Members Datasets Scaffolds Average Seq Length
559 251 1118 274

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_042327|Ga0590071_042327_94_1032
Length 312
Sequence MEVAIVRLSLSARLLMQARGTGFWFDREGACMRLDQEGQSTNVEDRRGMRVSRGLAGGGIGTIALVLIGLFFGIDPSVLLQGNIDSAPPSQQVPQQGGNDEMGHFVSSVLASTERTWGEIFRRHGQEYQEPKLVLFSGAVESACGFAQSASGPFYCGRDSNVYIDLEFFRELRDRFKAPGDFAQAYVIAHEIGHHVQNQLGVMRKTSELQSRSSRAQANAISVRVELQADCLAGIWAGTANRDRKILEEGDVEEGLNAAAQIGDDRIQKRSQGYVVPEGFTHGSAEQRVRWFRRGLESRDIDQCDTFSAGAV

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 1.79
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_042327 3300059421 Bacteria 1097
2 SwRhRL2b_contig_955068 2162886007 Bacteria 1623
3 JGI24751J29686_10005663 3300002459 Bacteria 2544
4 Ga0065712_10083651 3300005290 Bacteria 2821
5 Ga0065712_10093085 3300005290 Bacteria 2304
6 Ga0065712_10138186 3300005290 Bacteria 1476
7 Ga0065715_10000413 3300005293 Bacteria 16795
8 Ga0065715_10006642 3300005293 Bacteria 4229
9 Ga0065715_10033359 3300005293 Bacteria 1002
10 Ga0065715_10091633 3300005293 Bacteria 5654
11 Ga0065715_10113810 3300005293 Unclassified 2473
12 Ga0065715_10145145 3300005293 Unclassified 1799
13 Ga0065707_10101871 3300005295 Bacteria 2841
14 Ga0070676_10003384 3300005328 Bacteria 8303
15 Ga0070676_10004682 3300005328 Bacteria 7229
16 Ga0070676_10023936 3300005328 Bacteria 3435
17 Ga0070676_10087848 3300005328 Bacteria 1898
18 Ga0070690_100258270 3300005330 Bacteria 1235
19 Ga0070670_100001691 3300005331 Bacteria 17936
20 Ga0070670_100018976 3300005331 Bacteria 5898
21 Ga0070670_100028461 3300005331 Bacteria 4809
22 Ga0070670_100039599 3300005331 Bacteria 4052
23 Ga0070670_100048026 3300005331 Bacteria 3674
24 Ga0070670_100276671 3300005331 Bacteria 1465
25 Ga0070677_10000110 3300005333 Bacteria 26795
26 Ga0068869_100018786 3300005334 Bacteria 4712
27 Ga0068869_100084603 3300005334 Bacteria 2375
28 Ga0068869_100145773 3300005334 Unclassified 1832
29 Ga0068869_100418739 3300005334 Bacteria 1105
30 Ga0070666_10008003 3300005335 Bacteria 6538
31 Ga0070666_10012832 3300005335 Bacteria 5297
32 Ga0070666_10115531 3300005335 Bacteria 1858
33 Ga0070666_10182440 3300005335 Bacteria 1472
34 Ga0070680_100015957 3300005336 Bacteria 5900
35 Ga0070680_100033613 3300005336 Bacteria 4135
36 Ga0070680_100086019 3300005336 Bacteria 2598
37 Ga0070682_100127305 3300005337 Bacteria 1719
38 Ga0068868_100034923 3300005338 Bacteria 3884
39 Ga0068868_100054763 3300005338 Bacteria 3145
40 Ga0070660_100247480 3300005339 Bacteria 1453
41 Ga0070689_100260103 3300005340 Bacteria 1434
42 Ga0070689_100512946 3300005340 Bacteria 1028
43 Ga0070687_100158748 3300005343 Bacteria 1335
44 Ga0070692_10146641 3300005345 Bacteria 1341
45 Ga0070668_100000778 3300005347 Bacteria 22004
46 Ga0070668_100173928 3300005347 Bacteria 1755
47 Ga0070668_100274523 3300005347 Bacteria 1406
48 Ga0070669_100014105 3300005353 Bacteria 5685
49 Ga0070669_100125759 3300005353 Bacteria 1961
50 Ga0070669_100183455 3300005353 Bacteria 1638
51 Ga0070675_100001434 3300005354 Bacteria 17497
52 Ga0070675_100001862 3300005354 Bacteria 15546
53 Ga0070675_100007234 3300005354 Bacteria 8560
54 Ga0070675_100007498 3300005354 Bacteria 8432
55 Ga0070675_100011584 3300005354 Bacteria 6906
56 Ga0070675_100062181 3300005354 Bacteria 3085
57 Ga0070675_100109389 3300005354 Bacteria 2336
58 Ga0070675_100442251 3300005354 Bacteria 1165
59 Ga0070671_100004648 3300005355 Bacteria 10886
60 Ga0070671_100018867 3300005355 Bacteria 5605
61 Ga0070671_100132613 3300005355 Bacteria 2099
62 Ga0070671_100338489 3300005355 Bacteria 1283
63 Ga0070674_100005317 3300005356 Bacteria 7424
64 Ga0070674_100122285 3300005356 Bacteria 1929
65 Ga0070674_100253099 3300005356 Bacteria 1384
66 Ga0070674_100313713 3300005356 Bacteria 1255
67 Ga0070673_100001293 3300005364 Bacteria 14580
68 Ga0070673_100006461 3300005364 Bacteria 7622
69 Ga0070673_100012630 3300005364 Bacteria 5806
70 Ga0070673_100079743 3300005364 Bacteria 2651
71 Ga0070673_100097803 3300005364 Bacteria 2411
72 Ga0070673_100209099 3300005364 Bacteria 1684
73 Ga0070688_100006011 3300005365 Bacteria 6438
74 Ga0070659_100013038 3300005366 Bacteria 6181
75 Ga0070667_100002647 3300005367 Bacteria 15512
76 Ga0070667_100004875 3300005367 Bacteria 11235
77 Ga0070667_100005929 3300005367 Bacteria 10171
78 Ga0070667_100042104 3300005367 Bacteria 3831
79 Ga0070667_100163808 3300005367 Bacteria 1960
80 Ga0070667_100299024 3300005367 Bacteria 1449
81 Ga0070713_100021253 3300005436 Bacteria 4988
82 Ga0070713_100513329 3300005436 Bacteria 1132
83 Ga0070710_10132069 3300005437 Bacteria 1523
84 Ga0070701_10015945 3300005438 Bacteria 3482
85 Ga0070705_100204151 3300005440 Bacteria 1357
86 Ga0070700_100059543 3300005441 Bacteria 2404
87 Ga0070700_100290596 3300005441 Bacteria 1189
88 Ga0070694_100046414 3300005444 Unclassified 2916
89 Ga0070694_100068529 3300005444 Bacteria 2438
90 Ga0070708_100477917 3300005445 Bacteria 1176
91 Ga0070663_100009089 3300005455 Bacteria 6140
92 Ga0070663_100189953 3300005455 Bacteria 1598
93 Ga0070678_100002807 3300005456 Bacteria 9625
94 Ga0070678_100004953 3300005456 Bacteria 7624
95 Ga0070678_100188155 3300005456 Bacteria 1695
96 Ga0070681_10032407 3300005458 Bacteria 5244
97 Ga0070681_10134706 3300005458 Bacteria 2401
98 Ga0070681_10223640 3300005458 Bacteria 1797
