F463596

General Info

Members Datasets Scaffolds Average Seq Length
559 298 547 265

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0002833|Ga0495668_0002833_11275_12087
Length 270
Sequence MQQYLDLLQHIIDKGVTKTDRTGTGTTSCFGYQMRFDLQQGFPLVTTKKLHLKSIVYELLWFLQGDTNTRYLKEHNVSIWDEWADENGNLGPVYGKQWRSWQGANGKTIDQISDALNQIKNNPDSRRIIVSAWNVAELPEMALMPCHALFQFYVAPGVNGGKGKLSCQLYQRSADVFLGVPFNIASYALLTMMMAQVCDLEPGDFVHTFGDVHLYSNHIEQARLQLTRTPNALPTMKLNPAVKDLFSFTFEDFTLENYQPHPAIKAPVAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221684 Massilia sp. Root133 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
7 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
8 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
9 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
10 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
269 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
274 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
275 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
278 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
279 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
280 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
281 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
285 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.72
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0.54
Rhizoplane 2.5
Rhizosphere 87.84
Stem 0
Stem Tuber 0
Unclassified 5.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3160980 2162886007 Bacteria 4069
2 JGI24740J21852_10019370 3300001979 Bacteria 2397
3 JGI25156J39149_1001190 3300002705 Bacteria 11580
4 JGI25162J39368_1004954 3300002737 Bacteria 2824
5 JGI25154J39366_1000986 3300002738 Bacteria 11547
6 JGI25157J39369_1001849 3300002741 Bacteria 6593
7 JGI25406J46586_10012099 3300003203 Bacteria 3757
8 rootH2_10013019 3300003320 Bacteria 26132
9 rootL2_10241602 3300003322 Bacteria 2435
10 JGI25160J50197_1000425 3300003354 Bacteria 26592
11 Ga0055532_1000077 3300003758 Bacteria 122193
12 Ga0055525_1000008 3300003759 Bacteria 604287
13 Ga0055542_1012403 3300003762 Bacteria 1475
14 Ga0065704_10072654 3300005289 Bacteria 8196
15 Ga0070658_10025472 3300005327 Bacteria 4741
16 Ga0070658_10028978 3300005327 Bacteria 4446
17 Ga0070658_10196661 3300005327 Bacteria 1700
18 Ga0070676_10120820 3300005328 Bacteria 1644
19 Ga0070683_100007781 3300005329 Bacteria 9072
20 Ga0070683_100522899 3300005329 Bacteria 1134
21 Ga0070670_100050548 3300005331 Bacteria 3572
22 Ga0070670_100210256 3300005331 Bacteria 1691
23 Ga0068869_100010056 3300005334 Bacteria 6154
24 Ga0068869_100017750 3300005334 Bacteria 4833
25 Ga0070666_10000736 3300005335 Bacteria 19845
26 Ga0070666_10089513 3300005335 Bacteria 2112
27 Ga0070680_100000088 3300005336 Bacteria 51479
28 Ga0070680_100038613 3300005336 Bacteria 3861
29 Ga0068868_100025378 3300005338 Bacteria 4508
30 Ga0068868_100045260 3300005338 Bacteria 3443
31 Ga0068868_100224499 3300005338 Bacteria 1574
32 Ga0070660_100042601 3300005339 Bacteria 3465
33 Ga0070660_100058718 3300005339 Bacteria 2982
34 Ga0070660_100080999 3300005339 Bacteria 2548
35 Ga0070660_100105690 3300005339 Bacteria 2235
36 Ga0070660_100132997 3300005339 Bacteria 1992
37 Ga0070660_100260270 3300005339 Bacteria 1416
38 Ga0070689_100026131 3300005340 Bacteria 4393
39 Ga0070661_100017437 3300005344 Bacteria 5095
40 Ga0070668_100036467 3300005347 Bacteria 3753
41 Ga0070668_100189194 3300005347 Bacteria 1685
42 Ga0070669_100147955 3300005353 Bacteria 1816
43 Ga0070675_100038520 3300005354 Bacteria 3897
44 Ga0070671_100014761 3300005355 Bacteria 6312
45 Ga0070671_100110999 3300005355 Bacteria 2304
46 Ga0070674_100121079 3300005356 Bacteria 1937
47 Ga0070673_100023997 3300005364 Bacteria 4463
48 Ga0070673_100536616 3300005364 Bacteria 1061
49 Ga0070688_100008462 3300005365 Bacteria 5584
50 Ga0070659_100010190 3300005366 Bacteria 6915
51 Ga0070659_100043243 3300005366 Bacteria 3523
52 Ga0070659_100078813 3300005366 Bacteria 2629
53 Ga0070659_100082890 3300005366 Bacteria 2562
54 Ga0070663_100375911 3300005455 Bacteria 1156
55 Ga0070678_100013458 3300005456 Bacteria 5131
56 Ga0070678_100131890 3300005456 Bacteria 1986
57 Ga0070662_100151157 3300005457 Bacteria 1808
58 Ga0068867_100008426 3300005459 Bacteria 7272
59 Ga0070679_100000003 3300005530 Bacteria 307836
60 Ga0070679_100075145 3300005530 Bacteria 3369
61 Ga0070679_100347760 3300005530 Bacteria 1430
62 Ga0070672_100027937 3300005543 Bacteria 4214
63 Ga0070665_100043589 3300005548 Bacteria 4508
64 Ga0068855_100045035 3300005563 Bacteria 5219
65 Ga0068855_100079309 3300005563 Bacteria 3808
66 Ga0068855_100737942 3300005563 Bacteria 1051
67 Ga0070664_100024674 3300005564 Bacteria 4977
68 Ga0070664_100048325 3300005564 Bacteria 3595
69 Ga0070664_100094830 3300005564 Bacteria 2588
70 Ga0070664_100273688 3300005564 Bacteria 1521
71 Ga0068857_100046969 3300005577 Bacteria 3832
72 Ga0068857_100075562 3300005577 Bacteria 3004
73 Ga0068854_100094454 3300005578 Bacteria 2231
74 Ga0068859_100000037 3300005617 Bacteria 165480
75 Ga0068859_100005033 3300005617 Bacteria 13412
76 Ga0068859_100154534 3300005617 Bacteria 2371
77 Ga0068859_100167475 3300005617 Bacteria 2277
78 Ga0068859_100338016 3300005617 Bacteria 1600
79 Ga0068864_100009579 3300005618 Bacteria 7987
80 Ga0068864_100053693 3300005618 Bacteria 3477
81 Ga0068864_100055678 3300005618 Bacteria 3415
82 Ga0068864_100303277 3300005618 Bacteria 1496
83 Ga0068866_10024844 3300005718 Bacteria 2810
84 Ga0068861_100044059 3300005719 Bacteria 3353
85 Ga0068851_10008075 3300005834 Bacteria 4857
86 Ga0068851_10010366 3300005834 Bacteria 4350
87 Ga0068851_10117872 3300005834 Bacteria 1424
88 Ga0068870_10012327 3300005840 Bacteria 3992
89 Ga0068863_100032377 3300005841 Bacteria 4984
90 Ga0068858_100002312 3300005842 Bacteria 19265
91 Ga0068858_100841454 3300005842 Bacteria 896
92 Ga0068860_100003825 3300005843 Bacteria 15482
93 Ga0068860_100026415 3300005843 Bacteria 5597
94 Ga0068860_100030783 3300005843 Bacteria 5160
95 Ga0081539_10000531 3300005985 Bacteria 79191
96 Ga0075366_10107926 3300006195 Bacteria 1674
97 Ga0097621_100032447 3300006237 Bacteria 4151
98 Ga0097621_100068063 3300006237 Bacteria 2936
99 Ga0068871_100083751 3300006358 Bacteria 2646
100 Ga0097620_100000037 3300006931 Bacteria 165480
101 Ga0097620_100005033 3300006931 Bacteria 13412
102 Ga0097620_100154525 3300006931 Bacteria 2371
103 Ga0097620_100167474 3300006931 Bacteria 2277
104 Ga0097620_100338022 3300006931 Bacteria 1600
105 Ga0105240_10051294 3300009093 Bacteria 5193
106 Ga0105245_10057483 3300009098 Bacteria 3498
107 Ga0105245_10181275 3300009098 Bacteria 2012
108 Ga0105245_10386836 3300009098 Bacteria 1394
109 Ga0105247_10045640 3300009101 Bacteria 2689
110 Ga0105241_10001242 3300009174 Bacteria 19468
111 Ga0105241_10063295 3300009174 Bacteria 2854
112 Ga0105241_10119939 3300009174 Bacteria 2116
113 Ga0105242_10031141 3300009176 Bacteria 4258
114 Ga0105242_10119104 3300009176 Bacteria 2263
115 Ga0105237_10011912 3300009545 Bacteria 9193
116 Ga0105237_10019373 3300009545 Bacteria 7028
117 Ga0105238_10054006 3300009551 Bacteria 4036
118 Ga0105239_10050855 3300010375 Bacteria 4544
119 Ga0105246_10059113 3300011119 Bacteria 2658
120 Ga0157373_10049310 3300013100 Bacteria 3001
121 Ga0157371_10003328 3300013102 Bacteria 14681
122 Ga0157370_10058627 3300013104 Bacteria 3659
123 Ga0157370_10163019 3300013104 Bacteria 2074
124 Ga0157370_10486663 3300013104 Bacteria 1134
125 Ga0157369_10040311 3300013105 Bacteria 5098
126 Ga0157369_10109403 3300013105 Bacteria 2939
127 Ga0157374_10000500 3300013296 Bacteria 35513
128 Ga0157374_10065573 3300013296 Bacteria 3410
129 Ga0157374_10148425 3300013296 Bacteria 2279
130 Ga0157374_10583976 3300013296 Bacteria 1127
131 Ga0157378_10036726 3300013297 Bacteria 4336
132 Ga0157378_10057003 3300013297 Bacteria 3482
133 Ga0157378_10057524 3300013297 Bacteria 3465
134 Ga0157378_10059615 3300013297 Bacteria 3405
