F463596
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 298 | 547 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0002833|Ga0495668_0002833_11275_12087 |
| Length | 270 |
| Sequence | MQQYLDLLQHIIDKGVTKTDRTGTGTTSCFGYQMRFDLQQGFPLVTTKKLHLKSIVYELLWFLQGDTNTRYLKEHNVSIWDEWADENGNLGPVYGKQWRSWQGANGKTIDQISDALNQIKNNPDSRRIIVSAWNVAELPEMALMPCHALFQFYVAPGVNGGKGKLSCQLYQRSADVFLGVPFNIASYALLTMMMAQVCDLEPGDFVHTFGDVHLYSNHIEQARLQLTRTPNALPTMKLNPAVKDLFSFTFEDFTLENYQPHPAIKAPVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 3 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 4 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 5 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 6 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 7 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 8 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 9 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 10 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 11 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 12 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 151 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 162 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 163 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 164 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 174 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 270 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 271 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 277 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 279 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 285 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 293 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.72 |
| Isolates | 2.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.58 |
| Nodule | 0.54 |
| Rhizoplane | 2.5 |
| Rhizosphere | 87.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3160980 | 2162886007 | Bacteria | 4069 |
| 2 | JGI24740J21852_10019370 | 3300001979 | Bacteria | 2397 |
| 3 | JGI25156J39149_1001190 | 3300002705 | Bacteria | 11580 |
| 4 | JGI25162J39368_1004954 | 3300002737 | Bacteria | 2824 |
| 5 | JGI25154J39366_1000986 | 3300002738 | Bacteria | 11547 |
| 6 | JGI25157J39369_1001849 | 3300002741 | Bacteria | 6593 |
| 7 | JGI25406J46586_10012099 | 3300003203 | Bacteria | 3757 |
| 8 | rootH2_10013019 | 3300003320 | Bacteria | 26132 |
| 9 | rootL2_10241602 | 3300003322 | Bacteria | 2435 |
| 10 | JGI25160J50197_1000425 | 3300003354 | Bacteria | 26592 |
| 11 | Ga0055532_1000077 | 3300003758 | Bacteria | 122193 |
| 12 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 13 | Ga0055542_1012403 | 3300003762 | Bacteria | 1475 |
| 14 | Ga0065704_10072654 | 3300005289 | Bacteria | 8196 |
| 15 | Ga0070658_10025472 | 3300005327 | Bacteria | 4741 |
| 16 | Ga0070658_10028978 | 3300005327 | Bacteria | 4446 |
| 17 | Ga0070658_10196661 | 3300005327 | Bacteria | 1700 |
| 18 | Ga0070676_10120820 | 3300005328 | Bacteria | 1644 |
| 19 | Ga0070683_100007781 | 3300005329 | Bacteria | 9072 |
| 20 | Ga0070683_100522899 | 3300005329 | Bacteria | 1134 |
| 21 | Ga0070670_100050548 | 3300005331 | Bacteria | 3572 |
| 22 | Ga0070670_100210256 | 3300005331 | Bacteria | 1691 |
| 23 | Ga0068869_100010056 | 3300005334 | Bacteria | 6154 |
| 24 | Ga0068869_100017750 | 3300005334 | Bacteria | 4833 |
| 25 | Ga0070666_10000736 | 3300005335 | Bacteria | 19845 |
| 26 | Ga0070666_10089513 | 3300005335 | Bacteria | 2112 |
| 27 | Ga0070680_100000088 | 3300005336 | Bacteria | 51479 |
| 28 | Ga0070680_100038613 | 3300005336 | Bacteria | 3861 |
| 29 | Ga0068868_100025378 | 3300005338 | Bacteria | 4508 |
| 30 | Ga0068868_100045260 | 3300005338 | Bacteria | 3443 |
| 31 | Ga0068868_100224499 | 3300005338 | Bacteria | 1574 |
| 32 | Ga0070660_100042601 | 3300005339 | Bacteria | 3465 |
| 33 | Ga0070660_100058718 | 3300005339 | Bacteria | 2982 |