99 Ga0068867_100021942 3300005459 Bacteria 4560
100 Ga0068867_100024543 3300005459 Bacteria 4321
101 Ga0068867_100095240 3300005459 Bacteria 2265
102 Ga0070685_10005103 3300005466 Bacteria 6655
103 Ga0070685_10080490 3300005466 Bacteria 1952
104 Ga0070685_10258388 3300005466 Bacteria 1157
105 Ga0070679_100297722 3300005530 Bacteria 1564
106 Ga0070679_100331138 3300005530 Bacteria 1471
107 Ga0070679_100353409 3300005530 Bacteria 1417
108 Ga0070679_100481904 3300005530 Bacteria 1185
109 Ga0070697_100125997 3300005536 Bacteria 2145
110 Ga0068853_100002843 3300005539 Bacteria 13120
111 Ga0068853_100210593 3300005539 Bacteria 1772
112 Ga0070672_100001083 3300005543 Bacteria 16582
113 Ga0070672_100005650 3300005543 Bacteria 8322
114 Ga0070672_100008035 3300005543 Bacteria 7205
115 Ga0070672_100028898 3300005543 Bacteria 4151
116 Ga0070686_100049056 3300005544 Bacteria 2677
117 Ga0070686_100184259 3300005544 Bacteria 1486
118 Ga0070695_100153008 3300005545 Bacteria 1611
119 Ga0070695_100183936 3300005545 Bacteria 1483
120 Ga0070665_100003069 3300005548 Bacteria 17984
121 Ga0070665_100087374 3300005548 Bacteria 3123
122 Ga0070704_100012147 3300005549 Bacteria 5315
123 Ga0070704_100175887 3300005549 Bacteria 1707
124 Ga0070704_100261739 3300005549 Bacteria 1425
125 Ga0068855_100041733 3300005563 Bacteria 5437
126 Ga0070664_100001116 3300005564 Bacteria 21237
127 Ga0070664_100146695 3300005564 Bacteria 2081
128 Ga0070664_100245369 3300005564 Bacteria 1609
129 Ga0070664_100270760 3300005564 Bacteria 1530
130 Ga0068857_100485696 3300005577 Bacteria 1158
131 Ga0068854_100025252 3300005578 Bacteria 4076
132 Ga0068854_100095768 3300005578 Bacteria 2216
133 Ga0068856_100128188 3300005614 Bacteria 2541
134 Ga0068856_100330198 3300005614 Bacteria 1543
135 Ga0070702_100127978 3300005615 Bacteria 1600
136 Ga0070702_100216848 3300005615 Bacteria 1277
137 Ga0068852_100106740 3300005616 Bacteria 2539
138 Ga0068859_100011838 3300005617 Bacteria 8762
139 Ga0068859_100062404 3300005617 Bacteria 3757
140 Ga0068859_100110262 3300005617 Bacteria 2814
141 Ga0068859_100501549 3300005617 Unclassified 1309
142 Ga0068859_100533002 3300005617 Unclassified 1269
143 Ga0068859_100550951 3300005617 Bacteria 1248
144 Ga0068859_100695639 3300005617 Bacteria 1107
145 Ga0068864_100031869 3300005618 Bacteria 4475
146 Ga0068864_100035862 3300005618 Bacteria 4224
147 Ga0068864_100049439 3300005618 Bacteria 3618
148 Ga0068864_100252738 3300005618 Bacteria 1637
149 Ga0068861_100473385 3300005719 Bacteria 1127
150 Ga0068851_10011326 3300005834 Bacteria 4181
151 Ga0068870_10022688 3300005840 Bacteria 3087
152 Ga0068863_100014836 3300005841 Bacteria 7491
153 Ga0068863_100024162 3300005841 Bacteria 5798
154 Ga0068863_100060189 3300005841 Bacteria 3591
155 Ga0068858_100008324 3300005842 Bacteria 9977
156 Ga0068858_100133688 3300005842 Bacteria 2326
157 Ga0068858_100402933 3300005842 Bacteria 1314
158 Ga0068860_100036110 3300005843 Bacteria 4737
159 Ga0068862_100519315 3300005844 Bacteria 1133
160 Ga0081455_10000152 3300005937 Bacteria 83354
161 Ga0081455_10162476 3300005937 Bacteria 1710
162 Ga0081538_10045073 3300005981 Bacteria 2739
163 Ga0070717_10146180 3300006028 Bacteria 2042
164 Ga0075365_10081552 3300006038 Bacteria 2192
165 Ga0075368_10006151 3300006042 Bacteria 4176
166 Ga0075368_10081435 3300006042 Bacteria 1318
167 Ga0075364_10004247 3300006051 Bacteria 8226
168 Ga0075364_10239922 3300006051 Bacteria 1231
169 Ga0075362_10009214 3300006177 Bacteria 3807
170 Ga0075367_10001648 3300006178 Bacteria 9720
171 Ga0075367_10142660 3300006178 Bacteria 1484
172 Ga0075366_10006546 3300006195 Bacteria 6388
173 Ga0075366_10024710 3300006195 Bacteria 3505
174 Ga0097621_100004774 3300006237 Bacteria 9482
175 Ga0097621_100111380 3300006237 Bacteria 2313
176 Ga0068871_100007298 3300006358 Bacteria 7887
177 Ga0068871_100008462 3300006358 Bacteria 7403
178 Ga0068871_100026000 3300006358 Bacteria 4562
179 Ga0075428_100082119 3300006844 Bacteria 3517
180 Ga0075428_100153110 3300006844 Bacteria 2505
181 Ga0075428_100551896 3300006844 Bacteria 1232
182 Ga0075428_100659817 3300006844 Bacteria 1115
183 Ga0075430_100007277 3300006846 Bacteria 9343
184 Ga0075430_100018544 3300006846 Bacteria 5921
185 Ga0075431_100057775 3300006847 Bacteria 4001
186 Ga0075431_100205795 3300006847 Bacteria 2012
187 Ga0075431_100254017 3300006847 Bacteria 1785
188 Ga0075433_10009190 3300006852 Bacteria 7898
189 Ga0075433_10049697 3300006852 Bacteria 3648
190 Ga0075433_10052794 3300006852 Bacteria 3542
191 Ga0075433_10201197 3300006852 Bacteria 1771
192 Ga0075433_10212911 3300006852 Bacteria 1717
193 Ga0075433_10375905 3300006852 Bacteria 1255
194 Ga0075433_10464379 3300006852 Bacteria 1115
195 Ga0075434_100001526 3300006871 Bacteria 19565
196 Ga0075434_100036140 3300006871 Bacteria 4886
197 Ga0075434_100042940 3300006871 Bacteria 4483
198 Ga0075434_100080581 3300006871 Bacteria 3253
199 Ga0075434_100380031 3300006871 Bacteria 1433
200 Ga0075434_100692116 3300006871 Bacteria 1037
201 Ga0075429_100182458 3300006880 Bacteria 1839
202 Ga0075429_100219527 3300006880 Bacteria 1665
203 Ga0075429_100237410 3300006880 Bacteria 1597
204 Ga0075429_100323297 3300006880 Bacteria 1350
205 Ga0068865_100044413 3300006881 Bacteria 3041
206 Ga0068865_100146329 3300006881 Bacteria 1787
207 Ga0075436_100158856 3300006914 Bacteria 1593
