F463604

General Info

Members Datasets Scaffolds Average Seq Length
559 329 1118 50

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_1188493|Ga0496111_1188493_344_517
Length 57
Sequence MSAPKEFTMIRKLASGEYRLYSRKTDPKTGKRRNLGTFASREKAEQHEREIQYFKRH

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
320 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
323 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 0
Rhizoplane 2.5
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 16.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_1188493 3300048914 Bacteria 541
2 JGI25164J39214_1003592 3300002772 Bacteria 1930
3 JGI25152J39213_1000235 3300002773 Bacteria 37077
4 JGI25150J39212_1000384 3300002774 Bacteria 21069
5 JGI25159J45721_1000103 3300002987 Bacteria 40372
6 Ga0006778J45830_1081201 3300003162 Unclassified 528
7 JGI25151J46595_10000696 3300003187 Bacteria 28239
8 JGI25153J46596_10000298 3300003215 Bacteria 37077
9 JGI25160J50197_1000255 3300003354 Bacteria 40372
10 JGI25161J50226_1000393 3300003374 Bacteria 21899
11 Ga0007429J51699_1041666 3300003579 Unclassified 1777
12 Ga0055526_1000357 3300003771 Bacteria 37077
13 Ga0055537_1000274 3300003773 Bacteria 37077
14 Ga0055524_1000400 3300003775 Bacteria 37077
15 Ga0055536_1024809 3300003781 Bacteria 1726
16 Ga0055534_1000255 3300003784 Bacteria 37077
17 Ga0055528_1000277 3300003790 Bacteria 43644
18 Ga0055540_1050579 3300003792 Bacteria 859
19 Ga0055540_1054323 3300003792 Bacteria 817
20 Ga0055531_10061471 3300003794 Bacteria 914
21 Ga0055543_1000262 3300004625 Bacteria 39412
22 Ga0065165_1000494 3300005262 Bacteria 60929
23 Ga0065712_10073549 3300005290 Bacteria 4350
24 Ga0065715_10088954 3300005293 Bacteria 20865
25 Ga0070658_10006708 3300005327 Bacteria 9322
26 Ga0070658_10622345 3300005327 Bacteria 936
27 Ga0070676_10064510 3300005328 Bacteria 2184
28 Ga0070690_100134318 3300005330 Bacteria 1674
29 Ga0070670_100002206 3300005331 Bacteria 16007
30 Ga0070670_100133033 3300005331 Bacteria 2148
31 Ga0070677_10806108 3300005333 Unclassified 536
32 Ga0068869_100170846 3300005334 Unclassified 1698
33 Ga0070666_10217238 3300005335 Bacteria 1348
34 Ga0070666_10748954 3300005335 Unclassified 718
35 Ga0070682_100089573 3300005337 Bacteria 2010
36 Ga0068868_100145840 3300005338 Bacteria 1946
37 Ga0068868_100612674 3300005338 Bacteria 966
38 Ga0070660_100362940 3300005339 Bacteria 1194
39 Ga0070689_100672413 3300005340 Unclassified 902
40 Ga0070689_100861339 3300005340 Bacteria 800
41 Ga0070691_10402940 3300005341 Bacteria 771
42 Ga0070687_100175327 3300005343 Bacteria 1280
43 Ga0070661_100587530 3300005344 Bacteria 899
44 Ga0070692_10386347 3300005345 Bacteria 880
45 Ga0070669_100072547 3300005353 Bacteria 2549
46 Ga0070669_101039180 3300005353 Unclassified 704
47 Ga0070675_100181988 3300005354 Bacteria 1817
48 Ga0070675_100482482 3300005354 Unclassified 1115
49 Ga0070675_100498899 3300005354 Unclassified 1097
50 Ga0070671_100156606 3300005355 Bacteria 1924
51 Ga0070671_100417957 3300005355 Bacteria 1148
52 Ga0070671_100629255 3300005355 Bacteria 928
53 Ga0070674_100214043 3300005356 Unclassified 1495
54 Ga0070673_100586613 3300005364 Bacteria 1015
55 Ga0070673_100598691 3300005364 Bacteria 1005
56 Ga0070673_100953011 3300005364 Bacteria 797
57 Ga0070673_101798306 3300005364 Unclassified 580
58 Ga0070688_100269243 3300005365 Unclassified 1220
59 Ga0070659_100294388 3300005366 Bacteria 1352
60 Ga0070659_102053007 3300005366 Bacteria 514
61 Ga0070667_100063538 3300005367 Bacteria 3129
62 Ga0070667_100072312 3300005367 Bacteria 2939
63 Ga0070667_101017889 3300005367 Unclassified 773
64 Ga0070709_10429944 3300005434 Bacteria 991
65 Ga0070709_10683712 3300005434 Bacteria 797
66 Ga0070714_101584565 3300005435 Bacteria 640
67 Ga0070701_10310072 3300005438 Bacteria 973
68 Ga0070711_101783238 3300005439 Unclassified 540
69 Ga0070700_100088246 3300005441 Unclassified 2018
70 Ga0070700_101662145 3300005441 Unclassified 547
71 Ga0070708_101191551 3300005445 Bacteria 712
72 Ga0070663_100392857 3300005455 Bacteria 1132
73 Ga0070663_100509926 3300005455 Bacteria 1000
74 Ga0070663_101857250 3300005455 Unclassified 541
75 Ga0070678_100697097 3300005456 Unclassified 914
76 Ga0070678_101255433 3300005456 Bacteria 688
77 Ga0070662_100320345 3300005457 Unclassified 1264
78 Ga0070662_101795989 3300005457 Bacteria 530
79 Ga0068867_100329362 3300005459 Bacteria 1268
80 Ga0068867_101934525 3300005459 Unclassified 556
81 Ga0068867_101959322 3300005459 Unclassified 553
82 Ga0070706_100019944 3300005467 Bacteria 6181
83 Ga0070707_100445799 3300005468 Bacteria 1255
84 Ga0070707_102008114 3300005468 Bacteria 546
85 Ga0070698_100000446 3300005471 Bacteria 43861
86 Ga0070699_100083519 3300005518 Bacteria 2786
87 Ga0070699_100515345 3300005518 Bacteria 1087
88 Ga0070697_100737810 3300005536 Unclassified 870
89 Ga0070697_101625450 3300005536 Bacteria 578
90 Ga0068853_100000144 3300005539 Bacteria 48463
91 Ga0068853_100772537 3300005539 Bacteria 919
92 Ga0068853_101013058 3300005539 Bacteria 800
93 Ga0068853_101597285 3300005539 Bacteria 632
94 Ga0068853_101863463 3300005539 Unclassified 583
95 Ga0070672_100094291 3300005543 Bacteria 2420
96 Ga0070672_101526993 3300005543 Unclassified 599
97 Ga0070686_100063385 3300005544 Bacteria 2394