| 34 | Ga0070660_100080999 | 3300005339 | Bacteria | 2548 |
| 35 | Ga0070660_100105690 | 3300005339 | Bacteria | 2235 |
| 36 | Ga0070660_100132997 | 3300005339 | Bacteria | 1992 |
| 37 | Ga0070660_100260270 | 3300005339 | Bacteria | 1416 |
| 38 | Ga0070689_100026131 | 3300005340 | Bacteria | 4393 |
| 39 | Ga0070661_100017437 | 3300005344 | Bacteria | 5095 |
| 40 | Ga0070668_100036467 | 3300005347 | Bacteria | 3753 |
| 41 | Ga0070668_100189194 | 3300005347 | Bacteria | 1685 |
| 42 | Ga0070669_100147955 | 3300005353 | Bacteria | 1816 |
| 43 | Ga0070675_100038520 | 3300005354 | Bacteria | 3897 |
| 44 | Ga0070671_100014761 | 3300005355 | Bacteria | 6312 |
| 45 | Ga0070671_100110999 | 3300005355 | Bacteria | 2304 |
| 46 | Ga0070674_100121079 | 3300005356 | Bacteria | 1937 |
| 47 | Ga0070673_100023997 | 3300005364 | Bacteria | 4463 |
| 48 | Ga0070673_100536616 | 3300005364 | Bacteria | 1061 |
| 49 | Ga0070688_100008462 | 3300005365 | Bacteria | 5584 |
| 50 | Ga0070659_100010190 | 3300005366 | Bacteria | 6915 |
| 51 | Ga0070659_100043243 | 3300005366 | Bacteria | 3523 |
| 52 | Ga0070659_100078813 | 3300005366 | Bacteria | 2629 |
| 53 | Ga0070659_100082890 | 3300005366 | Bacteria | 2562 |
| 54 | Ga0070663_100375911 | 3300005455 | Bacteria | 1156 |
| 55 | Ga0070678_100013458 | 3300005456 | Bacteria | 5131 |
| 56 | Ga0070678_100131890 | 3300005456 | Bacteria | 1986 |
| 57 | Ga0070662_100151157 | 3300005457 | Bacteria | 1808 |
| 58 | Ga0068867_100008426 | 3300005459 | Bacteria | 7272 |
| 59 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 60 | Ga0070679_100075145 | 3300005530 | Bacteria | 3369 |
| 61 | Ga0070679_100347760 | 3300005530 | Bacteria | 1430 |
| 62 | Ga0070672_100027937 | 3300005543 | Bacteria | 4214 |
| 63 | Ga0070665_100043589 | 3300005548 | Bacteria | 4508 |
| 64 | Ga0068855_100045035 | 3300005563 | Bacteria | 5219 |
| 65 | Ga0068855_100079309 | 3300005563 | Bacteria | 3808 |
| 66 | Ga0068855_100737942 | 3300005563 | Bacteria | 1051 |
| 67 | Ga0070664_100024674 | 3300005564 | Bacteria | 4977 |
| 68 | Ga0070664_100048325 | 3300005564 | Bacteria | 3595 |
| 69 | Ga0070664_100094830 | 3300005564 | Bacteria | 2588 |
| 70 | Ga0070664_100273688 | 3300005564 | Bacteria | 1521 |
| 71 | Ga0068857_100046969 | 3300005577 | Bacteria | 3832 |
| 72 | Ga0068857_100075562 | 3300005577 | Bacteria | 3004 |
| 73 | Ga0068854_100094454 | 3300005578 | Bacteria | 2231 |
| 74 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 75 | Ga0068859_100005033 | 3300005617 | Bacteria | 13412 |
| 76 | Ga0068859_100154534 | 3300005617 | Bacteria | 2371 |
| 77 | Ga0068859_100167475 | 3300005617 | Bacteria | 2277 |
| 78 | Ga0068859_100338016 | 3300005617 | Bacteria | 1600 |
| 79 | Ga0068864_100009579 | 3300005618 | Bacteria | 7987 |
| 80 | Ga0068864_100053693 | 3300005618 | Bacteria | 3477 |
| 81 | Ga0068864_100055678 | 3300005618 | Bacteria | 3415 |
| 82 | Ga0068864_100303277 | 3300005618 | Bacteria | 1496 |
| 83 | Ga0068866_10024844 | 3300005718 | Bacteria | 2810 |
| 84 | Ga0068861_100044059 | 3300005719 | Bacteria | 3353 |
| 85 | Ga0068851_10008075 | 3300005834 | Bacteria | 4857 |
| 86 | Ga0068851_10010366 | 3300005834 | Bacteria | 4350 |
| 87 | Ga0068851_10117872 | 3300005834 | Bacteria | 1424 |
| 88 | Ga0068870_10012327 | 3300005840 | Bacteria | 3992 |
| 89 | Ga0068863_100032377 | 3300005841 | Bacteria | 4984 |
| 90 | Ga0068858_100002312 | 3300005842 | Bacteria | 19265 |
| 91 | Ga0068858_100841454 | 3300005842 | Bacteria | 896 |
| 92 | Ga0068860_100003825 | 3300005843 | Bacteria | 15482 |
| 93 | Ga0068860_100026415 | 3300005843 | Bacteria | 5597 |
| 94 | Ga0068860_100030783 | 3300005843 | Bacteria | 5160 |
| 95 | Ga0081539_10000531 | 3300005985 | Bacteria | 79191 |
| 96 | Ga0075366_10107926 | 3300006195 | Bacteria | 1674 |
| 97 | Ga0097621_100032447 | 3300006237 | Bacteria | 4151 |
| 98 | Ga0097621_100068063 | 3300006237 | Bacteria | 2936 |
| 99 | Ga0068871_100083751 | 3300006358 | Bacteria | 2646 |