135 Ga0157378_10123678 3300013297 Bacteria 2387
136 Ga0157378_10140088 3300013297 Bacteria 2245
137 Ga0163162_10004768 3300013306 Bacteria 13086
138 Ga0163162_10319034 3300013306 Bacteria 1686
139 Ga0157372_10089689 3300013307 Bacteria 3494
140 Ga0157372_10201163 3300013307 Bacteria 2307
141 Ga0157372_10352456 3300013307 Bacteria 1715
142 Ga0157372_10390004 3300013307 Bacteria 1623
143 Ga0157372_10432922 3300013307 Bacteria 1533
144 Ga0157375_10091600 3300013308 Bacteria 3102
145 Ga0157375_10149311 3300013308 Bacteria 2471
146 Ga0157375_10455800 3300013308 Bacteria 1444
147 Ga0163163_10001732 3300014325 Bacteria 18387
148 Ga0163163_10018090 3300014325 Bacteria 6586
149 Ga0157380_10022365 3300014326 Bacteria 4758
150 Ga0182008_10071418 3300014497 Bacteria 1708
151 Ga0157377_10013348 3300014745 Bacteria 4157
152 Ga0157379_10058571 3300014968 Bacteria 3445
153 Ga0157376_10032889 3300014969 Bacteria 4169
154 Ga0209435_100082 3300025206 Bacteria 45642
155 Ga0209147_100122 3300025229 Bacteria 138553
156 Ga0209563_100003 3300025230 Bacteria 1932942
157 Ga0209437_100081 3300025233 Bacteria 271072
158 Ga0209258_100739 3300025242 Bacteria 21164
159 Ga0209646_1000152 3300025246 Bacteria 97484
160 Ga0209026_1000126 3300025250 Bacteria 122422
161 Ga0209677_102681 3300025253 Bacteria 6422
162 Ga0209148_1000576 3300025254 Bacteria 34082
163 Ga0209759_1000193 3300025256 Bacteria 97484
164 Ga0207426_1000032 3300025302 Bacteria 457997
165 Ga0207656_10007990 3300025321 Bacteria 3879
166 Ga0207656_10139487 3300025321 Bacteria 1142
167 Ga0207682_10029991 3300025893 Bacteria 2177
168 Ga0207682_10039977 3300025893 Bacteria 1909
169 Ga0207642_10012030 3300025899 Bacteria 3110
170 Ga0207710_10166457 3300025900 Bacteria 1076
171 Ga0207688_10050439 3300025901 Bacteria 2329
172 Ga0207680_10002758 3300025903 Bacteria 8216
173 Ga0207680_10024859 3300025903 Bacteria 3295
174 Ga0207645_10008175 3300025907 Bacteria 7325
175 Ga0207645_10113229 3300025907 Bacteria 1757
176 Ga0207643_10061389 3300025908 Bacteria 2147
177 Ga0207705_10094360 3300025909 Bacteria 2194
178 Ga0207654_10001781 3300025911 Bacteria 11188
179 Ga0207654_10009833 3300025911 Bacteria 4864
180 Ga0207654_10364325 3300025911 Bacteria 998
181 Ga0207671_10001737 3300025914 Bacteria 24547
182 Ga0207660_10000231 3300025917 Bacteria 35986
183 Ga0207660_10144387 3300025917 Bacteria 1822
184 Ga0207660_10388337 3300025917 Bacteria 1123
185 Ga0207657_10005484 3300025919 Bacteria 13247
186 Ga0207657_10071592 3300025919 Bacteria 2936
187 Ga0207657_10085037 3300025919 Bacteria 2651
188 Ga0207657_10115329 3300025919 Bacteria 2214
189 Ga0207657_10539017 3300025919 Bacteria 913
190 Ga0207649_10010790 3300025920 Bacteria 5022
191 Ga0207652_10000004 3300025921 Bacteria 436303
192 Ga0207652_10000101 3300025921 Bacteria 93033
193 Ga0207652_10160509 3300025921 Bacteria 2015
194 Ga0207694_10126826 3300025924 Bacteria 2042
195 Ga0207659_10029066 3300025926 Bacteria 3763
196 Ga0207659_10077383 3300025926 Bacteria 2448
197 Ga0207687_10047815 3300025927 Bacteria 2967
198 Ga0207644_10123410 3300025931 Bacteria 1974
199 Ga0207690_10008026 3300025932 Bacteria 6267
200 Ga0207690_10025312 3300025932 Bacteria 3724
201 Ga0207690_10085253 3300025932 Bacteria 2217
202 Ga0207690_10385863 3300025932 Bacteria 1114
203 Ga0207686_10083724 3300025934 Bacteria 2088
204 Ga0207670_10045864 3300025936 Bacteria 2900
205 Ga0207669_10056730 3300025937 Bacteria 2380
206 Ga0207704_10062769 3300025938 Bacteria 2312
207 Ga0207691_10033299 3300025940 Bacteria 4797
208 Ga0207691_10050300 3300025940 Bacteria 3815
209 Ga0207691_10075103 3300025940 Bacteria 3048
210 Ga0207691_10092613 3300025940 Bacteria 2707
211 Ga0207689_10002113 3300025942 Bacteria 18676
212 Ga0207689_10004902 3300025942 Bacteria 12069
213 Ga0207689_10016695 3300025942 Bacteria 6212
214 Ga0207689_10146936 3300025942 Bacteria 1942
215 Ga0207661_10210677 3300025944 Bacteria 1713
216 Ga0207679_10012499 3300025945 Bacteria 5537
217 Ga0207667_10050356 3300025949 Bacteria 4395
218 Ga0207651_10030376 3300025960 Bacteria 3440
219 Ga0207651_10112157 3300025960 Bacteria 2049
220 Ga0207712_10040602 3300025961 Bacteria 3195
221 Ga0207668_10130196 3300025972 Bacteria 1920
222 Ga0207677_10038689 3300026023 Bacteria 3130
223 Ga0207677_10048022 3300026023 Bacteria 2871
224 Ga0207677_10053515 3300026023 Bacteria 2748
225 Ga0207677_10233828 3300026023 Bacteria 1482
226 Ga0207703_10000878 3300026035 Bacteria 29522
227 Ga0207678_10319081 3300026067 Bacteria 1337
228 Ga0207641_10000121 3300026088 Bacteria 114943
229 Ga0207648_10007071 3300026089 Bacteria 11073
230 Ga0207648_10008275 3300026089 Bacteria 10099
231 Ga0207676_10027669 3300026095 Bacteria 4225
232 Ga0207676_10179411 3300026095 Bacteria 1853
233 Ga0207674_10010770 3300026116 Bacteria 10317
234 Ga0207674_10061307 3300026116 Bacteria 3801
235 Ga0207675_100072985 3300026118 Bacteria 3210
236 Ga0207675_100134258 3300026118 Bacteria 2347
237 Ga0207675_100182952 3300026118 Bacteria 2007
238 Ga0207675_100632143 3300026118 Bacteria 1075
239 Ga0207683_10003508 3300026121 Bacteria 13678
240 Ga0207683_10010782 3300026121 Bacteria 7793
241 Ga0207683_10024062 3300026121 Bacteria 5241
242 Ga0207683_10325089 3300026121 Bacteria 1409
243 Ga0207698_10006261 3300026142 Bacteria 7406
244 Ga0209281_1000056 3300027111 Bacteria 307619
245 Ga0268265_10361576 3300028380 Bacteria 1329
246 Ga0268264_10002971 3300028381 Bacteria 14730
247 Ga0268264_10020319 3300028381 Bacteria 5427
248 Ga0316180_1157605 3300030736 Bacteria 2566
249 Ga0316182_1221789 3300030745 Bacteria 3419
250 Ga0265327_10000432 3300031251 Bacteria 75935
251 Ga0307508_10001325 3300031616 Bacteria 28026
252 Ga0307413_10428649 3300031824 Bacteria 1044
253 Ga0307406_10309760 3300031901 Bacteria 1217
254 Ga0316574_0083314 3300035398 Bacteria 2033
255 Ga0316574_0130205 3300035398 Bacteria 1619
256 Ga0395899_0002720 3300037312 Bacteria 14258
257 Ga0395899_0023907 3300037312 Bacteria 4623
258 Ga0395900_0000028 3300037418 Bacteria 285042
259 Ga0395900_0002348 3300037418 Bacteria 20948
260 Ga0395900_0004043 3300037418 Bacteria 15651
261 Ga0395900_0128905 3300037418 Bacteria 2593
262 Ga0395900_0205762 3300037418 Bacteria 1989
263 Ga0395900_0741019 3300037418 Bacteria 913
264 Ga0395898_0002043 3300037466 Bacteria 25263
265 Ga0395898_0259732 3300037466 Bacteria 1656
266 Ga0395901_0000025 3300038443 Bacteria 263463
267 Ga0395901_0019500 3300038443 Bacteria 6933
268 Ga0395901_0054633 3300038443 Bacteria 4151
269 Ga0395901_0477792 3300038443 Bacteria 1271
270 Ga0395901_0687442 3300038443 Bacteria 1022
271 Ga0439445_0051958 3300042004 Bacteria 1108
272 Ga0439448_0006129 3300042005 Bacteria 3451
273 Ga0439449_0015862 3300042007 Bacteria 2832
274 Ga0439446_0035090 3300042156 Bacteria 1462
275 Ga0466969_0008401 3300044656 Bacteria 5475
276 Ga0466972_0000003 3300044658 Bacteria 391452
277 Ga0466972_0000801 3300044658 Bacteria 14959
278 Ga0466972_0119060 3300044658 Bacteria 1246
279 Ga0466965_0006443 3300044683 Bacteria 5332
280 Ga0466965_0025139 3300044683 Bacteria 2882
281 Ga0466965_0108388 3300044683 Bacteria 1425
282 Ga0466966_0087316 3300044684 Bacteria 1938
283 Ga0466966_0125173 3300044684 Bacteria 1576
284 Ga0466966_0143467 3300044684 Bacteria 1458
285 Ga0466961_0156681 3300044693 Bacteria 1420
286 Ga0466964_0000574 3300044706 Bacteria 11581
287 Ga0466964_0048969 3300044706 Bacteria 1729
288 Ga0453684_0078879 3300044712 Bacteria 4119
289 Ga0466971_0079794 3300044719 Bacteria 1491
290 Ga0466968_0064983 3300044735 Bacteria 1579
291 Ga0466968_0090999 3300044735 Bacteria 1352
292 Ga0466970_0000607 3300044765 Bacteria 17574
293 Ga0466970_0143170 3300044765 Bacteria 1318
294 Ga0466957_0007434 3300044842 Bacteria 6188
295 Ga0466957_0033924 3300044842 Bacteria 3062
296 Ga0466959_0051074 3300045049 Bacteria 3034
297 Ga0466967_0093427 3300045976 Bacteria 2737
298 Ga0495627_001465 3300046453 Bacteria 13766
299 Ga0495603_0117361 3300046455 Bacteria 1551