208 Ga0075436_100257434 3300006914 Bacteria 1244
209 Ga0097620_100011838 3300006931 Bacteria 8762
210 Ga0097620_100062402 3300006931 Bacteria 3757
211 Ga0097620_100110263 3300006931 Bacteria 2814
212 Ga0097620_100501586 3300006931 Unclassified 1309
213 Ga0097620_100533058 3300006931 Unclassified 1269
214 Ga0097620_100550901 3300006931 Bacteria 1248
215 Ga0097620_100695649 3300006931 Bacteria 1107
216 Ga0105240_10049136 3300009093 Bacteria 5327
217 Ga0111539_10056779 3300009094 Bacteria 4652
218 Ga0111539_10212910 3300009094 Bacteria 2251
219 Ga0111539_10357065 3300009094 Bacteria 1701
220 Ga0111539_10402482 3300009094 Bacteria 1594
221 Ga0105245_10415367 3300009098 Bacteria 1347
222 Ga0114129_10000560 3300009147 Bacteria 45696
223 Ga0114129_10002287 3300009147 Bacteria 26519
224 Ga0114129_10079823 3300009147 Bacteria 4549
225 Ga0114129_10102233 3300009147 Bacteria 3964
226 Ga0114129_10193513 3300009147 Bacteria 2759
227 Ga0114129_10593118 3300009147 Bacteria 1436
228 Ga0114129_10660706 3300009147 Bacteria 1348
229 Ga0114129_10900296 3300009147 Bacteria 1121
230 Ga0105243_10033450 3300009148 Bacteria 3976
231 Ga0105243_10627604 3300009148 Bacteria 1038
232 Ga0105242_10024555 3300009176 Bacteria 4761
233 Ga0105242_10092194 3300009176 Bacteria 2552
234 Ga0105248_10008350 3300009177 Bacteria 11376
235 Ga0105248_10012279 3300009177 Bacteria 9447
236 Ga0105248_10081566 3300009177 Bacteria 3636
237 Ga0105248_10184097 3300009177 Bacteria 2354
238 Ga0105248_10250946 3300009177 Bacteria 1992
239 Ga0105248_10407413 3300009177 Bacteria 1531
240 Ga0105249_10089815 3300009553 Bacteria 2871
241 Ga0105249_10392213 3300009553 Bacteria 1417
242 Ga0105239_10043488 3300010375 Bacteria 4924
243 Ga0105239_10092572 3300010375 Bacteria 3337
244 Ga0105246_10178432 3300011119 Bacteria 1633
245 Ga0157371_10058905 3300013102 Bacteria 2724
246 Ga0157374_10002278 3300013296 Bacteria 16145
247 Ga0157374_10097492 3300013296 Bacteria 2813
248 Ga0157378_10134593 3300013297 Bacteria 2290
249 Ga0163162_10011894 3300013306 Bacteria 8488
250 Ga0163162_10016344 3300013306 Bacteria 7253
251 Ga0163162_10027458 3300013306 Bacteria 5629
252 Ga0163162_10337158 3300013306 Bacteria 1640
253 Ga0157372_10087835 3300013307 Bacteria 3529
254 Ga0157375_10010937 3300013308 Bacteria 8003
255 Ga0157375_10833235 3300013308 Bacteria 1070
256 Ga0163163_10045321 3300014325 Bacteria 4316
257 Ga0163163_10086357 3300014325 Bacteria 3147
258 Ga0157380_10023365 3300014326 Bacteria 4663
259 Ga0157380_10038697 3300014326 Bacteria 3705
260 Ga0157377_10057712 3300014745 Bacteria 2208
261 Ga0157379_10035824 3300014968 Bacteria 4425
262 Ga0157376_10016916 3300014969 Bacteria 5550
263 Ga0157376_10018761 3300014969 Bacteria 5314
264 Ga0157376_10053206 3300014969 Bacteria 3370
265 Ga0182006_1118791 3300015261 Bacteria 920
266 Ga0163161_10038486 3300017792 Bacteria 3430
267 Ga0163161_10044400 3300017792 Bacteria 3201
268 Ga0163161_10088733 3300017792 Bacteria 2286
269 Ga0207697_10012520 3300025315 Bacteria 3556
270 Ga0207656_10002066 3300025321 Bacteria 6703
271 Ga0207682_10000063 3300025893 Bacteria 46817
272 Ga0207642_10014167 3300025899 Bacteria 2934
273 Ga0207642_10098561 3300025899 Bacteria 1462
274 Ga0207642_10132070 3300025899 Bacteria 1305
275 Ga0207688_10006100 3300025901 Bacteria 6554
276 Ga0207688_10041270 3300025901 Bacteria 2566
277 Ga0207680_10002101 3300025903 Bacteria 9328
278 Ga0207680_10107527 3300025903 Bacteria 1803
279 Ga0207680_10144104 3300025903 Bacteria 1582
280 Ga0207645_10000195 3300025907 Bacteria 49424
281 Ga0207645_10005556 3300025907 Bacteria 9126
282 Ga0207645_10021948 3300025907 Bacteria 4159
283 Ga0207645_10053355 3300025907 Bacteria 2583
284 Ga0207643_10027180 3300025908 Bacteria 3171
285 Ga0207684_10183187 3300025910 Bacteria 1806
286 Ga0207707_10067805 3300025912 Bacteria 3108
287 Ga0207695_10161183 3300025913 Bacteria 2174
288 Ga0207660_10003749 3300025917 Bacteria 9893
289 Ga0207660_10018996 3300025917 Bacteria 4591
290 Ga0207660_10092189 3300025917 Bacteria 2248
291 Ga0207662_10002657 3300025918 Bacteria 9014
292 Ga0207662_10040448 3300025918 Bacteria 2741
293 Ga0207662_10095980 3300025918 Bacteria 1831
294 Ga0207657_10022040 3300025919 Bacteria 5981
295 Ga0207657_10308485 3300025919 Bacteria 1253
296 Ga0207652_10225736 3300025921 Bacteria 1688
297 Ga0207652_10289626 3300025921 Bacteria 1478
298 Ga0207652_10345661 3300025921 Bacteria 1343
299 Ga0207681_10027398 3300025923 Bacteria 3684
300 Ga0207681_10096615 3300025923 Bacteria 2121
301 Ga0207650_10003578 3300025925 Bacteria 10658
302 Ga0207650_10054198 3300025925 Bacteria 2974
303 Ga0207650_10077625 3300025925 Bacteria 2511
304 Ga0207650_10168659 3300025925 Bacteria 1739
305 Ga0207650_10219932 3300025925 Bacteria 1528
306 Ga0207650_10266985 3300025925 Bacteria 1390
307 Ga0207659_10007046 3300025926 Bacteria 6900
308 Ga0207659_10020047 3300025926 Bacteria 4413
309 Ga0207659_10365973 3300025926 Bacteria 1199
310 Ga0207687_10175134 3300025927 Bacteria 1658
311 Ga0207644_10008455 3300025931 Bacteria 6736
312 Ga0207644_10205125 3300025931 Bacteria 1556
313 Ga0207644_10260586 3300025931 Bacteria 1386
314 Ga0207690_10300201 3300025932 Bacteria 1256
315 Ga0207706_10012649 3300025933 Bacteria 7681
316 Ga0207686_10005665 3300025934 Bacteria 6694
317 Ga0207670_10212561 3300025936 Bacteria 1476