| 100 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 101 | Ga0097620_100005033 | 3300006931 | Bacteria | 13412 |
| 102 | Ga0097620_100154525 | 3300006931 | Bacteria | 2371 |
| 103 | Ga0097620_100167474 | 3300006931 | Bacteria | 2277 |
| 104 | Ga0097620_100338022 | 3300006931 | Bacteria | 1600 |
| 105 | Ga0105240_10051294 | 3300009093 | Bacteria | 5193 |
| 106 | Ga0105245_10057483 | 3300009098 | Bacteria | 3498 |
| 107 | Ga0105245_10181275 | 3300009098 | Bacteria | 2012 |
| 108 | Ga0105245_10386836 | 3300009098 | Bacteria | 1394 |
| 109 | Ga0105247_10045640 | 3300009101 | Bacteria | 2689 |
| 110 | Ga0105241_10001242 | 3300009174 | Bacteria | 19468 |
| 111 | Ga0105241_10063295 | 3300009174 | Bacteria | 2854 |
| 112 | Ga0105241_10119939 | 3300009174 | Bacteria | 2116 |
| 113 | Ga0105242_10031141 | 3300009176 | Bacteria | 4258 |
| 114 | Ga0105242_10119104 | 3300009176 | Bacteria | 2263 |
| 115 | Ga0105237_10011912 | 3300009545 | Bacteria | 9193 |
| 116 | Ga0105237_10019373 | 3300009545 | Bacteria | 7028 |
| 117 | Ga0105238_10054006 | 3300009551 | Bacteria | 4036 |
| 118 | Ga0105239_10050855 | 3300010375 | Bacteria | 4544 |
| 119 | Ga0105246_10059113 | 3300011119 | Bacteria | 2658 |
| 120 | Ga0157373_10049310 | 3300013100 | Bacteria | 3001 |
| 121 | Ga0157371_10003328 | 3300013102 | Bacteria | 14681 |
| 122 | Ga0157370_10058627 | 3300013104 | Bacteria | 3659 |
| 123 | Ga0157370_10163019 | 3300013104 | Bacteria | 2074 |
| 124 | Ga0157370_10486663 | 3300013104 | Bacteria | 1134 |
| 125 | Ga0157369_10040311 | 3300013105 | Bacteria | 5098 |
| 126 | Ga0157369_10109403 | 3300013105 | Bacteria | 2939 |
| 127 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 128 | Ga0157374_10065573 | 3300013296 | Bacteria | 3410 |
| 129 | Ga0157374_10148425 | 3300013296 | Bacteria | 2279 |
| 130 | Ga0157374_10583976 | 3300013296 | Bacteria | 1127 |
| 131 | Ga0157378_10036726 | 3300013297 | Bacteria | 4336 |
| 132 | Ga0157378_10057003 | 3300013297 | Bacteria | 3482 |
| 133 | Ga0157378_10057524 | 3300013297 | Bacteria | 3465 |
| 134 | Ga0157378_10059615 | 3300013297 | Bacteria | 3405 |
| 135 | Ga0157378_10123678 | 3300013297 | Bacteria | 2387 |
| 136 | Ga0157378_10140088 | 3300013297 | Bacteria | 2245 |
| 137 | Ga0163162_10004768 | 3300013306 | Bacteria | 13086 |
| 138 | Ga0163162_10319034 | 3300013306 | Bacteria | 1686 |
| 139 | Ga0157372_10089689 | 3300013307 | Bacteria | 3494 |
| 140 | Ga0157372_10201163 | 3300013307 | Bacteria | 2307 |
| 141 | Ga0157372_10352456 | 3300013307 | Bacteria | 1715 |
| 142 | Ga0157372_10390004 | 3300013307 | Bacteria | 1623 |
| 143 | Ga0157372_10432922 | 3300013307 | Bacteria | 1533 |
| 144 | Ga0157375_10091600 | 3300013308 | Bacteria | 3102 |
| 145 | Ga0157375_10149311 | 3300013308 | Bacteria | 2471 |
| 146 | Ga0157375_10455800 | 3300013308 | Bacteria | 1444 |
| 147 | Ga0163163_10001732 | 3300014325 | Bacteria | 18387 |
| 148 | Ga0163163_10018090 | 3300014325 | Bacteria | 6586 |
| 149 | Ga0157380_10022365 | 3300014326 | Bacteria | 4758 |
| 150 | Ga0182008_10071418 | 3300014497 | Bacteria | 1708 |
| 151 | Ga0157377_10013348 | 3300014745 | Bacteria | 4157 |
| 152 | Ga0157379_10058571 | 3300014968 | Bacteria | 3445 |
| 153 | Ga0157376_10032889 | 3300014969 | Bacteria | 4169 |
| 154 | Ga0209435_100082 | 3300025206 | Bacteria | 45642 |
| 155 | Ga0209147_100122 | 3300025229 | Bacteria | 138553 |
| 156 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 157 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 158 | Ga0209258_100739 | 3300025242 | Bacteria | 21164 |
| 159 | Ga0209646_1000152 | 3300025246 | Bacteria | 97484 |
| 160 | Ga0209026_1000126 | 3300025250 | Bacteria | 122422 |
| 161 | Ga0209677_102681 | 3300025253 | Bacteria | 6422 |
| 162 | Ga0209148_1000576 | 3300025254 | Bacteria | 34082 |
| 163 | Ga0209759_1000193 | 3300025256 | Bacteria | 97484 |
| 164 | Ga0207426_1000032 | 3300025302 | Bacteria | 457997 |