98 Ga0070686_100305717 3300005544 Bacteria 1181
99 Ga0070686_100366342 3300005544 Bacteria 1087
100 Ga0070696_100059173 3300005546 Bacteria 2677
101 Ga0070696_100797205 3300005546 Unclassified 777
102 Ga0070665_100025373 3300005548 Bacteria 5973
103 Ga0070665_101155413 3300005548 Bacteria 785
104 Ga0070704_100730720 3300005549 Bacteria 880
105 Ga0068855_100003683 3300005563 Bacteria 18751
106 Ga0068855_100014683 3300005563 Bacteria 9435
107 Ga0068855_100124334 3300005563 Bacteria 2951
108 Ga0068855_100176446 3300005563 Bacteria 2417
109 Ga0068855_100183313 3300005563 Bacteria 2366
110 Ga0068855_101989855 3300005563 Unclassified 587
111 Ga0070664_100072178 3300005564 Bacteria 2960
112 Ga0070664_101287763 3300005564 Bacteria 690
113 Ga0068857_100029665 3300005577 Bacteria 4828
114 Ga0068857_100265122 3300005577 Bacteria 1577
115 Ga0068857_100275238 3300005577 Bacteria 1548
116 Ga0068857_100767230 3300005577 Bacteria 919
117 Ga0068854_100421101 3300005578 Bacteria 1109
118 Ga0068854_101148657 3300005578 Bacteria 694
119 Ga0068852_100056365 3300005616 Bacteria 3396
120 Ga0068852_100464998 3300005616 Bacteria 1254
121 Ga0068852_100656219 3300005616 Bacteria 1057
122 Ga0068852_100994620 3300005616 Bacteria 857
123 Ga0068852_101321793 3300005616 Bacteria 743
124 Ga0068852_102524499 3300005616 Bacteria 534
125 Ga0068859_100009256 3300005617 Bacteria 9946
126 Ga0068859_100047552 3300005617 Bacteria 4310
127 Ga0068859_100124743 3300005617 Bacteria 2643
128 Ga0068859_100164509 3300005617 Bacteria 2298
129 Ga0068859_100803111 3300005617 Unclassified 1028
130 Ga0068859_100993213 3300005617 Bacteria 922
131 Ga0068859_102538701 3300005617 Unclassified 564
132 Ga0068864_100295279 3300005618 Unclassified 1516
133 Ga0068864_100357234 3300005618 Bacteria 1380
134 Ga0068864_100370559 3300005618 Bacteria 1355
135 Ga0068864_101440714 3300005618 Bacteria 691
136 Ga0068861_100038548 3300005719 Bacteria 3560
137 Ga0068861_100701312 3300005719 Bacteria 940
138 Ga0068851_10216403 3300005834 Bacteria 1075
139 Ga0068870_10033600 3300005840 Bacteria 2619
140 Ga0068870_10134470 3300005840 Bacteria 1440
141 Ga0068870_10181574 3300005840 Bacteria 1263
142 Ga0068870_10220947 3300005840 Bacteria 1160
143 Ga0068870_10235128 3300005840 Unclassified 1128
144 Ga0068863_100027429 3300005841 Bacteria 5432
145 Ga0068863_100067682 3300005841 Bacteria 3378
146 Ga0068863_100248971 3300005841 Bacteria 1716
147 Ga0068863_100657150 3300005841 Unclassified 1040
148 Ga0068863_100778169 3300005841 Bacteria 954
149 Ga0068863_101945069 3300005841 Unclassified 598
150 Ga0068858_100002592 3300005842 Bacteria 18197
151 Ga0068858_100421640 3300005842 Bacteria 1283
152 Ga0068858_101260413 3300005842 Bacteria 727
153 Ga0068858_101606677 3300005842 Bacteria 642
154 Ga0068860_100004560 3300005843 Bacteria 14139
155 Ga0068862_100141878 3300005844 Unclassified 2133
156 Ga0068862_100207488 3300005844 Bacteria 1769
157 Ga0068862_101557726 3300005844 Unclassified 667
158 Ga0070716_100451328 3300006173 Unclassified 937
159 Ga0075369_10183460 3300006186 Bacteria 963
160 Ga0075369_10325625 3300006186 Bacteria 719
161 Ga0075366_10013655 3300006195 Bacteria 4630
162 Ga0097621_101990820 3300006237 Bacteria 555
163 Ga0068871_100318592 3300006358 Bacteria 1369
164 Ga0068871_100347122 3300006358 Bacteria 1312
165 Ga0068871_100898176 3300006358 Bacteria 821
166 Ga0068871_101290049 3300006358 Unclassified 687
167 Ga0075430_100092261 3300006846 Bacteria 2532
168 Ga0075433_10019141 3300006852 Bacteria 5696
169 Ga0075434_100184225 3300006871 Unclassified 2108
170 Ga0075434_101310675 3300006871 Bacteria 735
171 Ga0068865_100311685 3300006881 Bacteria 1263
172 Ga0068865_100897126 3300006881 Bacteria 771
173 Ga0075436_100460886 3300006914 Bacteria 926
174 Ga0097620_100009256 3300006931 Bacteria 9946
175 Ga0097620_100047552 3300006931 Bacteria 4310
176 Ga0097620_100124748 3300006931 Bacteria 2643
177 Ga0097620_100164521 3300006931 Bacteria 2298
178 Ga0097620_100803257 3300006931 Unclassified 1028
179 Ga0097620_100993184 3300006931 Bacteria 922
180 Ga0097620_102537625 3300006931 Unclassified 564
181 Ga0075435_100032265 3300007076 Bacteria 4135
182 Ga0105244_10449760 3300009036 Bacteria 592
183 Ga0105240_10118884 3300009093 Bacteria 3185
184 Ga0105240_11076809 3300009093 Bacteria 856
185 Ga0105240_12387567 3300009093 Bacteria 547
186 Ga0111539_10017821 3300009094 Bacteria 8794
187 Ga0111539_12491867 3300009094 Unclassified 600
188 Ga0105243_10136154 3300009148 Bacteria 2090
189 Ga0105243_10835338 3300009148 Bacteria 911
190 Ga0105243_11722566 3300009148 Bacteria 656
191 Ga0105242_10189301 3300009176 Bacteria 1821
192 Ga0105242_11736183 3300009176 Bacteria 661
193 Ga0105248_10012808 3300009177 Bacteria 9251
194 Ga0105248_10075100 3300009177 Bacteria 3799
195 Ga0105248_12908929 3300009177 Unclassified 546
196 Ga0105248_13378797 3300009177 Unclassified 507
197 Ga0105237_10553041 3300009545 Bacteria 1157
198 Ga0105237_11133457 3300009545 Bacteria 789
199 Ga0105238_10000360 3300009551 Bacteria 48787
200 Ga0105238_11564738 3300009551 Unclassified 689
201 Ga0105249_10341897 3300009553 Bacteria 1513
202 Ga0105249_11295200 3300009553 Bacteria 800
203 Ga0099796_10040775 3300010159 Bacteria 1569
204 Ga0105246_10392968 3300011119 Bacteria 1149