300 Ga0495590_0001273 3300046457 Bacteria 10960
301 Ga0495591_000236 3300046458 Bacteria 53618
302 Ga0495638_0082435 3300046460 Bacteria 1951
303 Ga0495653_0170872 3300046463 Bacteria 1500
304 Ga0495580_0070292 3300046472 Bacteria 2445
305 Ga0495582_0013683 3300046473 Bacteria 4466
306 Ga0495605_0000177 3300046474 Bacteria 80399
307 Ga0495605_0001739 3300046474 Bacteria 13947
308 Ga0495605_0006538 3300046474 Bacteria 6690
309 Ga0495605_0013984 3300046474 Bacteria 4405
310 Ga0495639_0227324 3300046475 Bacteria 919
311 Ga0495584_0000001 3300046491 Bacteria 649329
312 Ga0495584_0000366 3300046491 Bacteria 31199
313 Ga0495584_0000452 3300046491 Bacteria 28285
314 Ga0495584_0001551 3300046491 Bacteria 13650
315 Ga0495584_0004007 3300046491 Bacteria 7947
316 Ga0495584_0008288 3300046491 Bacteria 5383
317 Ga0495584_0011200 3300046491 Bacteria 4594
318 Ga0495584_0011673 3300046491 Bacteria 4496
319 Ga0495585_0000600 3300046492 Bacteria 33658
320 Ga0495585_0000697 3300046492 Bacteria 30508
321 Ga0495585_0001480 3300046492 Bacteria 18341
322 Ga0495585_0006526 3300046492 Bacteria 7222
323 Ga0495585_0006714 3300046492 Bacteria 7100
324 Ga0495585_0017738 3300046492 Bacteria 4110
325 Ga0495585_0028730 3300046492 Bacteria 3169
326 Ga0495585_0042463 3300046492 Bacteria 2546
327 Ga0495585_0053236 3300046492 Bacteria 2240
328 Ga0495594_0023866 3300046499 Bacteria 3280
329 Ga0495594_0245791 3300046499 Bacteria 1019
330 Ga0495596_0000615 3300046500 Bacteria 22390
331 Ga0495596_0000821 3300046500 Bacteria 18784
332 Ga0495596_0006977 3300046500 Bacteria 5136
333 Ga0495596_0008987 3300046500 Bacteria 4416
334 Ga0495596_0010760 3300046500 Bacteria 3971
335 Ga0495596_0018122 3300046500 Bacteria 2905
336 Ga0495596_0029061 3300046500 Bacteria 2218
337 Ga0495607_0001696 3300046501 Bacteria 18957
338 Ga0495607_0002247 3300046501 Bacteria 15945
339 Ga0495607_0011028 3300046501 Bacteria 6036
340 Ga0495607_0029059 3300046501 Bacteria 3405
341 Ga0495607_0102545 3300046501 Bacteria 1530
342 Ga0495583_0000506 3300046506 Bacteria 56069
343 Ga0495606_0004705 3300046507 Bacteria 13467
344 Ga0495606_0015233 3300046507 Bacteria 5937
345 Ga0495606_0089815 3300046507 Bacteria 1892
346 Ga0495606_0135404 3300046507 Bacteria 1460
347 Ga0495610_0010358 3300046512 Bacteria 5802
348 Ga0495616_0000386 3300046513 Bacteria 34362
349 Ga0495616_0001634 3300046513 Bacteria 15368
350 Ga0495616_0003927 3300046513 Bacteria 9467
351 Ga0495616_0008600 3300046513 Bacteria 6028
352 Ga0495616_0106653 3300046513 Bacteria 1306
353 Ga0495631_0006918 3300046518 Bacteria 5813
354 Ga0495631_0033138 3300046518 Bacteria 2322
355 Ga0495632_0000156 3300046519 Bacteria 70702
356 Ga0495632_0000537 3300046519 Bacteria 35765
357 Ga0495632_0011507 3300046519 Bacteria 5158
358 Ga0495632_0035337 3300046519 Bacteria 2550
359 Ga0495643_0002305 3300046522 Bacteria 15401
360 Ga0495643_0003688 3300046522 Bacteria 11102
361 Ga0495643_0008036 3300046522 Bacteria 6727
362 Ga0495643_0028675 3300046522 Bacteria 3118
363 Ga0495643_0031913 3300046522 Bacteria 2928
364 Ga0495644_0010708 3300046523 Bacteria 3533
365 Ga0495644_0019643 3300046523 Bacteria 2580
366 Ga0495644_0053416 3300046523 Bacteria 1517
367 Ga0495644_0064157 3300046523 Bacteria 1380
368 Ga0495648_0023546 3300046524 Bacteria 4215
369 Ga0495666_0002495 3300046526 Bacteria 9133
370 Ga0495666_0063882 3300046526 Bacteria 1757
371 Ga0495642_0000053 3300046528 Bacteria 70172
372 Ga0495642_0000433 3300046528 Bacteria 22082
373 Ga0495642_0002723 3300046528 Bacteria 7097
374 Ga0495665_0001008 3300046531 Bacteria 14939
375 Ga0495586_0069245 3300046535 Bacteria 1925
376 Ga0495609_0000001 3300046538 Bacteria 1060094
377 Ga0495609_0008646 3300046538 Bacteria 4969
378 Ga0495609_0020636 3300046538 Bacteria 3042
379 Ga0495609_0026206 3300046538 Bacteria 2669
380 Ga0495597_0000488 3300046542 Bacteria 33250
381 Ga0495597_0002178 3300046542 Bacteria 12864
382 Ga0495597_0002942 3300046542 Bacteria 10335
383 Ga0495622_0113871 3300046557 Bacteria 1237
384 Ga0495633_0002380 3300046558 Bacteria 13321
385 Ga0495633_0027256 3300046558 Bacteria 2793
386 Ga0495633_0051966 3300046558 Bacteria 1930
387 Ga0495656_0017719 3300046615 Bacteria 2722
388 Ga0495656_0030285 3300046615 Bacteria 2186
389 Ga0495656_0105218 3300046615 Bacteria 1311
390 Ga0495668_0002833 3300046616 Bacteria 13784
391 Ga0495668_0006442 3300046616 Bacteria 7684
392 Ga0495668_0006681 3300046616 Bacteria 7509
393 Ga0495668_0024499 3300046616 Bacteria 3432
394 Ga0495668_0050068 3300046616 Bacteria 2315
395 Ga0495668_0089260 3300046616 Bacteria 1689
396 Ga0495668_0218136 3300046616 Bacteria 1044
397 Ga0495611_0000960 3300046648 Bacteria 15368
398 Ga0495611_0005964 3300046648 Bacteria 5196
399 Ga0495611_0061906 3300046648 Bacteria 1701
400 Ga0495611_0213440 3300046648 Bacteria 898
401 Ga0495625_0005815 3300046660 Bacteria 11129
402 Ga0495625_0041053 3300046660 Bacteria 3369
403 Ga0495661_0000069 3300046665 Bacteria 125790
404 Ga0495661_0000082 3300046665 Bacteria 116600
405 Ga0495661_0005217 3300046665 Bacteria 9246
406 Ga0495661_0009005 3300046665 Bacteria 6868
407 Ga0495661_0021506 3300046665 Bacteria 4205
408 Ga0495661_0050020 3300046665 Bacteria 2532
409 Ga0495661_0060506 3300046665 Bacteria 2249
410 Ga0495661_0135992 3300046665 Bacteria 1341
411 Ga0495588_0000041 3300046674 Bacteria 377896
412 Ga0495588_0111712 3300046674 Bacteria 1439
413 Ga0495669_0013262 3300046684 Bacteria 3510
414 Ga0495669_0025414 3300046684 Bacteria 2583
415 Ga0495669_0090576 3300046684 Bacteria 1411
416 Ga0495670_0002666 3300046691 Bacteria 8807
417 Ga0495670_0060581 3300046691 Bacteria 1902
418 Ga0495671_0008192 3300046692 Bacteria 5895
419 Ga0495649_0000537 3300046694 Bacteria 32173
420 Ga0495649_0001788 3300046694 Bacteria 15827
421 Ga0495649_0020176 3300046694 Bacteria 3739
422 Ga0495589_0000061 3300046794 Bacteria 104649
423 Ga0495589_0000072 3300046794 Bacteria 95649
424 Ga0495589_0014127 3300046794 Bacteria 4116
425 Ga0495589_0030024 3300046794 Bacteria 2739
426 Ga0495589_0046286 3300046794 Bacteria 2159
427 Ga0495660_0000243 3300046810 Bacteria 53378
428 Ga0495660_0008501 3300046810 Bacteria 6010
429 Ga0495660_0018048 3300046810 Bacteria 4057
430 Ga0495660_0074213 3300046810 Bacteria 1797
431 Ga0495604_0031391 3300047317 Bacteria 4213
432 Ga0495604_0154424 3300047317 Bacteria 1627
433 Ga0495636_0000011 3300047318 Bacteria 87862
434 Ga0495636_0003018 3300047318 Bacteria 6522
435 Ga0495672_0000258 3300047320 Bacteria 73971
436 Ga0495672_0010604 3300047320 Bacteria 6549
437 Ga0495672_0020962 3300047320 Bacteria 4270
438 Ga0495676_0039316 3300047321 Bacteria 3919
439 Ga0495680_0003891 3300047322 Bacteria 14448
440 Ga0495683_0000009 3300047323 Bacteria 241385
441 Ga0495683_0000446 3300047323 Bacteria 32629
442 Ga0495683_0015742 3300047323 Bacteria 3927
443 Ga0495687_000027 3300047443 Bacteria 299689
444 Ga0495687_000630 3300047443 Bacteria 40345
445 Ga0495687_001824 3300047443 Bacteria 18729
446 Ga0495687_002017 3300047443 Bacteria 17187
447 Ga0495675_0030627 3300047444 Bacteria 3432
448 Ga0495677_0000001 3300047445 Bacteria 715000
449 Ga0495677_0000195 3300047445 Bacteria 27965
450 Ga0495677_0001118 3300047445 Bacteria 10729
451 Ga0495677_0001701 3300047445 Bacteria 8838
452 Ga0495677_0006543 3300047445 Bacteria 4401
453 Ga0495679_001482 3300047446 Bacteria 13271
454 Ga0495679_016971 3300047446 Bacteria 2617
455 Ga0495685_036381 3300047447 Bacteria 1690
456 Ga0495681_0000428 3300047470 Bacteria 32244
457 Ga0495681_0015193 3300047470 Bacteria 4366
458 Ga0495681_0024964 3300047470 Bacteria 3134
459 Ga0495686_0000146 3300047472 Bacteria 141435
460 Ga0495686_0000373 3300047472 Bacteria 71977
461 Ga0495686_0001101 3300047472 Bacteria 32108
462 Ga0495686_0006503 3300047472 Bacteria 8925
463 Ga0495686_0047236 3300047472 Bacteria 2719
464 Ga0495593_0213731 3300047673 Bacteria 968
465 Ga0495614_0010053 3300048089 Bacteria 4177
466 Ga0495626_0000027 3300048091 Bacteria 206022