318 Ga0207669_10003605 3300025937 Bacteria 6717
319 Ga0207704_10114964 3300025938 Bacteria 1828
320 Ga0207691_10000370 3300025940 Bacteria 45317
321 Ga0207691_10010424 3300025940 Bacteria 8917
322 Ga0207691_10012973 3300025940 Bacteria 7979
323 Ga0207691_10016392 3300025940 Bacteria 7035
324 Ga0207711_10011189 3300025941 Bacteria 7456
325 Ga0207689_10004513 3300025942 Bacteria 12601
326 Ga0207689_10041834 3300025942 Bacteria 3791
327 Ga0207689_10078509 3300025942 Bacteria 2713
328 Ga0207689_10164515 3300025942 Unclassified 1828
329 Ga0207679_10003568 3300025945 Bacteria 9644
330 Ga0207679_10139600 3300025945 Bacteria 1957
331 Ga0207667_10362662 3300025949 Bacteria 1477
332 Ga0207667_10525625 3300025949 Bacteria 1198
333 Ga0207651_10003818 3300025960 Bacteria 7466
334 Ga0207651_10020081 3300025960 Bacteria 4022
335 Ga0207651_10037140 3300025960 Bacteria 3188
336 Ga0207651_10227320 3300025960 Bacteria 1512
337 Ga0207668_10001560 3300025972 Bacteria 13411
338 Ga0207640_10055424 3300025981 Bacteria 2597
339 Ga0207640_10228676 3300025981 Bacteria 1429
340 Ga0207640_10332220 3300025981 Bacteria 1214
341 Ga0207658_10008335 3300025986 Bacteria 7059
342 Ga0207658_10135882 3300025986 Bacteria 1982
343 Ga0207658_10252739 3300025986 Bacteria 1498
344 Ga0207658_10393353 3300025986 Bacteria 1217
345 Ga0207658_10414006 3300025986 Bacteria 1187
346 Ga0207677_10072956 3300026023 Bacteria 2429
347 Ga0207677_10193944 3300026023 Bacteria 1609
348 Ga0207677_10310648 3300026023 Bacteria 1306
349 Ga0207703_10012948 3300026035 Bacteria 6502
350 Ga0207703_10160567 3300026035 Bacteria 1968
351 Ga0207639_10022232 3300026041 Bacteria 4566
352 Ga0207678_10001630 3300026067 Bacteria 20581
353 Ga0207678_10033095 3300026067 Bacteria 4504
354 Ga0207708_10002411 3300026075 Bacteria 13720
355 Ga0207708_10199615 3300026075 Bacteria 1595
356 Ga0207641_10008925 3300026088 Bacteria 8283
357 Ga0207641_10016132 3300026088 Bacteria 6117
358 Ga0207641_10053709 3300026088 Bacteria 3416
359 Ga0207648_10000885 3300026089 Bacteria 33754
360 Ga0207648_10013515 3300026089 Bacteria 7593
361 Ga0207648_10120047 3300026089 Bacteria 2311
362 Ga0207676_10322086 3300026095 Bacteria 1419
363 Ga0207676_10442457 3300026095 Bacteria 1224
364 Ga0207674_10437490 3300026116 Bacteria 1264
365 Ga0207675_100220717 3300026118 Bacteria 1826
366 Ga0207683_10000009 3300026121 Bacteria 150281
367 Ga0207683_10007994 3300026121 Bacteria 9045
368 Ga0207683_10216420 3300026121 Bacteria 1745
369 Ga0207698_10022954 3300026142 Bacteria 4351
370 Ga0207698_10137222 3300026142 Bacteria 2101
371 Ga0207698_10388951 3300026142 Bacteria 1329
372 Ga0209813_10031144 3300027866 Bacteria 1573
373 Ga0209974_10104395 3300027876 Bacteria 992
374 Ga0207428_10084673 3300027907 Bacteria 2470
375 Ga0268266_10012266 3300028379 Bacteria 7413
376 Ga0268266_10017458 3300028379 Bacteria 6119
377 Ga0268266_10058287 3300028379 Bacteria 3325
378 Ga0268265_10256974 3300028380 Bacteria 1551
379 Ga0268264_10011660 3300028381 Bacteria 7248
380 Ga0268264_10070293 3300028381 Bacteria 2963
381 Ga0307408_100304719 3300031548 Bacteria 1336
382 Ga0307413_10032643 3300031824 Bacteria 2954
383 Ga0307410_10057928 3300031852 Unclassified 2640
384 Ga0307407_10315564 3300031903 Bacteria 1095
385 Ga0307409_100515737 3300031995 Bacteria 1167
386 Ga0307416_100345653 3300032002 Bacteria 1503
387 Ga0373955_0179881 3300035172 Bacteria 1254
388 Ga0373931_0041545 3300035691 Bacteria 2416
389 Ga0373933_0091578 3300035724 Bacteria 1877
390 Ga0373947_0017407 3300035725 Bacteria 4133
391 Ga0373937_0032611 3300036401 Bacteria 4725
392 Ga0373937_0198442 3300036401 Bacteria 1886
393 Ga0373937_0348725 3300036401 Bacteria 1402
394 Ga0373925_0453818 3300037068 Bacteria 1050
395 Ga0436365_0143486 3300039437 Bacteria 2181
396 Ga0439434_0028387 3300042435 Unclassified 1694
397 Ga0439435_0102786 3300042436 Bacteria 880
398 Ga0451577_0000124 3300042876 Bacteria 169120
399 Ga0451577_0034313 3300042876 Bacteria 4574
400 Ga0451577_0166155 3300042876 Bacteria 1988
401 Ga0453683_0124356 3300044673 Bacteria 1624
402 Ga0453683_0137991 3300044673 Bacteria 1538
403 Ga0453684_0000239 3300044712 Bacteria 235992
404 Ga0453684_0005447 3300044712 Bacteria 25200
405 Ga0453684_0022885 3300044712 Bacteria 9246
406 Ga0453684_0151487 3300044712 Bacteria 2755
407 Ga0451576_0001721 3300045051 Bacteria 36069
408 Ga0451576_1013658 3300045051 Bacteria 870
409 Ga0495651_0319243 3300046462 Bacteria 1036
410 Ga0495664_0078372 3300046477 Bacteria 1979
411 Ga0495630_0303217 3300046517 Bacteria 1221
412 Ga0495621_0032528 3300046539 Bacteria 1794
413 Ga0495645_0001414 3300046543 Bacteria 16162
414 Ga0495667_0079376 3300046559 Bacteria 2134
415 Ga0495635_0066066 3300046663 Bacteria 2481
416 Ga0495647_0106295 3300046681 Bacteria 1167
417 Ga0495674_0321305 3300047319 Bacteria 1261
418 Ga0495674_0393386 3300047319 Bacteria 1120
419 Ga0495684_0141079 3300047471 Bacteria 1807
420 Ga0496103_0288372 3300048906 Bacteria 1056
421 Ga0496107_0251929 3300048910 Bacteria 1314
422 Ga0496108_0082193 3300048911 Bacteria 2731
423 Ga0496109_0051790 3300048912 Bacteria 3740
424 Ga0496109_0408308 3300048912 Bacteria 1283
425 Ga0496112_0080900 3300048915 Bacteria 3212
426 Ga0496113_0117564 3300048916 Bacteria 2076
427 Ga0496113_0286045 3300048916 Bacteria 1319
428 Ga0496114_0076111 3300048917 Bacteria 2828