205 Ga0105246_11152269 3300011119 Bacteria 711
206 Ga0105246_11971147 3300011119 Bacteria 563
207 Ga0157343_1025614 3300012488 Bacteria 564
208 Ga0157319_1011841 3300012497 Bacteria 727
209 Ga0157324_1039580 3300012506 Unclassified 571
210 Ga0157371_10328240 3300013102 Bacteria 1111
211 Ga0157370_10494639 3300013104 Bacteria 1123
212 Ga0157370_10645834 3300013104 Bacteria 967
213 Ga0157369_10423917 3300013105 Bacteria 1379
214 Ga0157374_10001413 3300013296 Bacteria 20349
215 Ga0157374_11534055 3300013296 Unclassified 690
216 Ga0157374_11546244 3300013296 Bacteria 687
217 Ga0163162_10000493 3300013306 Bacteria 36632
218 Ga0163162_10419894 3300013306 Unclassified 1470
219 Ga0163162_10721328 3300013306 Unclassified 1118
220 Ga0163162_11603275 3300013306 Unclassified 742
221 Ga0163162_13388949 3300013306 Bacteria 509
222 Ga0157372_10393677 3300013307 Bacteria 1614
223 Ga0157375_10014399 3300013308 Bacteria 7054
224 Ga0157375_11029386 3300013308 Unclassified 962
225 Ga0157375_11391844 3300013308 Bacteria 826
226 Ga0157375_11927694 3300013308 Unclassified 702
227 Ga0163163_10077100 3300014325 Bacteria 3329
228 Ga0163163_10144456 3300014325 Bacteria 2422
229 Ga0163163_12229285 3300014325 Unclassified 607
230 Ga0157380_10006892 3300014326 Bacteria 8035
231 Ga0157380_12494995 3300014326 Bacteria 583
232 Ga0157380_13293265 3300014326 Bacteria 516
233 Ga0157379_10001066 3300014968 Bacteria 22342
234 Ga0157379_10004359 3300014968 Bacteria 12104
235 Ga0157379_10079668 3300014968 Bacteria 2933
236 Ga0157379_10726334 3300014968 Bacteria 934
237 Ga0157376_10095138 3300014969 Bacteria 2590
238 Ga0157376_10102744 3300014969 Bacteria 2501
239 Ga0157376_11254312 3300014969 Bacteria 770
240 Ga0157376_11832803 3300014969 Bacteria 643
241 Ga0157376_12570234 3300014969 Bacteria 549
242 Ga0163161_10025747 3300017792 Bacteria 4165
243 Ga0163161_10708059 3300017792 Bacteria 839
244 Ga0197907_11055148 3300020069 Bacteria 677
245 Ga0206356_11040483 3300020070 Bacteria 725
246 Ga0206349_1403748 3300020075 Bacteria 845
247 Ga0206349_1977504 3300020075 Unclassified 750
248 Ga0206355_1154125 3300020076 Bacteria 594
249 Ga0206351_10614300 3300020077 Bacteria 870
250 Ga0206350_10036426 3300020080 Bacteria 571
251 Ga0224712_10378855 3300022467 Bacteria 672
252 Ga0224572_1058861 3300024225 Bacteria 712
253 Ga0209436_100387 3300025208 Bacteria 19886
254 Ga0207427_100756 3300025231 Bacteria 14739
255 Ga0207425_1000087 3300025245 Bacteria 93219
256 Ga0209677_103196 3300025253 Bacteria 5493
257 Ga0209129_1000007 3300025258 Bacteria 771325
258 Ga0209565_1000038 3300025263 Bacteria 286433
259 Ga0209673_1000080 3300025273 Bacteria 223503
260 Ga0209130_1000137 3300025284 Bacteria 116784
261 Ga0209675_1000102 3300025291 Bacteria 123742
262 Ga0209676_1001078 3300025292 Bacteria 30809
263 Ga0209025_1000056 3300025294 Bacteria 316188
264 Ga0209564_1000073 3300025295 Bacteria 288080
265 Ga0209758_1000044 3300025297 Bacteria 398448
266 Ga0209256_1000020 3300025299 Bacteria 542402
267 Ga0207426_1000001 3300025302 Bacteria 1341301
268 Ga0209051_1014060 3300025303 Bacteria 3757
269 Ga0209051_1072071 3300025303 Bacteria 1035
270 Ga0209257_1000222 3300025304 Bacteria 134717
271 Ga0207656_10134962 3300025321 Bacteria 1159
272 Ga0207682_10546484 3300025893 Unclassified 548
273 Ga0207688_10170542 3300025901 Bacteria 1294
274 Ga0207688_10415325 3300025901 Bacteria 836
275 Ga0207680_10009795 3300025903 Bacteria 4768
276 Ga0207680_10225680 3300025903 Bacteria 1286
277 Ga0207680_10628194 3300025903 Bacteria 769
278 Ga0207699_10297850 3300025906 Unclassified 1125
279 Ga0207645_10556413 3300025907 Unclassified 778
280 Ga0207643_10027951 3300025908 Bacteria 3130
281 Ga0207643_10042289 3300025908 Bacteria 2569
282 Ga0207643_10235086 3300025908 Unclassified 1125
283 Ga0207643_10267023 3300025908 Bacteria 1058
284 Ga0207643_10496944 3300025908 Bacteria 779
285 Ga0207705_10232559 3300025909 Bacteria 1402
286 Ga0207705_10410493 3300025909 Bacteria 1048
287 Ga0207707_11323439 3300025912 Unclassified 578
288 Ga0207695_10190920 3300025913 Bacteria 1966
289 Ga0207671_10358196 3300025914 Bacteria 1157
290 Ga0207671_10518141 3300025914 Bacteria 951
291 Ga0207671_11191453 3300025914 Bacteria 596
292 Ga0207662_10284043 3300025918 Bacteria 1096
293 Ga0207662_10509724 3300025918 Bacteria 829
294 Ga0207657_10878799 3300025919 Bacteria 691
295 Ga0207646_10389601 3300025922 Bacteria 1259
296 Ga0207646_10701500 3300025922 Bacteria 905
297 Ga0207646_11687610 3300025922 Bacteria 544
298 Ga0207681_10028400 3300025923 Bacteria 3623
299 Ga0207681_11308595 3300025923 Unclassified 609
300 Ga0207694_10007986 3300025924 Bacteria 8000
301 Ga0207650_10007704 3300025925 Bacteria 7337
302 Ga0207650_10683088 3300025925 Bacteria 867
303 Ga0207659_10010476 3300025926 Bacteria 5829
304 Ga0207659_10259098 3300025926 Bacteria 1414
305 Ga0207659_10309300 3300025926 Bacteria 1301
306 Ga0207659_10376877 3300025926 Bacteria 1182
307 Ga0207659_10683000 3300025926 Unclassified 879
308 Ga0207687_10480300 3300025927 Bacteria 1035
309 Ga0207664_11324921 3300025929 Bacteria 640
310 Ga0207644_10013157 3300025931 Bacteria 5509
311 Ga0207644_10079709 3300025931 Bacteria 2416
312 Ga0207644_10103606 3300025931 Bacteria 2141