467 Ga0495626_0000135 3300048091 Bacteria 93280
468 Ga0495626_0000193 3300048091 Bacteria 73924
469 Ga0495626_0039499 3300048091 Bacteria 2233
470 Ga0495626_0067380 3300048091 Bacteria 1616
471 Ga0496101_0066030 3300048904 Bacteria 2638
472 Ga0496102_0000058 3300048905 Bacteria 168714
473 Ga0496104_0443251 3300048907 Bacteria 1210
474 Ga0496106_0297027 3300048909 Bacteria 1295
475 Ga0496107_0170968 3300048910 Bacteria 1613
476 Ga0496108_0955706 3300048911 Bacteria 733
477 Ga0496109_0347154 3300048912 Bacteria 1402
478 Ga0496110_0000251 3300048913 Bacteria 34859
479 Ga0496110_0009047 3300048913 Bacteria 8037
480 Ga0496110_0021952 3300048913 Bacteria 5414
481 Ga0496112_0240363 3300048915 Bacteria 1764
482 Ga0496113_0002669 3300048916 Bacteria 10454
483 Ga0496113_0405827 3300048916 Bacteria 1094
484 Ga0496115_0112393 3300048918 Bacteria 2238
485 Ga0496116_0003966 3300048919 Bacteria 14370
486 Ga0496121_0161506 3300048924 Bacteria 1638
487 Ga0496122_0000255 3300048925 Bacteria 120384
488 Ga0496122_0002056 3300048925 Bacteria 29860
489 Ga0496122_0007048 3300048925 Bacteria 12637
490 Ga0496122_0022678 3300048925 Bacteria 5572
491 Ga0496123_0000138 3300048926 Bacteria 151844
492 Ga0496123_0001705 3300048926 Bacteria 29367
493 Ga0496123_0004467 3300048926 Bacteria 14671
494 Ga0496124_0013112 3300048927 Bacteria 8115
495 Ga0496124_0180220 3300048927 Bacteria 1626
496 Ga0496125_0002290 3300048928 Bacteria 25316
497 Ga0496125_0002620 3300048928 Bacteria 23073
498 Ga0501308_001455 3300049128 Bacteria 1897
499 Ga0495678_000110 3300049459 Bacteria 97228
500 Ga0495678_022198 3300049459 Bacteria 2779
501 Ga0495682_0007385 3300049460 Bacteria 4379
502 Ga0495682_0020557 3300049460 Bacteria 2477
503 Ga0501298_004446 3300049521 Bacteria 2210
504 Ga0501034_0023415 3300049571 Bacteria 6293
505 Ga0501034_0170353 3300049571 Bacteria 2145
506 Ga0501034_0212020 3300049571 Bacteria 1892
507 Ga0501038_0149218 3300049574 Bacteria 1907
508 Ga0501039_0456830 3300049575 Bacteria 1003
509 Ga0501043_0113283 3300049579 Bacteria 2130
510 Ga0501067_0026472 3300049583 Bacteria 3212
511 Ga0501069_0048089 3300049585 Bacteria 2368
512 Ga0501070_0376927 3300049586 Bacteria 1149
513 Ga0501072_0181283 3300049588 Bacteria 1680
514 Ga0501073_0162407 3300049589 Bacteria 1547
515 Ga0501201_000140 3300049651 Bacteria 6066
516 Ga0501207_011209 3300049654 Bacteria 1332
517 Ga0501217_017854 3300049661 Bacteria 1640
518 Ga0501222_004316 3300049662 Bacteria 1930
519 Ga0501223_001744 3300049663 Bacteria 4945
520 Ga0501233_014174 3300049668 Bacteria 1626
521 Ga0501235_001675 3300049669 Bacteria 4752
522 Ga0501242_002559 3300049674 Bacteria 1918
523 Ga0501243_001273 3300049675 Bacteria 3595
524 Ga0501251_017977 3300049681 Bacteria 913
525 Ga0501257_003118 3300049686 Bacteria 3530
526 Ga0501257_004374 3300049686 Bacteria 3083
527 Ga0501259_004374 3300049688 Bacteria 2250
528 Ga0501234_011897 3300049707 Bacteria 1362
529 Ga0501245_004933 3300049708 Bacteria 1842
530 Ga0501080_0223463 3300049742 Bacteria 1722
531 Ga0501083_0015230 3300049744 Bacteria 5383
532 Ga0501232_001451 3300049757 Bacteria 1895
533 Ga0501266_001738 3300049763 Bacteria 2759
534 Ga0501035_0003078 3300049822 Bacteria 16010
535 Ga0501035_0159292 3300049822 Bacteria 1955
536 Ga0501035_0521741 3300049822 Bacteria 976
537 nmdc:mga0k408_92153_c1 3300050493 Bacteria 1781
538 Ga0500644_0063132 3300053088 Bacteria 1311
539 Ga0500641_0025562 3300053096 Bacteria 2285
540 Ga0500562_000077 3300053108 Bacteria 45189
541 Ga0500568_0006155 3300053139 Bacteria 6069
542 Ga0500622_0003322 3300053156 Bacteria 10864
543 Ga0500645_022740 3300053730 Bacteria 1925
544 Ga0501084_0029727 3300054114 Bacteria 4571
545 Ga0587077_025297 3300059493 Bacteria 1088
546 Ga0587083_0020468 3300059505 Bacteria 1219
547 Ga0587068_008424 3300059641 Bacteria 1494

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0955706 Ga0496108_0955706_36_716 220
2 3300053730 Ga0500645_022740 Ga0500645_022740_1174_1887 231
3 3300003320 rootH2_10013019 rootH2_100130198 255
4 3300046463 Ga0495653_0170872 Ga0495653_0170872_327_1100 257
5 3300046513 Ga0495616_0000386 Ga0495616_0000386_499_1272 257
6 3300046665 Ga0495661_0000082 Ga0495661_0000082_114822_115595 257
7 3300046684 Ga0495669_0090576 Ga0495669_0090576_449_1222 257
8 3300046810 Ga0495660_0018048 Ga0495660_0018048_2077_2850 257
9 3300047317 Ga0495604_0031391 Ga0495604_0031391_2335_3108 257
10 3300047322 Ga0495680_0003891 Ga0495680_0003891_1794_2567 257
11 3300047447 Ga0495685_036381 Ga0495685_036381_36_809 257
12 3300048089 Ga0495614_0010053 Ga0495614_0010053_2880_3653 257
13 3300048916 Ga0496113_0002669 Ga0496113_0002669_8646_9419 257
14 3300048925 Ga0496122_0000255 Ga0496122_0000255_117862_118635 257
15 3300048926 Ga0496123_0000138 Ga0496123_0000138_31984_32757 257
16 3300048928 Ga0496125_0002620 Ga0496125_0002620_21429_22202 257
17 3300049822 Ga0501035_0003078 Ga0501035_0003078_13392_14165 257
18 iso_pu_bacteria 2548876994 2550693359 260
19 iso_pu_bacteria 2643221556 2643798997 260
20 iso_pu_bacteria 2643221684 2644473672 260
21 iso_pu_bacteria 2818991444 2819590723 260
22 iso_pu_bacteria 2818991445 2819594937 260
23 iso_pu_bacteria 2884811622 2884812324 260
24 iso_pu_bacteria 2884836552 2884836688 260
25 iso_pu_bacteria 2884852848 2884852980 260
26 iso_pu_bacteria 2896154374 2896155903 260
27 iso_pu_bacteria 2929154850 2929157742 260
28 iso_pu_bacteria 3006973921 3006975565 260
29 iso_pu_bacteria 8047673197 8047679403 260
30 3300003203 JGI25406J46586_10012099 JGI25406J46586_100120992 262
31 3300005985 Ga0081539_10000531 Ga0081539_100005313 262
32 3300031616 Ga0307508_10001325 Ga0307508_1000132518 262
33 2162886007 SwRhRL2b_contig_3160980 SwRhRL2b_0077.00006020 264
34 3300001979 JGI24740J21852_10019370 JGI24740J21852_100193704 264
35 3300002705 JGI25156J39149_1001190 JGI25156J39149_10011909 264
36 3300002737 JGI25162J39368_1004954 JGI25162J39368_10049542 264
37 3300002738 JGI25154J39366_1000986 JGI25154J39366_10009861 264
38 3300002741 JGI25157J39369_1001849 JGI25157J39369_10018495 264
39 3300003322 rootL2_10241602 rootL2_102416021 264
40 3300003354 JGI25160J50197_1000425 JGI25160J50197_10004259 264
41 3300003758 Ga0055532_1000077 Ga0055532_10000771 264
42 3300003759 Ga0055525_1000008 Ga0055525_100000831 264
43 3300003762 Ga0055542_1012403 Ga0055542_10124032 264
44 3300005289 Ga0065704_10072654 Ga0065704_100726544 264
45 3300005327 Ga0070658_10025472 Ga0070658_100254722 264
46 3300005327 Ga0070658_10028978 Ga0070658_100289783 264
47 3300005327 Ga0070658_10196661 Ga0070658_101966612 264
48 3300005328 Ga0070676_10120820 Ga0070676_101208202 264
49 3300005329 Ga0070683_100007781 Ga0070683_1000077818 264
50 3300005329 Ga0070683_100522899 Ga0070683_1005228991 264
51 3300005331 Ga0070670_100050548 Ga0070670_1000505483 264
52 3300005331 Ga0070670_100210256 Ga0070670_1002102563 264
53 3300005334 Ga0068869_100010056 Ga0068869_1000100567 264
54 3300005334 Ga0068869_100017750 Ga0068869_1000177503 264
55 3300005335 Ga0070666_10000736 Ga0070666_1000073617 264
56 3300005335 Ga0070666_10089513 Ga0070666_100895133 264
57 3300005336 Ga0070680_100000088 Ga0070680_10000008853 264
58 3300005336 Ga0070680_100038613 Ga0070680_1000386135 264
59 3300005338 Ga0068868_100025378 Ga0068868_1000253782 264
60 3300005338 Ga0068868_100045260 Ga0068868_1000452603 264
61 3300005338 Ga0068868_100224499 Ga0068868_1002244992 264
62 3300005339 Ga0070660_100042601 Ga0070660_1000426014 264
63 3300005339 Ga0070660_100058718 Ga0070660_1000587182 264
64 3300005339 Ga0070660_100080999 Ga0070660_1000809993 264
65 3300005339 Ga0070660_100105690 Ga0070660_1001056903 264
66 3300005339 Ga0070660_100132997 Ga0070660_1001329971 264
67 3300005339 Ga0070660_100260270 Ga0070660_1002602701 264
68 3300005340 Ga0070689_100026131 Ga0070689_1000261313 264
69 3300005344 Ga0070661_100017437 Ga0070661_1000174375 264
70 3300005347 Ga0070668_100036467 Ga0070668_1000364674 264
71 3300005347 Ga0070668_100189194 Ga0070668_1001891942 264