429 Ga0496114_0081311 3300048917 Bacteria 2737
430 Ga0501031_0011326 3300049568 Bacteria 5810
431 Ga0501031_0036596 3300049568 Bacteria 3201
432 Ga0501032_0014214 3300049569 Bacteria 5639
433 Ga0501032_0032697 3300049569 Bacteria 3564
434 Ga0501032_0059718 3300049569 Bacteria 2558
435 Ga0501033_0001713 3300049570 Bacteria 19200
436 Ga0501033_0036585 3300049570 Bacteria 3678
437 Ga0501034_0020721 3300049571 Bacteria 6712
438 Ga0501036_0005512 3300049572 Bacteria 10261
439 Ga0501036_0007788 3300049572 Bacteria 8761
440 Ga0501036_0013340 3300049572 Bacteria 6825
441 Ga0501036_0388422 3300049572 Bacteria 1164
442 Ga0501037_0005442 3300049573 Bacteria 9276
443 Ga0501037_0006490 3300049573 Bacteria 8555
444 Ga0501037_0032011 3300049573 Bacteria 3882
445 Ga0501038_0002607 3300049574 Bacteria 16860
446 Ga0501038_0003273 3300049574 Bacteria 15094
447 Ga0501038_0008941 3300049574 Bacteria 9189
448 Ga0501039_0019627 3300049575 Bacteria 5183
449 Ga0501039_0036617 3300049575 Bacteria 3787
450 Ga0501039_0069322 3300049575 Bacteria 2739
451 Ga0501039_0416393 3300049575 Bacteria 1055
452 Ga0501039_0517649 3300049575 Bacteria 937
453 Ga0501040_0450883 3300049576 Bacteria 926
454 Ga0501040_0517201 3300049576 Bacteria 860
455 Ga0501042_0002223 3300049578 Bacteria 11843
456 Ga0501043_0031023 3300049579 Bacteria 4202
457 Ga0501043_0050196 3300049579 Bacteria 3279
458 Ga0501046_0013331 3300049580 Bacteria 6964
459 Ga0501046_0024053 3300049580 Bacteria 5002
460 Ga0501046_0045948 3300049580 Bacteria 3466
461 Ga0501046_0126331 3300049580 Bacteria 1942
462 Ga0501047_0019399 3300049581 Bacteria 6523
463 Ga0501047_0087783 3300049581 Bacteria 2987
464 Ga0501047_0219291 3300049581 Bacteria 1759
465 Ga0501048_0010166 3300049582 Bacteria 7039
466 Ga0501048_0134876 3300049582 Bacteria 1744
467 Ga0501067_0002805 3300049583 Bacteria 9585
468 Ga0501067_0003806 3300049583 Bacteria 8325
469 Ga0501068_0000840 3300049584 Bacteria 15972
470 Ga0501068_0052971 3300049584 Bacteria 2455
471 Ga0501069_0005327 3300049585 Bacteria 6685
472 Ga0501069_0083307 3300049585 Bacteria 1803
473 Ga0501070_0025976 3300049586 Bacteria 4912
474 Ga0501070_0043930 3300049586 Bacteria 3718
475 Ga0501071_0005504 3300049587 Bacteria 8150
476 Ga0501071_0026394 3300049587 Bacteria 4077
477 Ga0501072_0073175 3300049588 Bacteria 2709
478 Ga0501072_0384249 3300049588 Bacteria 1114
479 Ga0501073_0020146 3300049589 Bacteria 4809
480 Ga0501073_0024524 3300049589 Bacteria 4330
481 Ga0501074_0044166 3300049590 Bacteria 3226
482 Ga0501074_0048390 3300049590 Bacteria 3071
483 Ga0501074_0201473 3300049590 Bacteria 1418
484 Ga0501075_0031610 3300049591 Bacteria 3930
485 Ga0501075_0132627 3300049591 Bacteria 1898
486 Ga0501076_0066428 3300049592 Bacteria 2879
487 Ga0501076_0108599 3300049592 Bacteria 2241
488 Ga0501077_0036311 3300049593 Bacteria 3138
489 Ga0501216_016875 3300049660 Bacteria 1244
490 Ga0501249_008702 3300049679 Bacteria 2107
491 Ga0501079_0012104 3300049741 Bacteria 6585
492 Ga0501079_0034872 3300049741 Bacteria 3872
493 Ga0501079_0598712 3300049741 Bacteria 867
494 Ga0501080_0030013 3300049742 Bacteria 5062
495 Ga0501080_0048184 3300049742 Bacteria 3966
496 Ga0501080_0083183 3300049742 Bacteria 2973
497 Ga0501080_0141309 3300049742 Bacteria 2225
498 Ga0501081_0381949 3300049743 Bacteria 1041
499 Ga0501083_0066129 3300049744 Bacteria 2407
500 Ga0501083_0193577 3300049744 Bacteria 1327
501 Ga0501035_0010489 3300049822 Bacteria 8586
502 Ga0501035_0028279 3300049822 Bacteria 5118
503 Ga0501035_0258304 3300049822 Bacteria 1477
504 Ga0501044_0021248 3300049823 Bacteria 6928
505 Ga0501044_0038540 3300049823 Bacteria 4990
506 Ga0501044_0226333 3300049823 Bacteria 1819
507 Ga0501044_0283862 3300049823 Bacteria 1588
508 Ga0501045_0004215 3300049824 Bacteria 9921
509 Ga0501045_0162517 3300049824 Bacteria 1663
510 nmdc:mga03683_10098_c1 3300050489 Bacteria 3378
511 nmdc:mga00v17_2893_c1 3300050491 Bacteria 8803
512 nmdc:mga00v17_62676_c1 3300050491 Bacteria 2288
513 nmdc:mga0yw44_165239_c1 3300050492 Bacteria 1451
514 nmdc:mga0k408_24254_c1 3300050493 Bacteria 3428
515 nmdc:mga06z11_30598_c1 3300050494 Bacteria 2606
516 nmdc:mga06z11_32242_c1 3300050494 Bacteria 2554
517 nmdc:mga04h51_119741_c1 3300050495 Bacteria 979
518 nmdc:mga04h51_44966_c1 3300050495 Bacteria 1458
519 nmdc:mga04h51_58007_c1 3300050495 Bacteria 1319
520 nmdc:mga05p37_20323_c1 3300050507 Bacteria 8034
521 nmdc:mga05p37_225468_c1 3300050507 Bacteria 2260
522 nmdc:mga05p37_251639_c1 3300050507 Bacteria 2119
523 nmdc:mga05p37_263255_c1 3300050507 Bacteria 2063
524 nmdc:mga05p37_4082_c1 3300050507 Bacteria 17066
525 nmdc:mga05p37_421151_c1 3300050507 Bacteria 1554
526 nmdc:mga05p37_85387_c1 3300050507 Unclassified 3889
527 nmdc:mga09592_202094_c1 3300050508 Bacteria 1721
528 nmdc:mga0qj67_103407_c1 3300050509 Bacteria 2298
529 nmdc:mga06r32_123175_c1 3300050510 Bacteria 2559
530 nmdc:mga08y16_227164_c1 3300050511 Bacteria 1931
531 nmdc:mga08y16_91810_c1 3300050511 Bacteria 3164
532 nmdc:mga0n895_13735_c1 3300050512 Bacteria 7322
533 nmdc:mga0n895_21122_c1 3300050512 Bacteria 6084
534 nmdc:mga0n895_25218_c1 3300050512 Bacteria 5615
535 nmdc:mga0n895_328444_c1 3300050512 Bacteria 1550
536 nmdc:mga0n895_331003_c1 3300050512 Bacteria 1543
537 nmdc:mga0n895_39557_c1 3300050512 Bacteria 4576