313 Ga0207644_10823049 3300025931 Unclassified 777
314 Ga0207690_10254892 3300025932 Bacteria 1357
315 Ga0207690_11072054 3300025932 Bacteria 671
316 Ga0207706_10368438 3300025933 Bacteria 1248
317 Ga0207706_10907124 3300025933 Unclassified 744
318 Ga0207706_11490759 3300025933 Bacteria 552
319 Ga0207709_10063059 3300025935 Bacteria 2322
320 Ga0207709_11134948 3300025935 Bacteria 643
321 Ga0207669_10197366 3300025937 Unclassified 1457
322 Ga0207691_10002136 3300025940 Bacteria 19342
323 Ga0207691_10016566 3300025940 Bacteria 6997
324 Ga0207691_11011086 3300025940 Unclassified 694
325 Ga0207711_10192933 3300025941 Bacteria 1857
326 Ga0207711_10521985 3300025941 Bacteria 1107
327 Ga0207689_10013829 3300025942 Bacteria 6875
328 Ga0207689_11479177 3300025942 Bacteria 568
329 Ga0207679_10053745 3300025945 Bacteria 2961
330 Ga0207679_11884292 3300025945 Unclassified 545
331 Ga0207679_11953773 3300025945 Bacteria 534
332 Ga0207667_10017333 3300025949 Bacteria 8110
333 Ga0207667_10163739 3300025949 Bacteria 2287
334 Ga0207667_10179466 3300025949 Bacteria 2175
335 Ga0207667_10195432 3300025949 Bacteria 2075
336 Ga0207667_10448279 3300025949 Bacteria 1311
337 Ga0207651_10026225 3300025960 Bacteria 3636
338 Ga0207651_10175866 3300025960 Bacteria 1693
339 Ga0207651_10870402 3300025960 Bacteria 801
340 Ga0207712_10585274 3300025961 Bacteria 964
341 Ga0207712_11155207 3300025961 Bacteria 690
342 Ga0207640_10307280 3300025981 Bacteria 1257
343 Ga0207658_10049261 3300025986 Bacteria 3095
344 Ga0207658_10235307 3300025986 Bacteria 1548
345 Ga0207677_10115525 3300026023 Bacteria 2008
346 Ga0207703_10017324 3300026035 Bacteria 5624
347 Ga0207703_10869251 3300026035 Bacteria 863
348 Ga0207639_10002316 3300026041 Bacteria 12782
349 Ga0207639_10227803 3300026041 Bacteria 1614
350 Ga0207639_10503989 3300026041 Bacteria 1106
351 Ga0207639_10897819 3300026041 Bacteria 828
352 Ga0207639_11900811 3300026041 Bacteria 556
353 Ga0207639_11961508 3300026041 Bacteria 546
354 Ga0207678_10106965 3300026067 Bacteria 2386
355 Ga0207641_10029600 3300026088 Bacteria 4530
356 Ga0207641_10086907 3300026088 Bacteria 2727
357 Ga0207641_10088523 3300026088 Bacteria 2704
358 Ga0207641_11423421 3300026088 Bacteria 694
359 Ga0207641_11875054 3300026088 Unclassified 601
360 Ga0207648_10048891 3300026089 Bacteria 3702
361 Ga0207648_10245598 3300026089 Bacteria 1595
362 Ga0207648_10458350 3300026089 Bacteria 1162
363 Ga0207676_10057013 3300026095 Bacteria 3075
364 Ga0207676_10086608 3300026095 Bacteria 2559
365 Ga0207676_10143272 3300026095 Bacteria 2048
366 Ga0207676_10543446 3300026095 Bacteria 1109
367 Ga0207674_10089965 3300026116 Bacteria 3061
368 Ga0207674_10686180 3300026116 Bacteria 989
369 Ga0207674_12005518 3300026116 Bacteria 544
370 Ga0207675_100015291 3300026118 Bacteria 7161
371 Ga0207675_100090175 3300026118 Bacteria 2882
372 Ga0207683_10088675 3300026121 Bacteria 2753
373 Ga0207683_10655228 3300026121 Archaea 973
374 Ga0207683_11993407 3300026121 Bacteria 529
375 Ga0207698_10054390 3300026142 Bacteria 3080
376 Ga0207698_10175966 3300026142 Bacteria 1890
377 Ga0207698_10443429 3300026142 Bacteria 1251
378 Ga0207698_10640008 3300026142 Bacteria 1052
379 Ga0207698_11256310 3300026142 Bacteria 755
380 Ga0209967_1050341 3300027364 Bacteria 640
381 Ga0209982_1018324 3300027552 Bacteria 1071
382 Ga0210002_1011190 3300027617 Bacteria 1385
383 Ga0209588_1083225 3300027671 Bacteria 1033
384 Ga0209974_10018580 3300027876 Bacteria 2307
385 Ga0207428_10040442 3300027907 Bacteria 3781
386 Ga0207428_10309103 3300027907 Unclassified 1169
387 Ga0268266_10013522 3300028379 Bacteria 7027
388 Ga0268266_10184133 3300028379 Bacteria 1903
389 Ga0268266_11137381 3300028379 Bacteria 755
390 Ga0268266_11811353 3300028379 Bacteria 585
391 Ga0268265_10288366 3300028380 Bacteria 1472
392 Ga0268265_11345475 3300028380 Unclassified 715
393 Ga0268264_10084593 3300028381 Bacteria 2720
394 Ga0307511_10352124 3300030521 Unclassified 632
395 Ga0265331_10180853 3300031250 Bacteria 952
396 Ga0307513_10225768 3300031456 Bacteria 1690
397 Ga0307513_10910002 3300031456 Bacteria 587
398 Ga0265313_10040532 3300031595 Bacteria 2302
399 Ga0265313_10041485 3300031595 Bacteria 2267
400 Ga0265314_10048075 3300031711 Bacteria 2997
401 Ga0307516_10000109 3300031730 Bacteria 94762
402 Ga0307412_12305818 3300031911 Bacteria 502
403 Ga0307409_100393924 3300031995 Bacteria 1321
404 Ga0307510_10043442 3300033180 Bacteria 4885
405 Ga0373959_0080190 3300034820 Bacteria 751
406 Ga0373934_0012810 3300035086 Bacteria 3168
407 Ga0373952_0197215 3300035092 Bacteria 588
408 Ga0373945_0556160 3300035116 Unclassified 515
409 Ga0373953_0172353 3300035117 Bacteria 932
410 Ga0373946_0670466 3300035171 Bacteria 541
411 Ga0373955_0056377 3300035172 Bacteria 2156
412 Ga0373955_0871390 3300035172 Unclassified 554
413 Ga0373924_0531740 3300035410 Bacteria 529
414 Ga0373947_0374261 3300035725 Unclassified 958
415 Ga0373937_0226584 3300036401 Bacteria 1760
416 Ga0373937_0422686 3300036401 Bacteria 1265
417 Ga0373937_1108693 3300036401 Bacteria 740
418 Ga0373925_0038909 3300037068 Bacteria 3518
419 Ga0395899_0002695 3300037312 Bacteria 14318
420 Ga0395899_0605781 3300037312 Bacteria 697
421 Ga0395900_0031162 3300037418 Bacteria 5477
422 Ga0395898_0258089 3300037466 Bacteria 1662