72 3300005353 Ga0070669_100147955 Ga0070669_1001479553 264
73 3300005354 Ga0070675_100038520 Ga0070675_1000385201 264
74 3300005355 Ga0070671_100014761 Ga0070671_1000147614 264
75 3300005355 Ga0070671_100110999 Ga0070671_1001109992 264
76 3300005356 Ga0070674_100121079 Ga0070674_1001210792 264
77 3300005364 Ga0070673_100023997 Ga0070673_1000239974 264
78 3300005364 Ga0070673_100536616 Ga0070673_1005366161 264
79 3300005365 Ga0070688_100008462 Ga0070688_1000084622 264
80 3300005366 Ga0070659_100010190 Ga0070659_1000101903 264
81 3300005366 Ga0070659_100043243 Ga0070659_1000432434 264
82 3300005366 Ga0070659_100078813 Ga0070659_1000788133 264
83 3300005366 Ga0070659_100082890 Ga0070659_1000828902 264
84 3300005455 Ga0070663_100375911 Ga0070663_1003759111 264
85 3300005456 Ga0070678_100013458 Ga0070678_1000134584 264
86 3300005456 Ga0070678_100131890 Ga0070678_1001318902 264
87 3300005457 Ga0070662_100151157 Ga0070662_1001511572 264
88 3300005459 Ga0068867_100008426 Ga0068867_1000084263 264
89 3300005530 Ga0070679_100000003 Ga0070679_100000003220 264
90 3300005530 Ga0070679_100075145 Ga0070679_1000751453 264
91 3300005530 Ga0070679_100347760 Ga0070679_1003477601 264
92 3300005543 Ga0070672_100027937 Ga0070672_1000279375 264
93 3300005548 Ga0070665_100043589 Ga0070665_1000435894 264
94 3300005563 Ga0068855_100045035 Ga0068855_1000450351 264
95 3300005563 Ga0068855_100079309 Ga0068855_1000793092 264
96 3300005563 Ga0068855_100737942 Ga0068855_1007379421 264
97 3300005564 Ga0070664_100024674 Ga0070664_1000246746 264
98 3300005564 Ga0070664_100048325 Ga0070664_1000483252 264
99 3300005564 Ga0070664_100094830 Ga0070664_1000948302 264
100 3300005564 Ga0070664_100273688 Ga0070664_1002736882 264
101 3300005577 Ga0068857_100046969 Ga0068857_1000469694 264
102 3300005577 Ga0068857_100075562 Ga0068857_1000755623 264
103 3300005578 Ga0068854_100094454 Ga0068854_1000944542 264
104 3300005617 Ga0068859_100000037 Ga0068859_100000037102 264
105 3300005617 Ga0068859_100005033 Ga0068859_1000050332 264
106 3300005617 Ga0068859_100154534 Ga0068859_1001545342 264
107 3300005617 Ga0068859_100167475 Ga0068859_1001674753 264
108 3300005617 Ga0068859_100338016 Ga0068859_1003380163 264
109 3300005618 Ga0068864_100009579 Ga0068864_1000095792 264
110 3300005618 Ga0068864_100053693 Ga0068864_1000536932 264
111 3300005618 Ga0068864_100055678 Ga0068864_1000556783 264
112 3300005618 Ga0068864_100303277 Ga0068864_1003032772 264
113 3300005718 Ga0068866_10024844 Ga0068866_100248443 264
114 3300005719 Ga0068861_100044059 Ga0068861_1000440594 264
115 3300005834 Ga0068851_10008075 Ga0068851_100080754 264
116 3300005834 Ga0068851_10010366 Ga0068851_100103664 264
117 3300005834 Ga0068851_10117872 Ga0068851_101178723 264
118 3300005840 Ga0068870_10012327 Ga0068870_100123273 264
119 3300005841 Ga0068863_100032377 Ga0068863_1000323775 264
120 3300005842 Ga0068858_100002312 Ga0068858_1000023127 264
121 3300005842 Ga0068858_100841454 Ga0068858_1008414541 264
122 3300005843 Ga0068860_100003825 Ga0068860_1000038259 264
123 3300005843 Ga0068860_100026415 Ga0068860_1000264153 264
124 3300005843 Ga0068860_100030783 Ga0068860_1000307836 264
125 3300006195 Ga0075366_10107926 Ga0075366_101079262 264
126 3300006237 Ga0097621_100032447 Ga0097621_1000324473 264
127 3300006237 Ga0097621_100068063 Ga0097621_1000680634 264
128 3300006358 Ga0068871_100083751 Ga0068871_1000837513 264
129 3300006931 Ga0097620_100000037 Ga0097620_100000037102 264
130 3300006931 Ga0097620_100005033 Ga0097620_1000050332 264
131 3300006931 Ga0097620_100154525 Ga0097620_1001545252 264
132 3300006931 Ga0097620_100167474 Ga0097620_1001674742 264
133 3300006931 Ga0097620_100338022 Ga0097620_1003380223 264
134 3300009093 Ga0105240_10051294 Ga0105240_100512941 264
135 3300009098 Ga0105245_10057483 Ga0105245_100574833 264
136 3300009098 Ga0105245_10181275 Ga0105245_101812752 264
137 3300009098 Ga0105245_10386836 Ga0105245_103868361 264
138 3300009101 Ga0105247_10045640 Ga0105247_100456401 264
139 3300009174 Ga0105241_10001242 Ga0105241_1000124214 264
140 3300009174 Ga0105241_10063295 Ga0105241_100632954 264
141 3300009174 Ga0105241_10119939 Ga0105241_101199392 264
142 3300009176 Ga0105242_10031141 Ga0105242_100311414 264
143 3300009176 Ga0105242_10119104 Ga0105242_101191042 264
144 3300009545 Ga0105237_10011912 Ga0105237_100119127 264
145 3300009545 Ga0105237_10019373 Ga0105237_100193734 264
146 3300009551 Ga0105238_10054006 Ga0105238_100540063 264
147 3300010375 Ga0105239_10050855 Ga0105239_100508551 264
148 3300011119 Ga0105246_10059113 Ga0105246_100591133 264
149 3300013100 Ga0157373_10049310 Ga0157373_100493101 264
150 3300013102 Ga0157371_10003328 Ga0157371_100033286 264
151 3300013104 Ga0157370_10058627 Ga0157370_100586272 264
152 3300013104 Ga0157370_10163019 Ga0157370_101630191 264
153 3300013104 Ga0157370_10486663 Ga0157370_104866632 264
154 3300013105 Ga0157369_10040311 Ga0157369_100403116 264
155 3300013105 Ga0157369_10109403 Ga0157369_101094033 264
156 3300013296 Ga0157374_10000500 Ga0157374_1000050036 264
157 3300013296 Ga0157374_10065573 Ga0157374_100655734 264
158 3300013296 Ga0157374_10148425 Ga0157374_101484253 264
159 3300013296 Ga0157374_10583976 Ga0157374_105839761 264
160 3300013297 Ga0157378_10036726 Ga0157378_100367264 264
161 3300013297 Ga0157378_10057003 Ga0157378_100570031 264
162 3300013297 Ga0157378_10057524 Ga0157378_100575244 264
163 3300013297 Ga0157378_10059615 Ga0157378_100596154 264
164 3300013297 Ga0157378_10123678 Ga0157378_101236783 264
165 3300013297 Ga0157378_10140088 Ga0157378_101400882 264
166 3300013306 Ga0163162_10004768 Ga0163162_100047685 264
167 3300013306 Ga0163162_10319034 Ga0163162_103190342 264
168 3300013307 Ga0157372_10089689 Ga0157372_100896894 264
169 3300013307 Ga0157372_10201163 Ga0157372_102011632 264
170 3300013307 Ga0157372_10352456 Ga0157372_103524561 264
171 3300013307 Ga0157372_10390004 Ga0157372_103900042 264
172 3300013307 Ga0157372_10432922 Ga0157372_104329221 264
173 3300013308 Ga0157375_10091600 Ga0157375_100916002 264
174 3300013308 Ga0157375_10149311 Ga0157375_101493113 264
175 3300013308 Ga0157375_10455800 Ga0157375_104558002 264
176 3300014325 Ga0163163_10001732 Ga0163163_1000173222 264
177 3300014325 Ga0163163_10018090 Ga0163163_100180905 264
178 3300014326 Ga0157380_10022365 Ga0157380_100223655 264
179 3300014497 Ga0182008_10071418 Ga0182008_100714182 264
180 3300014745 Ga0157377_10013348 Ga0157377_100133481 264
181 3300014968 Ga0157379_10058571 Ga0157379_100585714 264
182 3300014969 Ga0157376_10032889 Ga0157376_100328893 264
183 3300025206 Ga0209435_100082 Ga0209435_10008215 264
184 3300025229 Ga0209147_100122 Ga0209147_100122120 264
185 3300025230 Ga0209563_100003 Ga0209563_1000031116 264
186 3300025233 Ga0209437_100081 Ga0209437_10008179 264
187 3300025242 Ga0209258_100739 Ga0209258_10073916 264
188 3300025246 Ga0209646_1000152 Ga0209646_100015215 264
189 3300025250 Ga0209026_1000126 Ga0209026_1000126120 264
190 3300025253 Ga0209677_102681 Ga0209677_1026814 264
191 3300025254 Ga0209148_1000576 Ga0209148_100057622 264
192 3300025256 Ga0209759_1000193 Ga0209759_100019315 264
193 3300025302 Ga0207426_1000032 Ga0207426_100003246 264
194 3300025321 Ga0207656_10007990 Ga0207656_100079904 264
195 3300025321 Ga0207656_10139487 Ga0207656_101394871 264
196 3300025893 Ga0207682_10029991 Ga0207682_100299912 264
197 3300025893 Ga0207682_10039977 Ga0207682_100399772 264
198 3300025899 Ga0207642_10012030 Ga0207642_100120303 264
199 3300025900 Ga0207710_10166457 Ga0207710_101664572 264
200 3300025901 Ga0207688_10050439 Ga0207688_100504393 264
201 3300025903 Ga0207680_10002758 Ga0207680_100027586 264
202 3300025903 Ga0207680_10024859 Ga0207680_100248593 264
203 3300025907 Ga0207645_10008175 Ga0207645_100081754 264
204 3300025907 Ga0207645_10113229 Ga0207645_101132292 264
205 3300025908 Ga0207643_10061389 Ga0207643_100613893 264
206 3300025909 Ga0207705_10094360 Ga0207705_100943603 264