538 nmdc:mga0n895_606201_c1 3300050512 Bacteria 1097
539 nmdc:mga0n895_90244_c1 3300050512 Unclassified 3066
540 nmdc:mga0rr50_20339_c1 3300050513 Bacteria 4505
541 nmdc:mga0rr50_7943_c1 3300050513 Bacteria 6583
542 nmdc:mga08x19_53069_c1 3300050514 Bacteria 2608
543 nmdc:mga0a205_29348_c1 3300050515 Bacteria 4457
544 nmdc:mga0a205_337035_c1 3300050515 Bacteria 1377
545 nmdc:mga0a205_3418_c1 3300050515 Bacteria 14157
546 nmdc:mga0a205_36887_c1 3300050515 Bacteria 4699
547 nmdc:mga0a205_378299_c1 3300050515 Bacteria 1281
548 nmdc:mga0a205_5541_c1 3300050515 Bacteria 11370
549 Ga0495619_0019113 3300053085 Bacteria 4354
550 Ga0495619_0040801 3300053085 Bacteria 3034
551 Ga0495619_0118236 3300053085 Bacteria 1816
552 Ga0495619_0150297 3300053085 Bacteria 1607
553 Ga0500568_0000170 3300053139 Bacteria 56559
554 Ga0501084_0028534 3300054114 Bacteria 4665
555 Ga0501082_0011383 3300060353 Bacteria 7652
556 Ga0501082_0615356 3300060353 Bacteria 950
557 Ga0530510_0100820 3300061734 Bacteria 2111
558 Ga0530510_0222258 3300061734 Bacteria 1404
559 2643776262 2643221551 Bacteria 3750538
560 Ga0590071_042327
561 SwRhRL2b_contig_955068
562 JGI24751J29686_10005663
563 Ga0065712_10083651
564 Ga0065712_10093085
565 Ga0065712_10138186
566 Ga0065715_10000413
567 Ga0065715_10006642
568 Ga0065715_10033359
569 Ga0065715_10091633
570 Ga0065715_10113810
571 Ga0065715_10145145
572 Ga0065707_10101871
573 Ga0070676_10003384
574 Ga0070676_10004682
575 Ga0070676_10023936
576 Ga0070676_10087848
577 Ga0070690_100258270
578 Ga0070670_100001691
579 Ga0070670_100018976
580 Ga0070670_100028461
581 Ga0070670_100039599
582 Ga0070670_100048026
583 Ga0070670_100276671
584 Ga0070677_10000110
585 Ga0068869_100018786
586 Ga0068869_100084603
587 Ga0068869_100145773
588 Ga0068869_100418739
589 Ga0070666_10008003
590 Ga0070666_10012832
591 Ga0070666_10115531
592 Ga0070666_10182440
593 Ga0070680_100015957
594 Ga0070680_100033613
595 Ga0070680_100086019
596 Ga0070682_100127305
597 Ga0068868_100034923
598 Ga0068868_100054763
599 Ga0070660_100247480
600 Ga0070689_100260103
601 Ga0070689_100512946
602 Ga0070687_100158748
603 Ga0070692_10146641
604 Ga0070668_100000778
605 Ga0070668_100173928
606 Ga0070668_100274523
607 Ga0070669_100014105
608 Ga0070669_100125759
609 Ga0070669_100183455
610 Ga0070675_100001434
611 Ga0070675_100001862
612 Ga0070675_100007234
613 Ga0070675_100007498
614 Ga0070675_100011584
615 Ga0070675_100062181
616 Ga0070675_100109389
617 Ga0070675_100442251
618 Ga0070671_100004648
619 Ga0070671_100018867
620 Ga0070671_100132613
621 Ga0070671_100338489
622 Ga0070674_100005317
623 Ga0070674_100122285
624 Ga0070674_100253099
625 Ga0070674_100313713
626 Ga0070673_100001293
627 Ga0070673_100006461
628 Ga0070673_100012630
629 Ga0070673_100079743
630 Ga0070673_100097803
631 Ga0070673_100209099
632 Ga0070688_100006011
633 Ga0070659_100013038
634 Ga0070667_100002647
635 Ga0070667_100004875
636 Ga0070667_100005929
637 Ga0070667_100042104
638 Ga0070667_100163808
639 Ga0070667_100299024
640 Ga0070713_100021253
641 Ga0070713_100513329
642 Ga0070710_10132069
643 Ga0070701_10015945
644 Ga0070705_100204151
645 Ga0070700_100059543
646 Ga0070700_100290596
647 Ga0070694_100046414
648 Ga0070694_100068529
649 Ga0070708_100477917
650 Ga0070663_100009089
651 Ga0070663_100189953
652 Ga0070678_100002807
653 Ga0070678_100004953
654 Ga0070678_100188155
655 Ga0070681_10032407
656 Ga0070681_10134706
657 Ga0070681_10223640
658 Ga0068867_100021942
659 Ga0068867_100024543
660 Ga0068867_100095240
661 Ga0070685_10005103
662 Ga0070685_10080490
663 Ga0070685_10258388
664 Ga0070679_100297722
665 Ga0070679_100331138
666 Ga0070679_100353409
667 Ga0070679_100481904
668 Ga0070697_100125997
669 Ga0068853_100002843
670 Ga0068853_100210593
671 Ga0070672_100001083
672 Ga0070672_100005650
673 Ga0070672_100008035
674 Ga0070672_100028898
675 Ga0070686_100049056
676 Ga0070686_100184259
677 Ga0070695_100153008
678 Ga0070695_100183936
679 Ga0070665_100003069
680 Ga0070665_100087374
681 Ga0070704_100012147
682 Ga0070704_100175887
683 Ga0070704_100261739
684 Ga0068855_100041733
685 Ga0070664_100001116
686 Ga0070664_100146695
687 Ga0070664_100245369
688 Ga0070664_100270760
689 Ga0068857_100485696
690 Ga0068854_100025252
691 Ga0068854_100095768
692 Ga0068856_100128188
693 Ga0068856_100330198
694 Ga0070702_100127978
695 Ga0070702_100216848
696 Ga0068852_100106740
697 Ga0068859_100011838
698 Ga0068859_100062404
699 Ga0068859_100110262
700 Ga0068859_100501549
701 Ga0068859_100533002
702 Ga0068859_100550951
703 Ga0068859_100695639
704 Ga0068864_100031869
705 Ga0068864_100035862
706 Ga0068864_100049439
707 Ga0068864_100252738
708 Ga0068861_100473385
709 Ga0068851_10011326
710 Ga0068870_10022688
711 Ga0068863_100014836
712 Ga0068863_100024162
713 Ga0068863_100060189
714 Ga0068858_100008324
715 Ga0068858_100133688
716 Ga0068858_100402933
717 Ga0068860_100036110
718 Ga0068862_100519315
719 Ga0081455_10000152
720 Ga0081455_10162476
721 Ga0081538_10045073
722 Ga0070717_10146180
723 Ga0075365_10081552
724 Ga0075368_10006151
725 Ga0075368_10081435
726 Ga0075364_10004247
727 Ga0075364_10239922
728 Ga0075362_10009214
729 Ga0075367_10001648
730 Ga0075367_10142660
731 Ga0075366_10006546
732 Ga0075366_10024710
733 Ga0097621_100004774
734 Ga0097621_100111380
735 Ga0068871_100007298
736 Ga0068871_100008462