| 165 | Ga0207656_10007990 | 3300025321 | Bacteria | 3879 |
| 166 | Ga0207656_10139487 | 3300025321 | Bacteria | 1142 |
| 167 | Ga0207682_10029991 | 3300025893 | Bacteria | 2177 |
| 168 | Ga0207682_10039977 | 3300025893 | Bacteria | 1909 |
| 169 | Ga0207642_10012030 | 3300025899 | Bacteria | 3110 |
| 170 | Ga0207710_10166457 | 3300025900 | Bacteria | 1076 |
| 171 | Ga0207688_10050439 | 3300025901 | Bacteria | 2329 |
| 172 | Ga0207680_10002758 | 3300025903 | Bacteria | 8216 |
| 173 | Ga0207680_10024859 | 3300025903 | Bacteria | 3295 |
| 174 | Ga0207645_10008175 | 3300025907 | Bacteria | 7325 |
| 175 | Ga0207645_10113229 | 3300025907 | Bacteria | 1757 |
| 176 | Ga0207643_10061389 | 3300025908 | Bacteria | 2147 |
| 177 | Ga0207705_10094360 | 3300025909 | Bacteria | 2194 |
| 178 | Ga0207654_10001781 | 3300025911 | Bacteria | 11188 |
| 179 | Ga0207654_10009833 | 3300025911 | Bacteria | 4864 |
| 180 | Ga0207654_10364325 | 3300025911 | Bacteria | 998 |
| 181 | Ga0207671_10001737 | 3300025914 | Bacteria | 24547 |
| 182 | Ga0207660_10000231 | 3300025917 | Bacteria | 35986 |
| 183 | Ga0207660_10144387 | 3300025917 | Bacteria | 1822 |
| 184 | Ga0207660_10388337 | 3300025917 | Bacteria | 1123 |
| 185 | Ga0207657_10005484 | 3300025919 | Bacteria | 13247 |
| 186 | Ga0207657_10071592 | 3300025919 | Bacteria | 2936 |
| 187 | Ga0207657_10085037 | 3300025919 | Bacteria | 2651 |
| 188 | Ga0207657_10115329 | 3300025919 | Bacteria | 2214 |
| 189 | Ga0207657_10539017 | 3300025919 | Bacteria | 913 |
| 190 | Ga0207649_10010790 | 3300025920 | Bacteria | 5022 |
| 191 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 192 | Ga0207652_10000101 | 3300025921 | Bacteria | 93033 |
| 193 | Ga0207652_10160509 | 3300025921 | Bacteria | 2015 |
| 194 | Ga0207694_10126826 | 3300025924 | Bacteria | 2042 |
| 195 | Ga0207659_10029066 | 3300025926 | Bacteria | 3763 |
| 196 | Ga0207659_10077383 | 3300025926 | Bacteria | 2448 |
| 197 | Ga0207687_10047815 | 3300025927 | Bacteria | 2967 |
| 198 | Ga0207644_10123410 | 3300025931 | Bacteria | 1974 |
| 199 | Ga0207690_10008026 | 3300025932 | Bacteria | 6267 |
| 200 | Ga0207690_10025312 | 3300025932 | Bacteria | 3724 |
| 201 | Ga0207690_10085253 | 3300025932 | Bacteria | 2217 |
| 202 | Ga0207690_10385863 | 3300025932 | Bacteria | 1114 |
| 203 | Ga0207686_10083724 | 3300025934 | Bacteria | 2088 |
| 204 | Ga0207670_10045864 | 3300025936 | Bacteria | 2900 |
| 205 | Ga0207669_10056730 | 3300025937 | Bacteria | 2380 |
| 206 | Ga0207704_10062769 | 3300025938 | Bacteria | 2312 |
| 207 | Ga0207691_10033299 | 3300025940 | Bacteria | 4797 |
| 208 | Ga0207691_10050300 | 3300025940 | Bacteria | 3815 |
| 209 | Ga0207691_10075103 | 3300025940 | Bacteria | 3048 |
| 210 | Ga0207691_10092613 | 3300025940 | Bacteria | 2707 |
| 211 | Ga0207689_10002113 | 3300025942 | Bacteria | 18676 |
| 212 | Ga0207689_10004902 | 3300025942 | Bacteria | 12069 |
| 213 | Ga0207689_10016695 | 3300025942 | Bacteria | 6212 |
| 214 | Ga0207689_10146936 | 3300025942 | Bacteria | 1942 |
| 215 | Ga0207661_10210677 | 3300025944 | Bacteria | 1713 |
| 216 | Ga0207679_10012499 | 3300025945 | Bacteria | 5537 |
| 217 | Ga0207667_10050356 | 3300025949 | Bacteria | 4395 |
| 218 | Ga0207651_10030376 | 3300025960 | Bacteria | 3440 |
| 219 | Ga0207651_10112157 | 3300025960 | Bacteria | 2049 |
| 220 | Ga0207712_10040602 | 3300025961 | Bacteria | 3195 |
| 221 | Ga0207668_10130196 | 3300025972 | Bacteria | 1920 |
| 222 | Ga0207677_10038689 | 3300026023 | Bacteria | 3130 |
| 223 | Ga0207677_10048022 | 3300026023 | Bacteria | 2871 |
| 224 | Ga0207677_10053515 | 3300026023 | Bacteria | 2748 |
| 225 | Ga0207677_10233828 | 3300026023 | Bacteria | 1482 |
| 226 | Ga0207703_10000878 | 3300026035 | Bacteria | 29522 |
| 227 | Ga0207678_10319081 | 3300026067 | Bacteria | 1337 |
| 228 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 229 | Ga0207648_10007071 | 3300026089 | Bacteria | 11073 |