207 3300025911 Ga0207654_10001781 Ga0207654_100017813 264
208 3300025911 Ga0207654_10009833 Ga0207654_100098332 264
209 3300025911 Ga0207654_10364325 Ga0207654_103643251 264
210 3300025914 Ga0207671_10001737 Ga0207671_100017378 264
211 3300025917 Ga0207660_10000231 Ga0207660_1000023120 264
212 3300025917 Ga0207660_10144387 Ga0207660_101443871 264
213 3300025917 Ga0207660_10388337 Ga0207660_103883372 264
214 3300025919 Ga0207657_10005484 Ga0207657_1000548410 264
215 3300025919 Ga0207657_10071592 Ga0207657_100715924 264
216 3300025919 Ga0207657_10085037 Ga0207657_100850374 264
217 3300025919 Ga0207657_10115329 Ga0207657_101153293 264
218 3300025919 Ga0207657_10539017 Ga0207657_105390171 264
219 3300025920 Ga0207649_10010790 Ga0207649_100107905 264
220 3300025921 Ga0207652_10000004 Ga0207652_10000004221 264
221 3300025921 Ga0207652_10000101 Ga0207652_1000010144 264
222 3300025921 Ga0207652_10160509 Ga0207652_101605091 264
223 3300025924 Ga0207694_10126826 Ga0207694_101268262 264
224 3300025926 Ga0207659_10029066 Ga0207659_100290661 264
225 3300025926 Ga0207659_10077383 Ga0207659_100773833 264
226 3300025927 Ga0207687_10047815 Ga0207687_100478152 264
227 3300025931 Ga0207644_10123410 Ga0207644_101234103 264
228 3300025932 Ga0207690_10008026 Ga0207690_100080264 264
229 3300025932 Ga0207690_10025312 Ga0207690_100253122 264
230 3300025932 Ga0207690_10085253 Ga0207690_100852532 264
231 3300025932 Ga0207690_10385863 Ga0207690_103858632 264
232 3300025934 Ga0207686_10083724 Ga0207686_100837243 264
233 3300025936 Ga0207670_10045864 Ga0207670_100458641 264
234 3300025937 Ga0207669_10056730 Ga0207669_100567302 264
235 3300025938 Ga0207704_10062769 Ga0207704_100627693 264
236 3300025940 Ga0207691_10033299 Ga0207691_100332995 264
237 3300025940 Ga0207691_10050300 Ga0207691_100503002 264
238 3300025940 Ga0207691_10075103 Ga0207691_100751034 264
239 3300025940 Ga0207691_10092613 Ga0207691_100926133 264
240 3300025942 Ga0207689_10002113 Ga0207689_100021138 264
241 3300025942 Ga0207689_10004902 Ga0207689_100049028 264
242 3300025942 Ga0207689_10016695 Ga0207689_100166954 264
243 3300025942 Ga0207689_10146936 Ga0207689_101469362 264
244 3300025944 Ga0207661_10210677 Ga0207661_102106772 264
245 3300025945 Ga0207679_10012499 Ga0207679_100124997 264
246 3300025949 Ga0207667_10050356 Ga0207667_100503563 264
247 3300025960 Ga0207651_10030376 Ga0207651_100303762 264
248 3300025960 Ga0207651_10112157 Ga0207651_101121573 264
249 3300025961 Ga0207712_10040602 Ga0207712_100406024 264
250 3300025972 Ga0207668_10130196 Ga0207668_101301963 264
251 3300026023 Ga0207677_10038689 Ga0207677_100386893 264
252 3300026023 Ga0207677_10048022 Ga0207677_100480222 264
253 3300026023 Ga0207677_10053515 Ga0207677_100535153 264
254 3300026023 Ga0207677_10233828 Ga0207677_102338283 264
255 3300026035 Ga0207703_10000878 Ga0207703_1000087815 264
256 3300026067 Ga0207678_10319081 Ga0207678_103190811 264
257 3300026088 Ga0207641_10000121 Ga0207641_1000012153 264
258 3300026089 Ga0207648_10007071 Ga0207648_100070714 264
259 3300026089 Ga0207648_10008275 Ga0207648_100082757 264
260 3300026095 Ga0207676_10027669 Ga0207676_100276693 264
261 3300026095 Ga0207676_10179411 Ga0207676_101794112 264
262 3300026116 Ga0207674_10010770 Ga0207674_100107707 264
263 3300026116 Ga0207674_10061307 Ga0207674_100613079 264
264 3300026118 Ga0207675_100072985 Ga0207675_1000729854 264
265 3300026118 Ga0207675_100134258 Ga0207675_1001342582 264
266 3300026118 Ga0207675_100182952 Ga0207675_1001829522 264
267 3300026118 Ga0207675_100632143 Ga0207675_1006321431 264
268 3300026121 Ga0207683_10003508 Ga0207683_100035088 264
269 3300026121 Ga0207683_10010782 Ga0207683_100107823 264
270 3300026121 Ga0207683_10024062 Ga0207683_100240623 264
271 3300026121 Ga0207683_10325089 Ga0207683_103250892 264
272 3300026142 Ga0207698_10006261 Ga0207698_100062615 264
273 3300027111 Ga0209281_1000056 Ga0209281_100005678 264
274 3300028380 Ga0268265_10361576 Ga0268265_103615762 264
275 3300028381 Ga0268264_10002971 Ga0268264_1000297110 264
276 3300028381 Ga0268264_10020319 Ga0268264_100203192 264
277 3300030736 Ga0316180_1157605 Ga0316180_11576052 264
278 3300030745 Ga0316182_1221789 Ga0316182_12217892 264
279 3300031251 Ga0265327_10000432 Ga0265327_1000043233 264
280 3300031824 Ga0307413_10428649 Ga0307413_104286491 264
281 3300031901 Ga0307406_10309760 Ga0307406_103097602 264
282 3300035398 Ga0316574_0083314 Ga0316574_0083314_445_1239 264
283 3300035398 Ga0316574_0130205 Ga0316574_0130205_223_1017 264
284 3300037312 Ga0395899_0002720 Ga0395899_0002720_12701_13495 264
285 3300037312 Ga0395899_0023907 Ga0395899_0023907_2134_2943 264
286 3300037418 Ga0395900_0000028 Ga0395900_0000028_37089_37883 264
287 3300037418 Ga0395900_0002348 Ga0395900_0002348_1916_2710 264
288 3300037418 Ga0395900_0004043 Ga0395900_0004043_13170_13979 264
289 3300037418 Ga0395900_0128905 Ga0395900_0128905_282_1091 264
290 3300037418 Ga0395900_0205762 Ga0395900_0205762_465_1259 264
291 3300037418 Ga0395900_0741019 Ga0395900_0741019_47_841 264
292 3300037466 Ga0395898_0002043 Ga0395898_0002043_12848_13657 264
293 3300037466 Ga0395898_0259732 Ga0395898_0259732_596_1390 264
294 3300038443 Ga0395901_0000025 Ga0395901_0000025_229441_230235 264
295 3300038443 Ga0395901_0019500 Ga0395901_0019500_230_1024 264
296 3300038443 Ga0395901_0054633 Ga0395901_0054633_1313_2122 264
297 3300038443 Ga0395901_0477792 Ga0395901_0477792_267_1061 264
298 3300038443 Ga0395901_0687442 Ga0395901_0687442_97_891 264
299 3300042004 Ga0439445_0051958 Ga0439445_0051958_54_848 264
300 3300042005 Ga0439448_0006129 Ga0439448_0006129_761_1555 264
301 3300042007 Ga0439449_0015862 Ga0439449_0015862_1837_2631 264
302 3300042156 Ga0439446_0035090 Ga0439446_0035090_344_1138 264
303 3300044656 Ga0466969_0008401 Ga0466969_0008401_55_867 264
304 3300044658 Ga0466972_0000003 Ga0466972_0000003_101965_102780 264
305 3300044658 Ga0466972_0000801 Ga0466972_0000801_12855_13649 264
306 3300044658 Ga0466972_0119060 Ga0466972_0119060_176_970 264
307 3300044683 Ga0466965_0006443 Ga0466965_0006443_3794_4588 264
308 3300044683 Ga0466965_0025139 Ga0466965_0025139_1786_2580 264
309 3300044683 Ga0466965_0108388 Ga0466965_0108388_106_900 264
310 3300044684 Ga0466966_0087316 Ga0466966_0087316_686_1480 264
311 3300044684 Ga0466966_0125173 Ga0466966_0125173_96_890 264
312 3300044684 Ga0466966_0143467 Ga0466966_0143467_592_1386 264
313 3300044693 Ga0466961_0156681 Ga0466961_0156681_592_1386 264
314 3300044706 Ga0466964_0000574 Ga0466964_0000574_9591_10385 264
315 3300044706 Ga0466964_0048969 Ga0466964_0048969_147_941 264
316 3300044712 Ga0453684_0078879 Ga0453684_0078879_1062_1856 264
317 3300044719 Ga0466971_0079794 Ga0466971_0079794_92_886 264
318 3300044735 Ga0466968_0064983 Ga0466968_0064983_67_861 264
319 3300044735 Ga0466968_0090999 Ga0466968_0090999_118_912 264
320 3300044765 Ga0466970_0000607 Ga0466970_0000607_4413_5228 264
321 3300044765 Ga0466970_0143170 Ga0466970_0143170_142_936 264
322 3300044842 Ga0466957_0007434 Ga0466957_0007434_1684_2478 264
323 3300044842 Ga0466957_0033924 Ga0466957_0033924_774_1568 264
324 3300045049 Ga0466959_0051074 Ga0466959_0051074_414_1208 264
325 3300045976 Ga0466967_0093427 Ga0466967_0093427_1180_1974 264
326 3300046453 Ga0495627_001465 Ga0495627_001465_6756_7550 264
327 3300046455 Ga0495603_0117361 Ga0495603_0117361_253_1047 264
328 3300046457 Ga0495590_0001273 Ga0495590_0001273_8775_9614 264
329 3300046458 Ga0495591_000236 Ga0495591_000236_45608_46402 264
330 3300046460 Ga0495638_0082435 Ga0495638_0082435_796_1590 264
331 3300046472 Ga0495580_0070292 Ga0495580_0070292_236_1030 264
332 3300046473 Ga0495582_0013683 Ga0495582_0013683_1544_2338 264
333 3300046474 Ga0495605_0000177 Ga0495605_0000177_77310_78104 264
334 3300046474 Ga0495605_0001739 Ga0495605_0001739_12938_13732 264
335 3300046474 Ga0495605_0006538 Ga0495605_0006538_3757_4551 264
336 3300046474 Ga0495605_0013984 Ga0495605_0013984_1916_2710 264