423 Ga0395905_0001125 3300037471 Bacteria 33497
424 Ga0395901_0002376 3300038443 Bacteria 19144
425 Ga0436360_0942728 3300039438 Bacteria 1461
426 Ga0451839_0367076 3300041496 Bacteria 535
427 Ga0439432_087092 3300042006 Bacteria 942
428 Ga0439458_0104520 3300042157 Bacteria 737
429 Ga0439435_0004616 3300042436 Bacteria 2981
430 Ga0439464_0225280 3300042439 Unclassified 602
431 Ga0451576_1077798 3300045051 Unclassified 841
432 Ga0451576_1623734 3300045051 Bacteria 670
433 Ga0495617_061716 3300046452 Unclassified 1239
434 Ga0495603_0065782 3300046455 Bacteria 2136
435 Ga0495603_0068931 3300046455 Bacteria 2081
436 Ga0495603_0711089 3300046455 Unclassified 574
437 Ga0495590_0302901 3300046457 Unclassified 601
438 Ga0495629_0004986 3300046459 Bacteria 9957
439 Ga0495629_0111259 3300046459 Bacteria 1909
440 Ga0495651_0012650 3300046462 Bacteria 6512
441 Ga0495651_0045248 3300046462 Bacteria 3410
442 Ga0495653_0149944 3300046463 Bacteria 1630
443 Ga0495580_0062372 3300046472 Bacteria 2615
444 Ga0495580_0093996 3300046472 Bacteria 2086
445 Ga0495580_0103356 3300046472 Bacteria 1980
446 Ga0495582_0122448 3300046473 Unclassified 1466
447 Ga0495605_0360370 3300046474 Unclassified 609
448 Ga0495639_0058100 3300046475 Bacteria 1768
449 Ga0495662_0001888 3300046476 Bacteria 10512
450 Ga0495664_0025964 3300046477 Bacteria 3410
451 Ga0495585_0055181 3300046492 Bacteria 2196
452 Ga0495594_0000897 3300046499 Bacteria 15406
453 Ga0495594_0001918 3300046499 Bacteria 10844
454 Ga0495596_0116139 3300046500 Unclassified 1039
455 Ga0495583_0033219 3300046506 Bacteria 2482
456 Ga0495606_0025664 3300046507 Bacteria 4215
457 Ga0495606_0091357 3300046507 Bacteria 1872
458 Ga0495608_0593108 3300046511 Unclassified 665
459 Ga0495610_0107405 3300046512 Bacteria 1241
460 Ga0495618_0384341 3300046514 Bacteria 861
461 Ga0495628_0032557 3300046516 Bacteria 4208
462 Ga0495630_0617363 3300046517 Unclassified 831
463 Ga0495644_0000080 3300046523 Bacteria 47069
464 Ga0495648_0206570 3300046524 Bacteria 979
465 Ga0495666_0044836 3300046526 Bacteria 2134
466 Ga0495652_0087739 3300046529 Bacteria 2551
467 Ga0495665_0001689 3300046531 Bacteria 11854
468 Ga0495640_0034601 3300046533 Bacteria 3580
469 Ga0495640_0795953 3300046533 Bacteria 564
470 Ga0495586_0207165 3300046535 Bacteria 1112
471 Ga0495645_0044461 3300046543 Bacteria 3239
472 Ga0495633_0177037 3300046558 Unclassified 982
473 Ga0495667_0051521 3300046559 Bacteria 2715
474 Ga0495634_0086423 3300046642 Bacteria 2042
475 Ga0495634_0241571 3300046642 Bacteria 1108
476 Ga0495625_0000895 3300046660 Bacteria 40237
477 Ga0495625_0018437 3300046660 Bacteria 5449
478 Ga0495625_0051518 3300046660 Bacteria 2951
479 Ga0495625_0778535 3300046660 Unclassified 558
480 Ga0495635_0009267 3300046663 Bacteria 6875
481 Ga0495659_0366086 3300046664 Bacteria 618
482 Ga0495661_0158340 3300046665 Bacteria 1218
483 Ga0495588_0071114 3300046674 Bacteria 1809
484 Ga0495588_0519271 3300046674 Bacteria 624
485 Ga0495657_0575590 3300046675 Unclassified 653
486 Ga0495599_0011673 3300046678 Bacteria 5402
487 Ga0495623_0061421 3300046679 Bacteria 2357
488 Ga0495646_0018102 3300046680 Bacteria 4461
489 Ga0495647_0445605 3300046681 Bacteria 599
490 Ga0495669_0108628 3300046684 Bacteria 1293
491 Ga0495613_0008107 3300046689 Bacteria 7810
492 Ga0495613_0132235 3300046689 Bacteria 1786
493 Ga0495624_0001639 3300046690 Bacteria 17159
494 Ga0495671_0173674 3300046692 Bacteria 1047
495 Ga0495600_0021147 3300046809 Bacteria 4165
496 Ga0495581_0076492 3300047315 Bacteria 1936
497 Ga0495604_0046471 3300047317 Bacteria 3384
498 Ga0495674_0011112 3300047319 Bacteria 8500
499 Ga0495672_0001214 3300047320 Bacteria 26001
500 Ga0495672_0294937 3300047320 Unclassified 770
501 Ga0495676_0012081 3300047321 Bacteria 7789
502 Ga0495676_0659167 3300047321 Bacteria 679
503 Ga0495680_0682126 3300047322 Bacteria 680
504 Ga0495675_0001969 3300047444 Bacteria 12255
505 Ga0495677_0083212 3300047445 Unclassified 1201
506 Ga0495684_0066542 3300047471 Bacteria 2740
507 Ga0495684_0871584 3300047471 Bacteria 582
508 Ga0495686_0082715 3300047472 Bacteria 1959
509 Ga0495593_0042769 3300047673 Bacteria 2431
510 Ga0495593_0229499 3300047673 Bacteria 931
511 Ga0495602_1148144 3300048088 Unclassified 508
512 Ga0495614_0001730 3300048089 Bacteria 9537
513 Ga0495614_0030274 3300048089 Bacteria 2329
514 Ga0496100_0316578 3300048903 Bacteria 1171
515 Ga0496101_0413952 3300048904 Bacteria 1062
516 Ga0496101_0434345 3300048904 Bacteria 1035
517 Ga0496101_1078164 3300048904 Unclassified 631
518 Ga0496104_0072078 3300048907 Bacteria 3285
519 Ga0496105_0888191 3300048908 Bacteria 672
520 Ga0496108_0057155 3300048911 Bacteria 3278
521 Ga0496109_0134296 3300048912 Bacteria 2311
522 Ga0496110_1871156 3300048913 Unclassified 510
523 Ga0496112_0067252 3300048915 Bacteria 3536
524 Ga0496112_1036640 3300048915 Unclassified 739
525 Ga0496113_0151023 3300048916 Bacteria 1832
526 Ga0496115_0299933 3300048918 Bacteria 1317
527 Ga0496121_0015785 3300048924 Bacteria 7866
528 Ga0496122_0027404 3300048925 Bacteria 4873
529 Ga0496122_0313980 3300048925 Bacteria 837
530 Ga0496123_0018786 3300048926 Bacteria 5479
531 Ga0496123_0035145 3300048926 Bacteria 3577
532 Ga0496124_0312773 3300048927 Bacteria 1129