| 230 | Ga0207648_10008275 | 3300026089 | Bacteria | 10099 |
| 231 | Ga0207676_10027669 | 3300026095 | Bacteria | 4225 |
| 232 | Ga0207676_10179411 | 3300026095 | Bacteria | 1853 |
| 233 | Ga0207674_10010770 | 3300026116 | Bacteria | 10317 |
| 234 | Ga0207674_10061307 | 3300026116 | Bacteria | 3801 |
| 235 | Ga0207675_100072985 | 3300026118 | Bacteria | 3210 |
| 236 | Ga0207675_100134258 | 3300026118 | Bacteria | 2347 |
| 237 | Ga0207675_100182952 | 3300026118 | Bacteria | 2007 |
| 238 | Ga0207675_100632143 | 3300026118 | Bacteria | 1075 |
| 239 | Ga0207683_10003508 | 3300026121 | Bacteria | 13678 |
| 240 | Ga0207683_10010782 | 3300026121 | Bacteria | 7793 |
| 241 | Ga0207683_10024062 | 3300026121 | Bacteria | 5241 |
| 242 | Ga0207683_10325089 | 3300026121 | Bacteria | 1409 |
| 243 | Ga0207698_10006261 | 3300026142 | Bacteria | 7406 |
| 244 | Ga0209281_1000056 | 3300027111 | Bacteria | 307619 |
| 245 | Ga0268265_10361576 | 3300028380 | Bacteria | 1329 |
| 246 | Ga0268264_10002971 | 3300028381 | Bacteria | 14730 |
| 247 | Ga0268264_10020319 | 3300028381 | Bacteria | 5427 |
| 248 | Ga0316180_1157605 | 3300030736 | Bacteria | 2566 |
| 249 | Ga0316182_1221789 | 3300030745 | Bacteria | 3419 |
| 250 | Ga0265327_10000432 | 3300031251 | Bacteria | 75935 |
| 251 | Ga0307508_10001325 | 3300031616 | Bacteria | 28026 |
| 252 | Ga0307413_10428649 | 3300031824 | Bacteria | 1044 |
| 253 | Ga0307406_10309760 | 3300031901 | Bacteria | 1217 |
| 254 | Ga0316574_0083314 | 3300035398 | Bacteria | 2033 |
| 255 | Ga0316574_0130205 | 3300035398 | Bacteria | 1619 |
| 256 | Ga0395899_0002720 | 3300037312 | Bacteria | 14258 |
| 257 | Ga0395899_0023907 | 3300037312 | Bacteria | 4623 |
| 258 | Ga0395900_0000028 | 3300037418 | Bacteria | 285042 |
| 259 | Ga0395900_0002348 | 3300037418 | Bacteria | 20948 |
| 260 | Ga0395900_0004043 | 3300037418 | Bacteria | 15651 |
| 261 | Ga0395900_0128905 | 3300037418 | Bacteria | 2593 |
| 262 | Ga0395900_0205762 | 3300037418 | Bacteria | 1989 |
| 263 | Ga0395900_0741019 | 3300037418 | Bacteria | 913 |
| 264 | Ga0395898_0002043 | 3300037466 | Bacteria | 25263 |
| 265 | Ga0395898_0259732 | 3300037466 | Bacteria | 1656 |
| 266 | Ga0395901_0000025 | 3300038443 | Bacteria | 263463 |
| 267 | Ga0395901_0019500 | 3300038443 | Bacteria | 6933 |
| 268 | Ga0395901_0054633 | 3300038443 | Bacteria | 4151 |
| 269 | Ga0395901_0477792 | 3300038443 | Bacteria | 1271 |
| 270 | Ga0395901_0687442 | 3300038443 | Bacteria | 1022 |
| 271 | Ga0439445_0051958 | 3300042004 | Bacteria | 1108 |
| 272 | Ga0439448_0006129 | 3300042005 | Bacteria | 3451 |
| 273 | Ga0439449_0015862 | 3300042007 | Bacteria | 2832 |
| 274 | Ga0439446_0035090 | 3300042156 | Bacteria | 1462 |
| 275 | Ga0466969_0008401 | 3300044656 | Bacteria | 5475 |
| 276 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 277 | Ga0466972_0000801 | 3300044658 | Bacteria | 14959 |
| 278 | Ga0466972_0119060 | 3300044658 | Bacteria | 1246 |
| 279 | Ga0466965_0006443 | 3300044683 | Bacteria | 5332 |
| 280 | Ga0466965_0025139 | 3300044683 | Bacteria | 2882 |
| 281 | Ga0466965_0108388 | 3300044683 | Bacteria | 1425 |
| 282 | Ga0466966_0087316 | 3300044684 | Bacteria | 1938 |
| 283 | Ga0466966_0125173 | 3300044684 | Bacteria | 1576 |
| 284 | Ga0466966_0143467 | 3300044684 | Bacteria | 1458 |
| 285 | Ga0466961_0156681 | 3300044693 | Bacteria | 1420 |
| 286 | Ga0466964_0000574 | 3300044706 | Bacteria | 11581 |
| 287 | Ga0466964_0048969 | 3300044706 | Bacteria | 1729 |
| 288 | Ga0453684_0078879 | 3300044712 | Bacteria | 4119 |
| 289 | Ga0466971_0079794 | 3300044719 | Bacteria | 1491 |
| 290 | Ga0466968_0064983 | 3300044735 | Bacteria | 1579 |
| 291 | Ga0466968_0090999 | 3300044735 | Bacteria | 1352 |
| 292 | Ga0466970_0000607 | 3300044765 | Bacteria | 17574 |
| 293 | Ga0466970_0143170 | 3300044765 | Bacteria | 1318 |
| 294 | Ga0466957_0007434 | 3300044842 | Bacteria | 6188 |