337 3300046475 Ga0495639_0227324 Ga0495639_0227324_102_896 264
338 3300046491 Ga0495584_0000001 Ga0495584_0000001_155850_156644 264
339 3300046491 Ga0495584_0000366 Ga0495584_0000366_1842_2636 264
340 3300046491 Ga0495584_0000452 Ga0495584_0000452_3495_4289 264
341 3300046491 Ga0495584_0001551 Ga0495584_0001551_10557_11351 264
342 3300046491 Ga0495584_0004007 Ga0495584_0004007_3879_4673 264
343 3300046491 Ga0495584_0008288 Ga0495584_0008288_512_1306 264
344 3300046491 Ga0495584_0011200 Ga0495584_0011200_2568_3362 264
345 3300046491 Ga0495584_0011673 Ga0495584_0011673_1270_2064 264
346 3300046492 Ga0495585_0000600 Ga0495585_0000600_1955_2749 264
347 3300046492 Ga0495585_0000697 Ga0495585_0000697_1912_2706 264
348 3300046492 Ga0495585_0001480 Ga0495585_0001480_11384_12178 264
349 3300046492 Ga0495585_0006526 Ga0495585_0006526_3630_4424 264
350 3300046492 Ga0495585_0006714 Ga0495585_0006714_478_1272 264
351 3300046492 Ga0495585_0017738 Ga0495585_0017738_1540_2334 264
352 3300046492 Ga0495585_0028730 Ga0495585_0028730_1754_2548 264
353 3300046492 Ga0495585_0042463 Ga0495585_0042463_938_1732 264
354 3300046492 Ga0495585_0053236 Ga0495585_0053236_313_1107 264
355 3300046499 Ga0495594_0023866 Ga0495594_0023866_1790_2584 264
356 3300046499 Ga0495594_0245791 Ga0495594_0245791_131_925 264
357 3300046500 Ga0495596_0000615 Ga0495596_0000615_2016_2810 264
358 3300046500 Ga0495596_0000821 Ga0495596_0000821_2170_2964 264
359 3300046500 Ga0495596_0006977 Ga0495596_0006977_1738_2532 264
360 3300046500 Ga0495596_0008987 Ga0495596_0008987_2610_3404 264
361 3300046500 Ga0495596_0010760 Ga0495596_0010760_1762_2556 264
362 3300046500 Ga0495596_0018122 Ga0495596_0018122_1028_1822 264
363 3300046500 Ga0495596_0029061 Ga0495596_0029061_1184_1978 264
364 3300046501 Ga0495607_0001696 Ga0495607_0001696_2245_3039 264
365 3300046501 Ga0495607_0002247 Ga0495607_0002247_14833_15627 264
366 3300046501 Ga0495607_0011028 Ga0495607_0011028_3680_4474 264
367 3300046501 Ga0495607_0029059 Ga0495607_0029059_2177_2971 264
368 3300046501 Ga0495607_0102545 Ga0495607_0102545_312_1106 264
369 3300046506 Ga0495583_0000506 Ga0495583_0000506_51434_52228 264
370 3300046507 Ga0495606_0004705 Ga0495606_0004705_11071_11865 264
371 3300046507 Ga0495606_0015233 Ga0495606_0015233_1152_1946 264
372 3300046507 Ga0495606_0089815 Ga0495606_0089815_179_973 264
373 3300046507 Ga0495606_0135404 Ga0495606_0135404_348_1142 264
374 3300046512 Ga0495610_0010358 Ga0495610_0010358_3446_4240 264
375 3300046513 Ga0495616_0001634 Ga0495616_0001634_437_1231 264
376 3300046513 Ga0495616_0003927 Ga0495616_0003927_3829_4755 264
377 3300046513 Ga0495616_0008600 Ga0495616_0008600_4445_5239 264
378 3300046513 Ga0495616_0106653 Ga0495616_0106653_67_861 264
379 3300046518 Ga0495631_0006918 Ga0495631_0006918_4982_5776 264
380 3300046518 Ga0495631_0033138 Ga0495631_0033138_121_915 264
381 3300046519 Ga0495632_0000156 Ga0495632_0000156_6607_7401 264
382 3300046519 Ga0495632_0000537 Ga0495632_0000537_7225_8019 264
383 3300046519 Ga0495632_0011507 Ga0495632_0011507_662_1456 264
384 3300046519 Ga0495632_0035337 Ga0495632_0035337_308_1102 264
385 3300046522 Ga0495643_0002305 Ga0495643_0002305_3524_4318 264
386 3300046522 Ga0495643_0003688 Ga0495643_0003688_9155_9949 264
387 3300046522 Ga0495643_0008036 Ga0495643_0008036_5861_6655 264
388 3300046522 Ga0495643_0028675 Ga0495643_0028675_17_811 264
389 3300046522 Ga0495643_0031913 Ga0495643_0031913_194_988 264
390 3300046523 Ga0495644_0010708 Ga0495644_0010708_1746_2540 264
391 3300046523 Ga0495644_0019643 Ga0495644_0019643_685_1479 264
392 3300046523 Ga0495644_0053416 Ga0495644_0053416_602_1396 264
393 3300046523 Ga0495644_0064157 Ga0495644_0064157_337_1131 264
394 3300046524 Ga0495648_0023546 Ga0495648_0023546_315_1109 264
395 3300046526 Ga0495666_0002495 Ga0495666_0002495_7608_8402 264
396 3300046526 Ga0495666_0063882 Ga0495666_0063882_680_1474 264
397 3300046528 Ga0495642_0000053 Ga0495642_0000053_63008_63802 264
398 3300046528 Ga0495642_0000433 Ga0495642_0000433_2386_3180 264
399 3300046528 Ga0495642_0002723 Ga0495642_0002723_4037_4831 264
400 3300046531 Ga0495665_0001008 Ga0495665_0001008_2347_3141 264
401 3300046535 Ga0495586_0069245 Ga0495586_0069245_138_932 264
402 3300046538 Ga0495609_0000001 Ga0495609_0000001_523534_524460 264
403 3300046538 Ga0495609_0008646 Ga0495609_0008646_3853_4647 264
404 3300046538 Ga0495609_0020636 Ga0495609_0020636_470_1264 264
405 3300046538 Ga0495609_0026206 Ga0495609_0026206_423_1217 264
406 3300046542 Ga0495597_0000488 Ga0495597_0000488_2356_3150 264
407 3300046542 Ga0495597_0002178 Ga0495597_0002178_6448_7242 264
408 3300046542 Ga0495597_0002942 Ga0495597_0002942_6485_7279 264
409 3300046557 Ga0495622_0113871 Ga0495622_0113871_365_1159 264
410 3300046558 Ga0495633_0002380 Ga0495633_0002380_11404_12198 264
411 3300046558 Ga0495633_0027256 Ga0495633_0027256_1814_2608 264
412 3300046558 Ga0495633_0051966 Ga0495633_0051966_762_1556 264
413 3300046615 Ga0495656_0017719 Ga0495656_0017719_1666_2460 264
414 3300046615 Ga0495656_0030285 Ga0495656_0030285_1283_2077 264
415 3300046615 Ga0495656_0105218 Ga0495656_0105218_96_890 264
416 3300046616 Ga0495668_0002833 Ga0495668_0002833_11275_12087 264
417 3300046616 Ga0495668_0006442 Ga0495668_0006442_5617_6411 264
418 3300046616 Ga0495668_0006681 Ga0495668_0006681_6487_7281 264
419 3300046616 Ga0495668_0024499 Ga0495668_0024499_1274_2068 264
420 3300046616 Ga0495668_0050068 Ga0495668_0050068_568_1362 264
421 3300046616 Ga0495668_0089260 Ga0495668_0089260_298_1092 264
422 3300046616 Ga0495668_0218136 Ga0495668_0218136_97_891 264
423 3300046648 Ga0495611_0000960 Ga0495611_0000960_11429_12223 264
424 3300046648 Ga0495611_0005964 Ga0495611_0005964_1355_2149 264
425 3300046648 Ga0495611_0061906 Ga0495611_0061906_137_931 264
426 3300046648 Ga0495611_0213440 Ga0495611_0213440_82_876 264
427 3300046660 Ga0495625_0005815 Ga0495625_0005815_241_1035 264
428 3300046660 Ga0495625_0041053 Ga0495625_0041053_2530_3324 264
429 3300046665 Ga0495661_0000069 Ga0495661_0000069_96074_96868 264
430 3300046665 Ga0495661_0005217 Ga0495661_0005217_5269_6063 264
431 3300046665 Ga0495661_0009005 Ga0495661_0009005_2298_3092 264
432 3300046665 Ga0495661_0021506 Ga0495661_0021506_3138_3932 264
433 3300046665 Ga0495661_0050020 Ga0495661_0050020_555_1349 264
434 3300046665 Ga0495661_0060506 Ga0495661_0060506_308_1102 264
435 3300046665 Ga0495661_0135992 Ga0495661_0135992_411_1205 264
436 3300046674 Ga0495588_0000041 Ga0495588_0000041_144345_145139 264
437 3300046674 Ga0495588_0111712 Ga0495588_0111712_11_805 264
438 3300046684 Ga0495669_0013262 Ga0495669_0013262_1234_2028 264
439 3300046684 Ga0495669_0025414 Ga0495669_0025414_927_1721 264
440 3300046691 Ga0495670_0002666 Ga0495670_0002666_1441_2235 264
441 3300046691 Ga0495670_0060581 Ga0495670_0060581_922_1716 264
442 3300046692 Ga0495671_0008192 Ga0495671_0008192_637_1431 264
443 3300046694 Ga0495649_0000537 Ga0495649_0000537_3465_4259 264
444 3300046694 Ga0495649_0001788 Ga0495649_0001788_3763_4557 264
445 3300046694 Ga0495649_0020176 Ga0495649_0020176_2482_3276 264
446 3300046794 Ga0495589_0000061 Ga0495589_0000061_39521_40447 264
447 3300046794 Ga0495589_0000072 Ga0495589_0000072_3770_4564 264
448 3300046794 Ga0495589_0014127 Ga0495589_0014127_1321_2115 264
449 3300046794 Ga0495589_0030024 Ga0495589_0030024_696_1490 264
450 3300046794 Ga0495589_0046286 Ga0495589_0046286_343_1137 264
451 3300046810 Ga0495660_0000243 Ga0495660_0000243_11810_12604 264
452 3300046810 Ga0495660_0008501 Ga0495660_0008501_362_1156 264
453 3300046810 Ga0495660_0074213 Ga0495660_0074213_847_1680 264
454 3300047317 Ga0495604_0154424 Ga0495604_0154424_165_959 264
455 3300047318 Ga0495636_0000011 Ga0495636_0000011_11268_12062 264
456 3300047318 Ga0495636_0003018 Ga0495636_0003018_2681_3475 264
457 3300047320 Ga0495672_0000258 Ga0495672_0000258_3693_4487 264
458 3300047320 Ga0495672_0010604 Ga0495672_0010604_3941_4750 264