737 Ga0068871_100026000
738 Ga0075428_100082119
739 Ga0075428_100153110
740 Ga0075428_100551896
741 Ga0075428_100659817
742 Ga0075430_100007277
743 Ga0075430_100018544
744 Ga0075431_100057775
745 Ga0075431_100205795
746 Ga0075431_100254017
747 Ga0075433_10009190
748 Ga0075433_10049697
749 Ga0075433_10052794
750 Ga0075433_10201197
751 Ga0075433_10212911
752 Ga0075433_10375905
753 Ga0075433_10464379
754 Ga0075434_100001526
755 Ga0075434_100036140
756 Ga0075434_100042940
757 Ga0075434_100080581
758 Ga0075434_100380031
759 Ga0075434_100692116
760 Ga0075429_100182458
761 Ga0075429_100219527
762 Ga0075429_100237410
763 Ga0075429_100323297
764 Ga0068865_100044413
765 Ga0068865_100146329
766 Ga0075436_100158856
767 Ga0075436_100257434
768 Ga0097620_100011838
769 Ga0097620_100062402
770 Ga0097620_100110263
771 Ga0097620_100501586
772 Ga0097620_100533058
773 Ga0097620_100550901
774 Ga0097620_100695649
775 Ga0105240_10049136
776 Ga0111539_10056779
777 Ga0111539_10212910
778 Ga0111539_10357065
779 Ga0111539_10402482
780 Ga0105245_10415367
781 Ga0114129_10000560
782 Ga0114129_10002287
783 Ga0114129_10079823
784 Ga0114129_10102233
785 Ga0114129_10193513
786 Ga0114129_10593118
787 Ga0114129_10660706
788 Ga0114129_10900296
789 Ga0105243_10033450
790 Ga0105243_10627604
791 Ga0105242_10024555
792 Ga0105242_10092194
793 Ga0105248_10008350
794 Ga0105248_10012279
795 Ga0105248_10081566
796 Ga0105248_10184097
797 Ga0105248_10250946
798 Ga0105248_10407413
799 Ga0105249_10089815
800 Ga0105249_10392213
801 Ga0105239_10043488
802 Ga0105239_10092572
803 Ga0105246_10178432
804 Ga0157371_10058905
805 Ga0157374_10002278
806 Ga0157374_10097492
807 Ga0157378_10134593
808 Ga0163162_10011894
809 Ga0163162_10016344
810 Ga0163162_10027458
811 Ga0163162_10337158
812 Ga0157372_10087835
813 Ga0157375_10010937
814 Ga0157375_10833235
815 Ga0163163_10045321
816 Ga0163163_10086357
817 Ga0157380_10023365
818 Ga0157380_10038697
819 Ga0157377_10057712
820 Ga0157379_10035824
821 Ga0157376_10016916
822 Ga0157376_10018761
823 Ga0157376_10053206
824 Ga0182006_1118791
825 Ga0163161_10038486
826 Ga0163161_10044400
827 Ga0163161_10088733
828 Ga0207697_10012520
829 Ga0207656_10002066
830 Ga0207682_10000063
831 Ga0207642_10014167
832 Ga0207642_10098561
833 Ga0207642_10132070
834 Ga0207688_10006100
835 Ga0207688_10041270
836 Ga0207680_10002101
837 Ga0207680_10107527
838 Ga0207680_10144104
839 Ga0207645_10000195
840 Ga0207645_10005556
841 Ga0207645_10021948
842 Ga0207645_10053355
843 Ga0207643_10027180
844 Ga0207684_10183187
845 Ga0207707_10067805
846 Ga0207695_10161183
847 Ga0207660_10003749
848 Ga0207660_10018996
849 Ga0207660_10092189
850 Ga0207662_10002657
851 Ga0207662_10040448
852 Ga0207662_10095980
853 Ga0207657_10022040
854 Ga0207657_10308485
855 Ga0207652_10225736
856 Ga0207652_10289626
857 Ga0207652_10345661
858 Ga0207681_10027398
859 Ga0207681_10096615
860 Ga0207650_10003578
861 Ga0207650_10054198
862 Ga0207650_10077625
863 Ga0207650_10168659
864 Ga0207650_10219932
865 Ga0207650_10266985
866 Ga0207659_10007046
867 Ga0207659_10020047
868 Ga0207659_10365973
869 Ga0207687_10175134
870 Ga0207644_10008455
871 Ga0207644_10205125
872 Ga0207644_10260586
873 Ga0207690_10300201
874 Ga0207706_10012649
875 Ga0207686_10005665
876 Ga0207670_10212561
877 Ga0207669_10003605
878 Ga0207704_10114964
879 Ga0207691_10000370
880 Ga0207691_10010424
881 Ga0207691_10012973
882 Ga0207691_10016392
883 Ga0207711_10011189
884 Ga0207689_10004513
885 Ga0207689_10041834
886 Ga0207689_10078509
887 Ga0207689_10164515
888 Ga0207679_10003568
889 Ga0207679_10139600
890 Ga0207667_10362662
891 Ga0207667_10525625
892 Ga0207651_10003818
893 Ga0207651_10020081
894 Ga0207651_10037140
895 Ga0207651_10227320
896 Ga0207668_10001560
897 Ga0207640_10055424
898 Ga0207640_10228676
899 Ga0207640_10332220
900 Ga0207658_10008335
901 Ga0207658_10135882
902 Ga0207658_10252739
903 Ga0207658_10393353
904 Ga0207658_10414006
905 Ga0207677_10072956
906 Ga0207677_10193944
907 Ga0207677_10310648
908 Ga0207703_10012948
909 Ga0207703_10160567
910 Ga0207639_10022232
911 Ga0207678_10001630
912 Ga0207678_10033095
913 Ga0207708_10002411
914 Ga0207708_10199615
915 Ga0207641_10008925
916 Ga0207641_10016132
917 Ga0207641_10053709
918 Ga0207648_10000885
919 Ga0207648_10013515
920 Ga0207648_10120047
921 Ga0207676_10322086
922 Ga0207676_10442457
923 Ga0207674_10437490
924 Ga0207675_100220717
925 Ga0207683_10000009
926 Ga0207683_10007994
927 Ga0207683_10216420
928 Ga0207698_10022954
929 Ga0207698_10137222
930 Ga0207698_10388951
931 Ga0209813_10031144
932 Ga0209974_10104395
933 Ga0207428_10084673
934 Ga0268266_10012266
935 Ga0268266_10017458
936 Ga0268266_10058287
937 Ga0268265_10256974
938 Ga0268264_10011660
939 Ga0268264_10070293
940 Ga0307408_100304719
941 Ga0307413_10032643
942 Ga0307410_10057928
943 Ga0307407_10315564
944 Ga0307409_100515737
945 Ga0307416_100345653
946 Ga0373955_0179881
947 Ga0373931_0041545
948 Ga0373933_0091578
949 Ga0373947_0017407
950 Ga0373937_0032611
951 Ga0373937_0198442
952 Ga0373937_0348725
953 Ga0373925_0453818
954 Ga0436365_0143486
955 Ga0439434_0028387
956 Ga0439435_0102786
957 Ga0451577_0000124
958 Ga0451577_0034313
959 Ga0451577_0166155
960 Ga0453683_0124356
961 Ga0453683_0137991
962 Ga0453684_0000239
963 Ga0453684_0005447
964 Ga0453684_0022885
965 Ga0453684_0151487
966 Ga0451576_0001721