| 295 | Ga0466957_0033924 | 3300044842 | Bacteria | 3062 |
| 296 | Ga0466959_0051074 | 3300045049 | Bacteria | 3034 |
| 297 | Ga0466967_0093427 | 3300045976 | Bacteria | 2737 |
| 298 | Ga0495627_001465 | 3300046453 | Bacteria | 13766 |
| 299 | Ga0495603_0117361 | 3300046455 | Bacteria | 1551 |
| 300 | Ga0495590_0001273 | 3300046457 | Bacteria | 10960 |
| 301 | Ga0495591_000236 | 3300046458 | Bacteria | 53618 |
| 302 | Ga0495638_0082435 | 3300046460 | Bacteria | 1951 |
| 303 | Ga0495653_0170872 | 3300046463 | Bacteria | 1500 |
| 304 | Ga0495580_0070292 | 3300046472 | Bacteria | 2445 |
| 305 | Ga0495582_0013683 | 3300046473 | Bacteria | 4466 |
| 306 | Ga0495605_0000177 | 3300046474 | Bacteria | 80399 |
| 307 | Ga0495605_0001739 | 3300046474 | Bacteria | 13947 |
| 308 | Ga0495605_0006538 | 3300046474 | Bacteria | 6690 |
| 309 | Ga0495605_0013984 | 3300046474 | Bacteria | 4405 |
| 310 | Ga0495639_0227324 | 3300046475 | Bacteria | 919 |
| 311 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 312 | Ga0495584_0000366 | 3300046491 | Bacteria | 31199 |
| 313 | Ga0495584_0000452 | 3300046491 | Bacteria | 28285 |
| 314 | Ga0495584_0001551 | 3300046491 | Bacteria | 13650 |
| 315 | Ga0495584_0004007 | 3300046491 | Bacteria | 7947 |
| 316 | Ga0495584_0008288 | 3300046491 | Bacteria | 5383 |
| 317 | Ga0495584_0011200 | 3300046491 | Bacteria | 4594 |
| 318 | Ga0495584_0011673 | 3300046491 | Bacteria | 4496 |
| 319 | Ga0495585_0000600 | 3300046492 | Bacteria | 33658 |
| 320 | Ga0495585_0000697 | 3300046492 | Bacteria | 30508 |
| 321 | Ga0495585_0001480 | 3300046492 | Bacteria | 18341 |
| 322 | Ga0495585_0006526 | 3300046492 | Bacteria | 7222 |
| 323 | Ga0495585_0006714 | 3300046492 | Bacteria | 7100 |
| 324 | Ga0495585_0017738 | 3300046492 | Bacteria | 4110 |
| 325 | Ga0495585_0028730 | 3300046492 | Bacteria | 3169 |
| 326 | Ga0495585_0042463 | 3300046492 | Bacteria | 2546 |
| 327 | Ga0495585_0053236 | 3300046492 | Bacteria | 2240 |
| 328 | Ga0495594_0023866 | 3300046499 | Bacteria | 3280 |
| 329 | Ga0495594_0245791 | 3300046499 | Bacteria | 1019 |
| 330 | Ga0495596_0000615 | 3300046500 | Bacteria | 22390 |
| 331 | Ga0495596_0000821 | 3300046500 | Bacteria | 18784 |
| 332 | Ga0495596_0006977 | 3300046500 | Bacteria | 5136 |
| 333 | Ga0495596_0008987 | 3300046500 | Bacteria | 4416 |
| 334 | Ga0495596_0010760 | 3300046500 | Bacteria | 3971 |
| 335 | Ga0495596_0018122 | 3300046500 | Bacteria | 2905 |
| 336 | Ga0495596_0029061 | 3300046500 | Bacteria | 2218 |
| 337 | Ga0495607_0001696 | 3300046501 | Bacteria | 18957 |
| 338 | Ga0495607_0002247 | 3300046501 | Bacteria | 15945 |
| 339 | Ga0495607_0011028 | 3300046501 | Bacteria | 6036 |
| 340 | Ga0495607_0029059 | 3300046501 | Bacteria | 3405 |
| 341 | Ga0495607_0102545 | 3300046501 | Bacteria | 1530 |
| 342 | Ga0495583_0000506 | 3300046506 | Bacteria | 56069 |
| 343 | Ga0495606_0004705 | 3300046507 | Bacteria | 13467 |
| 344 | Ga0495606_0015233 | 3300046507 | Bacteria | 5937 |
| 345 | Ga0495606_0089815 | 3300046507 | Bacteria | 1892 |
| 346 | Ga0495606_0135404 | 3300046507 | Bacteria | 1460 |
| 347 | Ga0495610_0010358 | 3300046512 | Bacteria | 5802 |
| 348 | Ga0495616_0000386 | 3300046513 | Bacteria | 34362 |
| 349 | Ga0495616_0001634 | 3300046513 | Bacteria | 15368 |
| 350 | Ga0495616_0003927 | 3300046513 | Bacteria | 9467 |
| 351 | Ga0495616_0008600 | 3300046513 | Bacteria | 6028 |
| 352 | Ga0495616_0106653 | 3300046513 | Bacteria | 1306 |
| 353 | Ga0495631_0006918 | 3300046518 | Bacteria | 5813 |
| 354 | Ga0495631_0033138 | 3300046518 | Bacteria | 2322 |
| 355 | Ga0495632_0000156 | 3300046519 | Bacteria | 70702 |
| 356 | Ga0495632_0000537 | 3300046519 | Bacteria | 35765 |
| 357 | Ga0495632_0011507 | 3300046519 | Bacteria | 5158 |
| 358 | Ga0495632_0035337 | 3300046519 | Bacteria | 2550 |
| 359 | Ga0495643_0002305 | 3300046522 | Bacteria | 15401 |
| 360 | Ga0495643_0003688 | 3300046522 | Bacteria | 11102 |