459 3300047320 Ga0495672_0020962 Ga0495672_0020962_1556_2350 264
460 3300047321 Ga0495676_0039316 Ga0495676_0039316_2518_3312 264
461 3300047323 Ga0495683_0000009 Ga0495683_0000009_46997_47791 264
462 3300047323 Ga0495683_0000446 Ga0495683_0000446_3914_4708 264
463 3300047323 Ga0495683_0015742 Ga0495683_0015742_492_1286 264
464 3300047443 Ga0495687_000027 Ga0495687_000027_181806_182732 264
465 3300047443 Ga0495687_000630 Ga0495687_000630_26531_27325 264
466 3300047443 Ga0495687_001824 Ga0495687_001824_15864_16658 264
467 3300047443 Ga0495687_002017 Ga0495687_002017_5136_5930 264
468 3300047444 Ga0495675_0030627 Ga0495675_0030627_2217_3011 264
469 3300047445 Ga0495677_0000001 Ga0495677_0000001_181887_182813 264
470 3300047445 Ga0495677_0000195 Ga0495677_0000195_2935_3729 264
471 3300047445 Ga0495677_0001118 Ga0495677_0001118_7707_8501 264
472 3300047445 Ga0495677_0001701 Ga0495677_0001701_487_1281 264
473 3300047445 Ga0495677_0006543 Ga0495677_0006543_3433_4227 264
474 3300047446 Ga0495679_001482 Ga0495679_001482_12226_13020 264
475 3300047446 Ga0495679_016971 Ga0495679_016971_614_1408 264
476 3300047470 Ga0495681_0000428 Ga0495681_0000428_5395_6189 264
477 3300047470 Ga0495681_0015193 Ga0495681_0015193_2117_2911 264
478 3300047470 Ga0495681_0024964 Ga0495681_0024964_1502_2296 264
479 3300047472 Ga0495686_0000146 Ga0495686_0000146_655_1449 264
480 3300047472 Ga0495686_0000373 Ga0495686_0000373_34521_35315 264
481 3300047472 Ga0495686_0001101 Ga0495686_0001101_28408_29202 264
482 3300047472 Ga0495686_0006503 Ga0495686_0006503_7674_8468 264
483 3300047472 Ga0495686_0047236 Ga0495686_0047236_1270_2064 264
484 3300047673 Ga0495593_0213731 Ga0495593_0213731_37_831 264
485 3300048091 Ga0495626_0000027 Ga0495626_0000027_166356_167150 264
486 3300048091 Ga0495626_0000135 Ga0495626_0000135_90741_91535 264
487 3300048091 Ga0495626_0000193 Ga0495626_0000193_32356_33150 264
488 3300048091 Ga0495626_0039499 Ga0495626_0039499_787_1581 264
489 3300048091 Ga0495626_0067380 Ga0495626_0067380_266_1060 264
490 3300048904 Ga0496101_0066030 Ga0496101_0066030_1016_1810 264
491 3300048905 Ga0496102_0000058 Ga0496102_0000058_122186_122980 264
492 3300048907 Ga0496104_0443251 Ga0496104_0443251_188_982 264
493 3300048909 Ga0496106_0297027 Ga0496106_0297027_326_1120 264
494 3300048910 Ga0496107_0170968 Ga0496107_0170968_450_1244 264
495 3300048912 Ga0496109_0347154 Ga0496109_0347154_548_1342 264
496 3300048913 Ga0496110_0000251 Ga0496110_0000251_1880_2674 264
497 3300048913 Ga0496110_0009047 Ga0496110_0009047_1092_1886 264
498 3300048913 Ga0496110_0021952 Ga0496110_0021952_2961_3755 264
499 3300048915 Ga0496112_0240363 Ga0496112_0240363_358_1152 264
500 3300048916 Ga0496113_0405827 Ga0496113_0405827_77_871 264
501 3300048918 Ga0496115_0112393 Ga0496115_0112393_456_1250 264
502 3300048919 Ga0496116_0003966 Ga0496116_0003966_8593_9387 264
503 3300048924 Ga0496121_0161506 Ga0496121_0161506_213_1007 264
504 3300048925 Ga0496122_0002056 Ga0496122_0002056_10530_11324 264
505 3300048925 Ga0496122_0007048 Ga0496122_0007048_4548_5342 264
506 3300048925 Ga0496122_0022678 Ga0496122_0022678_2543_3337 264
507 3300048926 Ga0496123_0001705 Ga0496123_0001705_23243_24037 264
508 3300048926 Ga0496123_0004467 Ga0496123_0004467_11288_12082 264
509 3300048927 Ga0496124_0013112 Ga0496124_0013112_6404_7198 264
510 3300048927 Ga0496124_0180220 Ga0496124_0180220_80_895 264
511 3300048928 Ga0496125_0002290 Ga0496125_0002290_10215_11009 264
512 3300049128 Ga0501308_001455 Ga0501308_001455_907_1701 264
513 3300049459 Ga0495678_000110 Ga0495678_000110_3584_4378 264
514 3300049459 Ga0495678_022198 Ga0495678_022198_1256_2050 264
515 3300049460 Ga0495682_0007385 Ga0495682_0007385_1933_2727 264
516 3300049460 Ga0495682_0020557 Ga0495682_0020557_438_1232 264
517 3300049521 Ga0501298_004446 Ga0501298_004446_246_1040 264
518 3300049571 Ga0501034_0023415 Ga0501034_0023415_2412_3227 264
519 3300049571 Ga0501034_0170353 Ga0501034_0170353_156_965 264
520 3300049571 Ga0501034_0212020 Ga0501034_0212020_753_1562 264
521 3300049574 Ga0501038_0149218 Ga0501038_0149218_104_913 264
522 3300049575 Ga0501039_0456830 Ga0501039_0456830_37_846 264
523 3300049579 Ga0501043_0113283 Ga0501043_0113283_573_1382 264
524 3300049583 Ga0501067_0026472 Ga0501067_0026472_1668_2483 264
525 3300049585 Ga0501069_0048089 Ga0501069_0048089_922_1737 264
526 3300049586 Ga0501070_0376927 Ga0501070_0376927_321_1136 264
527 3300049588 Ga0501072_0181283 Ga0501072_0181283_519_1334 264
528 3300049589 Ga0501073_0162407 Ga0501073_0162407_586_1401 264
529 3300049651 Ga0501201_000140 Ga0501201_000140_1995_2789 264
530 3300049654 Ga0501207_011209 Ga0501207_011209_92_886 264
531 3300049661 Ga0501217_017854 Ga0501217_017854_129_923 264
532 3300049662 Ga0501222_004316 Ga0501222_004316_835_1629 264
533 3300049663 Ga0501223_001744 Ga0501223_001744_543_1337 264
534 3300049668 Ga0501233_014174 Ga0501233_014174_426_1220 264
535 3300049669 Ga0501235_001675 Ga0501235_001675_3859_4653 264
536 3300049674 Ga0501242_002559 Ga0501242_002559_253_1047 264
537 3300049675 Ga0501243_001273 Ga0501243_001273_358_1152 264
538 3300049681 Ga0501251_017977 Ga0501251_017977_39_833 264
539 3300049686 Ga0501257_003118 Ga0501257_003118_2591_3385 264
540 3300049686 Ga0501257_004374 Ga0501257_004374_289_1083 264
541 3300049688 Ga0501259_004374 Ga0501259_004374_259_1053 264
542 3300049707 Ga0501234_011897 Ga0501234_011897_172_966 264
543 3300049708 Ga0501245_004933 Ga0501245_004933_280_1074 264
544 3300049742 Ga0501080_0223463 Ga0501080_0223463_778_1593 264
545 3300049744 Ga0501083_0015230 Ga0501083_0015230_1629_2444 264
546 3300049757 Ga0501232_001451 Ga0501232_001451_804_1598 264
547 3300049763 Ga0501266_001738 Ga0501266_001738_656_1450 264
548 3300049822 Ga0501035_0159292 Ga0501035_0159292_179_988 264
549 3300049822 Ga0501035_0521741 Ga0501035_0521741_35_850 264
550 3300050493 nmdc:mga0k408_92153_c1 nmdc:mga0k408_92153_c1_227_1021 264
551 3300053088 Ga0500644_0063132 Ga0500644_0063132_379_1173 264
552 3300053096 Ga0500641_0025562 Ga0500641_0025562_719_1513 264
553 3300053108 Ga0500562_000077 Ga0500562_000077_5731_6525 264
554 3300053139 Ga0500568_0006155 Ga0500568_0006155_4689_5510 264
555 3300053156 Ga0500622_0003322 Ga0500622_0003322_6716_7510 264
556 3300054114 Ga0501084_0029727 Ga0501084_0029727_3434_4249 264
557 3300059493 Ga0587077_025297 Ga0587077_025297_225_1019 264
558 3300059505 Ga0587083_0020468 Ga0587083_0020468_276_1070 264
559 3300059641 Ga0587068_008424 Ga0587068_008424_646_1440 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

270

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0r-assembly1.cif.gz_A crystal structure of thymidylate synthase from corynebacterium glutamicum 0.9746 3 258
6auj-assembly2.cif.gz_C crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.9743 1 251
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9726 3 262
4h0r-assembly1.cif.gz_B crystal structure of thymidylate synthase from corynebacterium glutamicum 0.9718 3 258
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9716 1 261
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9593 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9466 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9443 2 262 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9397 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.933 2 251 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9826 99 228 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A4Z0P2P4-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9778 51 259 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3Q3X194-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9759 107 243 GO:0004799
GO:0005739
GO:0005829
GO:0006231
GO:0006235
GO:0032259
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9743 119 250
AF-A0A355C418-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9742 1 222 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map