533 Ga0496126_0712799 3300048929 Unclassified 778
534 Ga0501067_0557774 3300049583 Bacteria 642
535 Ga0501074_0563073 3300049590 Bacteria 807
536 Ga0501081_0423762 3300049743 Unclassified 987
537 nmdc:mga0k408_2265_c1 3300050493 Bacteria 10268
538 nmdc:mga05p37_37507_c1 3300050507 Bacteria 5943
539 nmdc:mga0qj67_195625_c1 3300050509 Bacteria 1643
540 nmdc:mga06r32_3433_c1 3300050510 Bacteria 14177
541 nmdc:mga06r32_349077_c1 3300050510 Unclassified 1464
542 nmdc:mga06r32_859285_c1 3300050510 Bacteria 865
543 nmdc:mga08y16_9794_c1 3300050511 Bacteria 10057
544 nmdc:mga0n895_1498955_c1 3300050512 Bacteria 641
545 nmdc:mga0rr50_178872_c1 3300050513 Bacteria 1733
546 nmdc:mga0a205_512033_c1 3300050515 Unclassified 1057
547 Ga0495655_0121984 3300053083 Bacteria 794
548 Ga0500554_091123 3300053102 Bacteria 1013
549 Ga0500555_056897 3300053103 Bacteria 1059
550 Ga0500595_000012 3300053119 Bacteria 255472
551 Ga0500597_000256 3300053120 Bacteria 10905
552 Ga0500608_037953 3300053122 Bacteria 2302
553 Ga0500608_195938 3300053122 Bacteria 840
554 Ga0500658_0000131 3300053134 Bacteria 35339
555 Ga0500568_0000784 3300053139 Bacteria 22410
556 Ga0500616_0003482 3300053153 Bacteria 11970
557 Ga0587114_025835 3300059655 Bacteria 864
558 Ga0501082_0154036 3300060353 Bacteria 1997
559 Ga0530510_0790653 3300061734 Bacteria 724
560 Ga0496111_1188493
561 JGI25164J39214_1003592
562 JGI25152J39213_1000235
563 JGI25150J39212_1000384
564 JGI25159J45721_1000103
565 Ga0006778J45830_1081201
566 JGI25151J46595_10000696
567 JGI25153J46596_10000298
568 JGI25160J50197_1000255
569 JGI25161J50226_1000393
570 Ga0007429J51699_1041666
571 Ga0055526_1000357
572 Ga0055537_1000274
573 Ga0055524_1000400
574 Ga0055536_1024809
575 Ga0055534_1000255
576 Ga0055528_1000277
577 Ga0055540_1050579
578 Ga0055540_1054323
579 Ga0055531_10061471
580 Ga0055543_1000262
581 Ga0065165_1000494
582 Ga0065712_10073549
583 Ga0065715_10088954
584 Ga0070658_10006708
585 Ga0070658_10622345
586 Ga0070676_10064510
587 Ga0070690_100134318
588 Ga0070670_100002206
589 Ga0070670_100133033
590 Ga0070677_10806108
591 Ga0068869_100170846
592 Ga0070666_10217238
593 Ga0070666_10748954
594 Ga0070682_100089573
595 Ga0068868_100145840
596 Ga0068868_100612674
597 Ga0070660_100362940
598 Ga0070689_100672413
599 Ga0070689_100861339
600 Ga0070691_10402940
601 Ga0070687_100175327
602 Ga0070661_100587530
603 Ga0070692_10386347
604 Ga0070669_100072547
605 Ga0070669_101039180
606 Ga0070675_100181988
607 Ga0070675_100482482
608 Ga0070675_100498899
609 Ga0070671_100156606
610 Ga0070671_100417957
611 Ga0070671_100629255
612 Ga0070674_100214043
613 Ga0070673_100586613
614 Ga0070673_100598691
615 Ga0070673_100953011
616 Ga0070673_101798306
617 Ga0070688_100269243
618 Ga0070659_100294388
619 Ga0070659_102053007
620 Ga0070667_100063538
621 Ga0070667_100072312
622 Ga0070667_101017889
623 Ga0070709_10429944
624 Ga0070709_10683712
625 Ga0070714_101584565
626 Ga0070701_10310072
627 Ga0070711_101783238
628 Ga0070700_100088246
629 Ga0070700_101662145
630 Ga0070708_101191551
631 Ga0070663_100392857
632 Ga0070663_100509926
633 Ga0070663_101857250
634 Ga0070678_100697097
635 Ga0070678_101255433
636 Ga0070662_100320345
637 Ga0070662_101795989
638 Ga0068867_100329362
639 Ga0068867_101934525
640 Ga0068867_101959322
641 Ga0070706_100019944
642 Ga0070707_100445799
643 Ga0070707_102008114
644 Ga0070698_100000446
645 Ga0070699_100083519
646 Ga0070699_100515345
647 Ga0070697_100737810
648 Ga0070697_101625450
649 Ga0068853_100000144
650 Ga0068853_100772537
651 Ga0068853_101013058
652 Ga0068853_101597285
653 Ga0068853_101863463
654 Ga0070672_100094291
655 Ga0070672_101526993
656 Ga0070686_100063385
657 Ga0070686_100305717
658 Ga0070686_100366342
659 Ga0070696_100059173
660 Ga0070696_100797205
661 Ga0070665_100025373
662 Ga0070665_101155413
663 Ga0070704_100730720
664 Ga0068855_100003683
665 Ga0068855_100014683
666 Ga0068855_100124334
667 Ga0068855_100176446
668 Ga0068855_100183313
669 Ga0068855_101989855
670 Ga0070664_100072178
671 Ga0070664_101287763
672 Ga0068857_100029665
673 Ga0068857_100265122
674 Ga0068857_100275238
675 Ga0068857_100767230
676 Ga0068854_100421101
677 Ga0068854_101148657
678 Ga0068852_100056365
679 Ga0068852_100464998
680 Ga0068852_100656219
681 Ga0068852_100994620
682 Ga0068852_101321793
683 Ga0068852_102524499
684 Ga0068859_100009256
685 Ga0068859_100047552
686 Ga0068859_100124743
687 Ga0068859_100164509
688 Ga0068859_100803111
689 Ga0068859_100993213
690 Ga0068859_102538701
691 Ga0068864_100295279
692 Ga0068864_100357234
693 Ga0068864_100370559
694 Ga0068864_101440714
695 Ga0068861_100038548
696 Ga0068861_100701312
697 Ga0068851_10216403
698 Ga0068870_10033600
699 Ga0068870_10134470
700 Ga0068870_10181574
701 Ga0068870_10220947
702 Ga0068870_10235128
703 Ga0068863_100027429
704 Ga0068863_100067682
705 Ga0068863_100248971
706 Ga0068863_100657150
707 Ga0068863_100778169
708 Ga0068863_101945069
709 Ga0068858_100002592
710 Ga0068858_100421640
711 Ga0068858_101260413
712 Ga0068858_101606677
713 Ga0068860_100004560
714 Ga0068862_100141878
715 Ga0068862_100207488
716 Ga0068862_101557726
717 Ga0070716_100451328
718 Ga0075369_10183460
719 Ga0075369_10325625
720 Ga0075366_10013655
721 Ga0097621_101990820
722 Ga0068871_100318592
723 Ga0068871_100347122