| 361 | Ga0495643_0008036 | 3300046522 | Bacteria | 6727 |
| 362 | Ga0495643_0028675 | 3300046522 | Bacteria | 3118 |
| 363 | Ga0495643_0031913 | 3300046522 | Bacteria | 2928 |
| 364 | Ga0495644_0010708 | 3300046523 | Bacteria | 3533 |
| 365 | Ga0495644_0019643 | 3300046523 | Bacteria | 2580 |
| 366 | Ga0495644_0053416 | 3300046523 | Bacteria | 1517 |
| 367 | Ga0495644_0064157 | 3300046523 | Bacteria | 1380 |
| 368 | Ga0495648_0023546 | 3300046524 | Bacteria | 4215 |
| 369 | Ga0495666_0002495 | 3300046526 | Bacteria | 9133 |
| 370 | Ga0495666_0063882 | 3300046526 | Bacteria | 1757 |
| 371 | Ga0495642_0000053 | 3300046528 | Bacteria | 70172 |
| 372 | Ga0495642_0000433 | 3300046528 | Bacteria | 22082 |
| 373 | Ga0495642_0002723 | 3300046528 | Bacteria | 7097 |
| 374 | Ga0495665_0001008 | 3300046531 | Bacteria | 14939 |
| 375 | Ga0495586_0069245 | 3300046535 | Bacteria | 1925 |
| 376 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 377 | Ga0495609_0008646 | 3300046538 | Bacteria | 4969 |
| 378 | Ga0495609_0020636 | 3300046538 | Bacteria | 3042 |
| 379 | Ga0495609_0026206 | 3300046538 | Bacteria | 2669 |
| 380 | Ga0495597_0000488 | 3300046542 | Bacteria | 33250 |
| 381 | Ga0495597_0002178 | 3300046542 | Bacteria | 12864 |
| 382 | Ga0495597_0002942 | 3300046542 | Bacteria | 10335 |
| 383 | Ga0495622_0113871 | 3300046557 | Bacteria | 1237 |
| 384 | Ga0495633_0002380 | 3300046558 | Bacteria | 13321 |
| 385 | Ga0495633_0027256 | 3300046558 | Bacteria | 2793 |
| 386 | Ga0495633_0051966 | 3300046558 | Bacteria | 1930 |
| 387 | Ga0495656_0017719 | 3300046615 | Bacteria | 2722 |
| 388 | Ga0495656_0030285 | 3300046615 | Bacteria | 2186 |
| 389 | Ga0495656_0105218 | 3300046615 | Bacteria | 1311 |
| 390 | Ga0495668_0002833 | 3300046616 | Bacteria | 13784 |
| 391 | Ga0495668_0006442 | 3300046616 | Bacteria | 7684 |
| 392 | Ga0495668_0006681 | 3300046616 | Bacteria | 7509 |
| 393 | Ga0495668_0024499 | 3300046616 | Bacteria | 3432 |
| 394 | Ga0495668_0050068 | 3300046616 | Bacteria | 2315 |
| 395 | Ga0495668_0089260 | 3300046616 | Bacteria | 1689 |
| 396 | Ga0495668_0218136 | 3300046616 | Bacteria | 1044 |
| 397 | Ga0495611_0000960 | 3300046648 | Bacteria | 15368 |
| 398 | Ga0495611_0005964 | 3300046648 | Bacteria | 5196 |
| 399 | Ga0495611_0061906 | 3300046648 | Bacteria | 1701 |
| 400 | Ga0495611_0213440 | 3300046648 | Bacteria | 898 |
| 401 | Ga0495625_0005815 | 3300046660 | Bacteria | 11129 |
| 402 | Ga0495625_0041053 | 3300046660 | Bacteria | 3369 |
| 403 | Ga0495661_0000069 | 3300046665 | Bacteria | 125790 |
| 404 | Ga0495661_0000082 | 3300046665 | Bacteria | 116600 |
| 405 | Ga0495661_0005217 | 3300046665 | Bacteria | 9246 |
| 406 | Ga0495661_0009005 | 3300046665 | Bacteria | 6868 |
| 407 | Ga0495661_0021506 | 3300046665 | Bacteria | 4205 |
| 408 | Ga0495661_0050020 | 3300046665 | Bacteria | 2532 |
| 409 | Ga0495661_0060506 | 3300046665 | Bacteria | 2249 |
| 410 | Ga0495661_0135992 | 3300046665 | Bacteria | 1341 |
| 411 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 412 | Ga0495588_0111712 | 3300046674 | Bacteria | 1439 |
| 413 | Ga0495669_0013262 | 3300046684 | Bacteria | 3510 |
| 414 | Ga0495669_0025414 | 3300046684 | Bacteria | 2583 |
| 415 | Ga0495669_0090576 | 3300046684 | Bacteria | 1411 |
| 416 | Ga0495670_0002666 | 3300046691 | Bacteria | 8807 |
| 417 | Ga0495670_0060581 | 3300046691 | Bacteria | 1902 |
| 418 | Ga0495671_0008192 | 3300046692 | Bacteria | 5895 |
| 419 | Ga0495649_0000537 | 3300046694 | Bacteria | 32173 |
| 420 | Ga0495649_0001788 | 3300046694 | Bacteria | 15827 |
| 421 | Ga0495649_0020176 | 3300046694 | Bacteria | 3739 |
| 422 | Ga0495589_0000061 | 3300046794 | Bacteria | 104649 |
| 423 | Ga0495589_0000072 | 3300046794 | Bacteria | 95649 |
| 424 | Ga0495589_0014127 | 3300046794 | Bacteria | 4116 |
| 425 | Ga0495589_0030024 | 3300046794 | Bacteria | 2739 |