967 Ga0451576_1013658
968 Ga0495651_0319243
969 Ga0495664_0078372
970 Ga0495630_0303217
971 Ga0495621_0032528
972 Ga0495645_0001414
973 Ga0495667_0079376
974 Ga0495635_0066066
975 Ga0495647_0106295
976 Ga0495674_0321305
977 Ga0495674_0393386
978 Ga0495684_0141079
979 Ga0496103_0288372
980 Ga0496107_0251929
981 Ga0496108_0082193
982 Ga0496109_0051790
983 Ga0496109_0408308
984 Ga0496112_0080900
985 Ga0496113_0117564
986 Ga0496113_0286045
987 Ga0496114_0076111
988 Ga0496114_0081311
989 Ga0501031_0011326
990 Ga0501031_0036596
991 Ga0501032_0014214
992 Ga0501032_0032697
993 Ga0501032_0059718
994 Ga0501033_0001713
995 Ga0501033_0036585
996 Ga0501034_0020721
997 Ga0501036_0005512
998 Ga0501036_0007788
999 Ga0501036_0013340
1000 Ga0501036_0388422
1001 Ga0501037_0005442
1002 Ga0501037_0006490
1003 Ga0501037_0032011
1004 Ga0501038_0002607
1005 Ga0501038_0003273
1006 Ga0501038_0008941
1007 Ga0501039_0019627
1008 Ga0501039_0036617
1009 Ga0501039_0069322
1010 Ga0501039_0416393
1011 Ga0501039_0517649
1012 Ga0501040_0450883
1013 Ga0501040_0517201
1014 Ga0501042_0002223
1015 Ga0501043_0031023
1016 Ga0501043_0050196
1017 Ga0501046_0013331
1018 Ga0501046_0024053
1019 Ga0501046_0045948
1020 Ga0501046_0126331
1021 Ga0501047_0019399
1022 Ga0501047_0087783
1023 Ga0501047_0219291
1024 Ga0501048_0010166
1025 Ga0501048_0134876
1026 Ga0501067_0002805
1027 Ga0501067_0003806
1028 Ga0501068_0000840
1029 Ga0501068_0052971
1030 Ga0501069_0005327
1031 Ga0501069_0083307
1032 Ga0501070_0025976
1033 Ga0501070_0043930
1034 Ga0501071_0005504
1035 Ga0501071_0026394
1036 Ga0501072_0073175
1037 Ga0501072_0384249
1038 Ga0501073_0020146
1039 Ga0501073_0024524
1040 Ga0501074_0044166
1041 Ga0501074_0048390
1042 Ga0501074_0201473
1043 Ga0501075_0031610
1044 Ga0501075_0132627
1045 Ga0501076_0066428
1046 Ga0501076_0108599
1047 Ga0501077_0036311
1048 Ga0501216_016875
1049 Ga0501249_008702
1050 Ga0501079_0012104
1051 Ga0501079_0034872
1052 Ga0501079_0598712
1053 Ga0501080_0030013
1054 Ga0501080_0048184
1055 Ga0501080_0083183
1056 Ga0501080_0141309
1057 Ga0501081_0381949
1058 Ga0501083_0066129
1059 Ga0501083_0193577
1060 Ga0501035_0010489
1061 Ga0501035_0028279
1062 Ga0501035_0258304
1063 Ga0501044_0021248
1064 Ga0501044_0038540
1065 Ga0501044_0226333
1066 Ga0501044_0283862
1067 Ga0501045_0004215
1068 Ga0501045_0162517
1069 nmdc:mga03683_10098_c1
1070 nmdc:mga00v17_2893_c1
1071 nmdc:mga00v17_62676_c1
1072 nmdc:mga0yw44_165239_c1
1073 nmdc:mga0k408_24254_c1
1074 nmdc:mga06z11_30598_c1
1075 nmdc:mga06z11_32242_c1
1076 nmdc:mga04h51_119741_c1
1077 nmdc:mga04h51_44966_c1
1078 nmdc:mga04h51_58007_c1
1079 nmdc:mga05p37_20323_c1
1080 nmdc:mga05p37_225468_c1
1081 nmdc:mga05p37_251639_c1
1082 nmdc:mga05p37_263255_c1
1083 nmdc:mga05p37_4082_c1
1084 nmdc:mga05p37_421151_c1
1085 nmdc:mga05p37_85387_c1
1086 nmdc:mga09592_202094_c1
1087 nmdc:mga0qj67_103407_c1
1088 nmdc:mga06r32_123175_c1
1089 nmdc:mga08y16_227164_c1
1090 nmdc:mga08y16_91810_c1
1091 nmdc:mga0n895_13735_c1
1092 nmdc:mga0n895_21122_c1
1093 nmdc:mga0n895_25218_c1
1094 nmdc:mga0n895_328444_c1
1095 nmdc:mga0n895_331003_c1
1096 nmdc:mga0n895_39557_c1
1097 nmdc:mga0n895_606201_c1
1098 nmdc:mga0n895_90244_c1
1099 nmdc:mga0rr50_20339_c1
1100 nmdc:mga0rr50_7943_c1
1101 nmdc:mga08x19_53069_c1
1102 nmdc:mga0a205_29348_c1
1103 nmdc:mga0a205_337035_c1
1104 nmdc:mga0a205_3418_c1
1105 nmdc:mga0a205_36887_c1
1106 nmdc:mga0a205_378299_c1
1107 nmdc:mga0a205_5541_c1
1108 Ga0495619_0019113
1109 Ga0495619_0040801
1110 Ga0495619_0118236
1111 Ga0495619_0150297
1112 Ga0500568_0000170
1113 Ga0501084_0028534
1114 Ga0501082_0011383
1115 Ga0501082_0615356
1116 Ga0530510_0100820
1117 Ga0530510_0222258
1118 2643776262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04228

Zn_peptidase

Putative neutral zinc metallopeptidase

32

307

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmn-assembly1.cif.gz_A crystal structure of a putative hydrolase with a novel fold from chloroflexus aurantiacus 0.4149 111 244
4kbl-assembly3.cif.gz_B structure of hhari, a ring-ibr-ring ubiquitin ligase: autoinhibition of an ariadne-family e3 and insights into ligation mechanism 0.3158 121 255
5vot-assembly1.cif.gz_G structure of ampa receptor-tarp complex 0.306 173 252
8e0m-assembly4.cif.gz_L homotrimeric variant of tctrp9, bgl15 0.3055 120 247
3s5i-assembly1.cif.gz_A crystal structures of falcilysin, a m16 metalloprotease from the malaria parasite plasmodium falciparum 0.304 185 255
ID Description Score Start End Superfamily
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8293 1 258 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8079 1 258 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7414 6 258 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7105 6 258 3.40.390.10
af_A0A0R0G7E0_1084_1251_1.10.357.90 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Telomerase reverse transcriptase (TERT), thumb domain 0.5208 169 247 1.10.357.90
ID Description Score Start End GO Terms
AF-A0A4S0PXI0-F1-model_v4 deleted 0.979 48 149
AF-A0A3D3K4L7-F1-model_v4 Metalloprotease 0.9645 53 195 GO:0006508
GO:0008237
GO:0016020
AF-A0A537KK18-F1-model_v4 Metalloprotease 0.9468 51 261 GO:0006508
GO:0008237
GO:0016020
AF-A0A6N6XAB7-F1-model_v4 deleted 0.9462 54 159
AF-F0GZ41-F1-model_v4 Putative neutral zinc metallopeptidase 0.9439 68 151 GO:0016020

Map