724 Ga0068871_100898176
725 Ga0068871_101290049
726 Ga0075430_100092261
727 Ga0075433_10019141
728 Ga0075434_100184225
729 Ga0075434_101310675
730 Ga0068865_100311685
731 Ga0068865_100897126
732 Ga0075436_100460886
733 Ga0097620_100009256
734 Ga0097620_100047552
735 Ga0097620_100124748
736 Ga0097620_100164521
737 Ga0097620_100803257
738 Ga0097620_100993184
739 Ga0097620_102537625
740 Ga0075435_100032265
741 Ga0105244_10449760
742 Ga0105240_10118884
743 Ga0105240_11076809
744 Ga0105240_12387567
745 Ga0111539_10017821
746 Ga0111539_12491867
747 Ga0105243_10136154
748 Ga0105243_10835338
749 Ga0105243_11722566
750 Ga0105242_10189301
751 Ga0105242_11736183
752 Ga0105248_10012808
753 Ga0105248_10075100
754 Ga0105248_12908929
755 Ga0105248_13378797
756 Ga0105237_10553041
757 Ga0105237_11133457
758 Ga0105238_10000360
759 Ga0105238_11564738
760 Ga0105249_10341897
761 Ga0105249_11295200
762 Ga0099796_10040775
763 Ga0105246_10392968
764 Ga0105246_11152269
765 Ga0105246_11971147
766 Ga0157343_1025614
767 Ga0157319_1011841
768 Ga0157324_1039580
769 Ga0157371_10328240
770 Ga0157370_10494639
771 Ga0157370_10645834
772 Ga0157369_10423917
773 Ga0157374_10001413
774 Ga0157374_11534055
775 Ga0157374_11546244
776 Ga0163162_10000493
777 Ga0163162_10419894
778 Ga0163162_10721328
779 Ga0163162_11603275
780 Ga0163162_13388949
781 Ga0157372_10393677
782 Ga0157375_10014399
783 Ga0157375_11029386
784 Ga0157375_11391844
785 Ga0157375_11927694
786 Ga0163163_10077100
787 Ga0163163_10144456
788 Ga0163163_12229285
789 Ga0157380_10006892
790 Ga0157380_12494995
791 Ga0157380_13293265
792 Ga0157379_10001066
793 Ga0157379_10004359
794 Ga0157379_10079668
795 Ga0157379_10726334
796 Ga0157376_10095138
797 Ga0157376_10102744
798 Ga0157376_11254312
799 Ga0157376_11832803
800 Ga0157376_12570234
801 Ga0163161_10025747
802 Ga0163161_10708059
803 Ga0197907_11055148
804 Ga0206356_11040483
805 Ga0206349_1403748
806 Ga0206349_1977504
807 Ga0206355_1154125
808 Ga0206351_10614300
809 Ga0206350_10036426
810 Ga0224712_10378855
811 Ga0224572_1058861
812 Ga0209436_100387
813 Ga0207427_100756
814 Ga0207425_1000087
815 Ga0209677_103196
816 Ga0209129_1000007
817 Ga0209565_1000038
818 Ga0209673_1000080
819 Ga0209130_1000137
820 Ga0209675_1000102
821 Ga0209676_1001078
822 Ga0209025_1000056
823 Ga0209564_1000073
824 Ga0209758_1000044
825 Ga0209256_1000020
826 Ga0207426_1000001
827 Ga0209051_1014060
828 Ga0209051_1072071
829 Ga0209257_1000222
830 Ga0207656_10134962
831 Ga0207682_10546484
832 Ga0207688_10170542
833 Ga0207688_10415325
834 Ga0207680_10009795
835 Ga0207680_10225680
836 Ga0207680_10628194
837 Ga0207699_10297850
838 Ga0207645_10556413
839 Ga0207643_10027951
840 Ga0207643_10042289
841 Ga0207643_10235086
842 Ga0207643_10267023
843 Ga0207643_10496944
844 Ga0207705_10232559
845 Ga0207705_10410493
846 Ga0207707_11323439
847 Ga0207695_10190920
848 Ga0207671_10358196
849 Ga0207671_10518141
850 Ga0207671_11191453
851 Ga0207662_10284043
852 Ga0207662_10509724
853 Ga0207657_10878799
854 Ga0207646_10389601
855 Ga0207646_10701500
856 Ga0207646_11687610
857 Ga0207681_10028400
858 Ga0207681_11308595
859 Ga0207694_10007986
860 Ga0207650_10007704
861 Ga0207650_10683088
862 Ga0207659_10010476
863 Ga0207659_10259098
864 Ga0207659_10309300
865 Ga0207659_10376877
866 Ga0207659_10683000
867 Ga0207687_10480300
868 Ga0207664_11324921
869 Ga0207644_10013157
870 Ga0207644_10079709
871 Ga0207644_10103606
872 Ga0207644_10823049
873 Ga0207690_10254892
874 Ga0207690_11072054
875 Ga0207706_10368438
876 Ga0207706_10907124
877 Ga0207706_11490759
878 Ga0207709_10063059
879 Ga0207709_11134948
880 Ga0207669_10197366
881 Ga0207691_10002136
882 Ga0207691_10016566
883 Ga0207691_11011086
884 Ga0207711_10192933
885 Ga0207711_10521985
886 Ga0207689_10013829
887 Ga0207689_11479177
888 Ga0207679_10053745
889 Ga0207679_11884292
890 Ga0207679_11953773
891 Ga0207667_10017333
892 Ga0207667_10163739
893 Ga0207667_10179466
894 Ga0207667_10195432
895 Ga0207667_10448279
896 Ga0207651_10026225
897 Ga0207651_10175866
898 Ga0207651_10870402
899 Ga0207712_10585274
900 Ga0207712_11155207
901 Ga0207640_10307280
902 Ga0207658_10049261
903 Ga0207658_10235307
904 Ga0207677_10115525
905 Ga0207703_10017324
906 Ga0207703_10869251
907 Ga0207639_10002316
908 Ga0207639_10227803
909 Ga0207639_10503989
910 Ga0207639_10897819
911 Ga0207639_11900811
912 Ga0207639_11961508
913 Ga0207678_10106965
914 Ga0207641_10029600
915 Ga0207641_10086907
916 Ga0207641_10088523
917 Ga0207641_11423421
918 Ga0207641_11875054
919 Ga0207648_10048891
920 Ga0207648_10245598
921 Ga0207648_10458350
922 Ga0207676_10057013
923 Ga0207676_10086608
924 Ga0207676_10143272
925 Ga0207676_10543446
926 Ga0207674_10089965
927 Ga0207674_10686180
928 Ga0207674_12005518
929 Ga0207675_100015291
930 Ga0207675_100090175
931 Ga0207683_10088675
932 Ga0207683_10655228
933 Ga0207683_11993407
934 Ga0207698_10054390
935 Ga0207698_10175966
936 Ga0207698_10443429
937 Ga0207698_10640008
938 Ga0207698_11256310
939 Ga0209967_1050341
940 Ga0209982_1018324
941 Ga0210002_1011190
942 Ga0209588_1083225
943 Ga0209974_10018580
944 Ga0207428_10040442
945 Ga0207428_10309103
946 Ga0268266_10013522
947 Ga0268266_10184133
948 Ga0268266_11137381
949 Ga0268266_11811353
950 Ga0268265_10288366
951 Ga0268265_11345475
952 Ga0268264_10084593
953 Ga0307511_10352124
954 Ga0265331_10180853
955 Ga0307513_10225768
956 Ga0307513_10910002
957 Ga0265313_10040532
958 Ga0265313_10041485
959 Ga0265314_10048075
960 Ga0307516_10000109
961 Ga0307412_12305818
962 Ga0307409_100393924
963 Ga0307510_10043442
964 Ga0373959_0080190
965 Ga0373934_0012810
966 Ga0373952_0197215
967 Ga0373945_0556160
968 Ga0373953_0172353
969 Ga0373946_0670466
970 Ga0373955_0056377
971 Ga0373955_0871390
972 Ga0373924_0531740
973 Ga0373947_0374261
974 Ga0373937_0226584
975 Ga0373937_0422686
976 Ga0373937_1108693
977 Ga0373925_0038909
978 Ga0395899_0002695
979 Ga0395899_0605781
980 Ga0395900_0031162
981 Ga0395898_0258089
982 Ga0395905_0001125
983 Ga0395901_0002376
984 Ga0436360_0942728
985 Ga0451839_0367076
986 Ga0439432_087092
987 Ga0439458_0104520
988 Ga0439435_0004616
989 Ga0439464_0225280
990 Ga0451576_1077798
991 Ga0451576_1623734
992 Ga0495617_061716
993 Ga0495603_0065782
994 Ga0495603_0068931
995 Ga0495603_0711089
996 Ga0495590_0302901
997 Ga0495629_0004986
998 Ga0495629_0111259
999 Ga0495651_0012650
1000 Ga0495651_0045248
1001 Ga0495653_0149944
1002 Ga0495580_0062372
1003 Ga0495580_0093996
1004 Ga0495580_0103356
1005 Ga0495582_0122448
1006 Ga0495605_0360370
1007 Ga0495639_0058100
1008 Ga0495662_0001888
1009 Ga0495664_0025964
1010 Ga0495585_0055181
1011 Ga0495594_0000897
1012 Ga0495594_0001918
1013 Ga0495596_0116139
1014 Ga0495583_0033219
1015 Ga0495606_0025664
1016 Ga0495606_0091357
1017 Ga0495608_0593108
1018 Ga0495610_0107405
1019 Ga0495618_0384341
1020 Ga0495628_0032557
1021 Ga0495630_0617363
1022 Ga0495644_0000080
1023 Ga0495648_0206570
1024 Ga0495666_0044836
1025 Ga0495652_0087739
1026 Ga0495665_0001689
1027 Ga0495640_0034601
1028 Ga0495640_0795953
1029 Ga0495586_0207165
1030 Ga0495645_0044461
1031 Ga0495633_0177037
1032 Ga0495667_0051521
1033 Ga0495634_0086423
1034 Ga0495634_0241571
1035 Ga0495625_0000895
1036 Ga0495625_0018437
1037 Ga0495625_0051518
1038 Ga0495625_0778535
1039 Ga0495635_0009267
1040 Ga0495659_0366086
1041 Ga0495661_0158340
1042 Ga0495588_0071114
1043 Ga0495588_0519271
1044 Ga0495657_0575590
1045 Ga0495599_0011673
1046 Ga0495623_0061421
1047 Ga0495646_0018102
1048 Ga0495647_0445605
1049 Ga0495669_0108628
1050 Ga0495613_0008107
1051 Ga0495613_0132235
1052 Ga0495624_0001639
1053 Ga0495671_0173674
1054 Ga0495600_0021147
1055 Ga0495581_0076492
1056 Ga0495604_0046471
1057 Ga0495674_0011112
1058 Ga0495672_0001214
1059 Ga0495672_0294937
1060 Ga0495676_0012081
1061 Ga0495676_0659167
1062 Ga0495680_0682126
1063 Ga0495675_0001969
1064 Ga0495677_0083212
1065 Ga0495684_0066542
1066 Ga0495684_0871584
1067 Ga0495686_0082715
1068 Ga0495593_0042769
1069 Ga0495593_0229499
1070 Ga0495602_1148144
1071 Ga0495614_0001730
1072 Ga0495614_0030274
1073 Ga0496100_0316578
1074 Ga0496101_0413952
1075 Ga0496101_0434345
1076 Ga0496101_1078164
1077 Ga0496104_0072078
1078 Ga0496105_0888191
1079 Ga0496108_0057155
1080 Ga0496109_0134296
1081 Ga0496110_1871156
1082 Ga0496112_0067252
1083 Ga0496112_1036640
1084 Ga0496113_0151023
1085 Ga0496115_0299933
1086 Ga0496121_0015785
1087 Ga0496122_0027404
1088 Ga0496122_0313980
1089 Ga0496123_0018786
1090 Ga0496123_0035145
1091 Ga0496124_0312773
1092 Ga0496126_0712799
1093 Ga0501067_0557774
1094 Ga0501074_0563073
1095 Ga0501081_0423762
1096 nmdc:mga0k408_2265_c1
1097 nmdc:mga05p37_37507_c1
1098 nmdc:mga0qj67_195625_c1
1099 nmdc:mga06r32_3433_c1
1100 nmdc:mga06r32_349077_c1
1101 nmdc:mga06r32_859285_c1
1102 nmdc:mga08y16_9794_c1
1103 nmdc:mga0n895_1498955_c1
1104 nmdc:mga0rr50_178872_c1
1105 nmdc:mga0a205_512033_c1
1106 Ga0495655_0121984
1107 Ga0500554_091123
1108 Ga0500555_056897
1109 Ga0500595_000012
1110 Ga0500597_000256
1111 Ga0500608_037953
1112 Ga0500608_195938
1113 Ga0500658_0000131
1114 Ga0500568_0000784
1115 Ga0500616_0003482
1116 Ga0587114_025835
1117 Ga0501082_0154036
1118 Ga0530510_0790653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4l-assembly1.cif.gz_A crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.7394 1 29
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.7222 2 38
3mzl-assembly2.cif.gz_E sec13/sec31 edge element, loop deletion mutant 0.707 2 32
1gcc-assembly1.cif.gz_A solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box dna, minimized average structure 0.6992 2 36
7p4l-assembly1.cif.gz_B crystal structure of the trimeric ectodomain of archaeal fusexin1 (fsx1) 0.6983 1 29
ID Description Score Start End Superfamily
af_P76389_435_515_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9114 1 13 3.30.465.10
af_Q9AWS7_65_121_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8212 2 36 3.30.730.10
af_P0DH87_218_327_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.789 1 29 2.10.25.10
af_C0P9B0_100_150_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7795 2 36 3.30.730.10
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7784 2 36 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.012 1 39
AF-A0A521Z023-F1-model_v4 MBL fold metallo-hydrolase 1.012 1 43 GO:0016740
GO:0016787
AF-A0A2V7EQ65-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.007 1 48
AF-A0A1G6YAM6-F1-model_v4 AP2-like DNA-binding integrase domain-containing protein 1.005 1 49
AF-A0A6I6MUD1-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.004 1 49

Map