| 426 | Ga0495589_0046286 | 3300046794 | Bacteria | 2159 |
| 427 | Ga0495660_0000243 | 3300046810 | Bacteria | 53378 |
| 428 | Ga0495660_0008501 | 3300046810 | Bacteria | 6010 |
| 429 | Ga0495660_0018048 | 3300046810 | Bacteria | 4057 |
| 430 | Ga0495660_0074213 | 3300046810 | Bacteria | 1797 |
| 431 | Ga0495604_0031391 | 3300047317 | Bacteria | 4213 |
| 432 | Ga0495604_0154424 | 3300047317 | Bacteria | 1627 |
| 433 | Ga0495636_0000011 | 3300047318 | Bacteria | 87862 |
| 434 | Ga0495636_0003018 | 3300047318 | Bacteria | 6522 |
| 435 | Ga0495672_0000258 | 3300047320 | Bacteria | 73971 |
| 436 | Ga0495672_0010604 | 3300047320 | Bacteria | 6549 |
| 437 | Ga0495672_0020962 | 3300047320 | Bacteria | 4270 |
| 438 | Ga0495676_0039316 | 3300047321 | Bacteria | 3919 |
| 439 | Ga0495680_0003891 | 3300047322 | Bacteria | 14448 |
| 440 | Ga0495683_0000009 | 3300047323 | Bacteria | 241385 |
| 441 | Ga0495683_0000446 | 3300047323 | Bacteria | 32629 |
| 442 | Ga0495683_0015742 | 3300047323 | Bacteria | 3927 |
| 443 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 444 | Ga0495687_000630 | 3300047443 | Bacteria | 40345 |
| 445 | Ga0495687_001824 | 3300047443 | Bacteria | 18729 |
| 446 | Ga0495687_002017 | 3300047443 | Bacteria | 17187 |
| 447 | Ga0495675_0030627 | 3300047444 | Bacteria | 3432 |
| 448 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 449 | Ga0495677_0000195 | 3300047445 | Bacteria | 27965 |
| 450 | Ga0495677_0001118 | 3300047445 | Bacteria | 10729 |
| 451 | Ga0495677_0001701 | 3300047445 | Bacteria | 8838 |
| 452 | Ga0495677_0006543 | 3300047445 | Bacteria | 4401 |
| 453 | Ga0495679_001482 | 3300047446 | Bacteria | 13271 |
| 454 | Ga0495679_016971 | 3300047446 | Bacteria | 2617 |
| 455 | Ga0495685_036381 | 3300047447 | Bacteria | 1690 |
| 456 | Ga0495681_0000428 | 3300047470 | Bacteria | 32244 |
| 457 | Ga0495681_0015193 | 3300047470 | Bacteria | 4366 |
| 458 | Ga0495681_0024964 | 3300047470 | Bacteria | 3134 |
| 459 | Ga0495686_0000146 | 3300047472 | Bacteria | 141435 |
| 460 | Ga0495686_0000373 | 3300047472 | Bacteria | 71977 |
| 461 | Ga0495686_0001101 | 3300047472 | Bacteria | 32108 |
| 462 | Ga0495686_0006503 | 3300047472 | Bacteria | 8925 |
| 463 | Ga0495686_0047236 | 3300047472 | Bacteria | 2719 |
| 464 | Ga0495593_0213731 | 3300047673 | Bacteria | 968 |
| 465 | Ga0495614_0010053 | 3300048089 | Bacteria | 4177 |
| 466 | Ga0495626_0000027 | 3300048091 | Bacteria | 206022 |
| 467 | Ga0495626_0000135 | 3300048091 | Bacteria | 93280 |
| 468 | Ga0495626_0000193 | 3300048091 | Bacteria | 73924 |
| 469 | Ga0495626_0039499 | 3300048091 | Bacteria | 2233 |
| 470 | Ga0495626_0067380 | 3300048091 | Bacteria | 1616 |
| 471 | Ga0496101_0066030 | 3300048904 | Bacteria | 2638 |
| 472 | Ga0496102_0000058 | 3300048905 | Bacteria | 168714 |
| 473 | Ga0496104_0443251 | 3300048907 | Bacteria | 1210 |
| 474 | Ga0496106_0297027 | 3300048909 | Bacteria | 1295 |
| 475 | Ga0496107_0170968 | 3300048910 | Bacteria | 1613 |
| 476 | Ga0496108_0955706 | 3300048911 | Bacteria | 733 |
| 477 | Ga0496109_0347154 | 3300048912 | Bacteria | 1402 |
| 478 | Ga0496110_0000251 | 3300048913 | Bacteria | 34859 |
| 479 | Ga0496110_0009047 | 3300048913 | Bacteria | 8037 |
| 480 | Ga0496110_0021952 | 3300048913 | Bacteria | 5414 |
| 481 | Ga0496112_0240363 | 3300048915 | Bacteria | 1764 |
| 482 | Ga0496113_0002669 | 3300048916 | Bacteria | 10454 |
| 483 | Ga0496113_0405827 | 3300048916 | Bacteria | 1094 |
| 484 | Ga0496115_0112393 | 3300048918 | Bacteria | 2238 |
| 485 | Ga0496116_0003966 | 3300048919 | Bacteria | 14370 |
| 486 | Ga0496121_0161506 | 3300048924 | Bacteria | 1638 |
| 487 | Ga0496122_0000255 | 3300048925 | Bacteria | 120384 |
| 488 | Ga0496122_0002056 | 3300048925 | Bacteria | 29860 |
| 489 | Ga0496122_0007048 | 3300048925 | Bacteria | 12637 |
| 490 | Ga0496122_0022678 | 3300048925 | Bacteria | 5572 |
| 491 | Ga0496123_0000138 | 3300048926 | Bacteria | 151844 |
| 492 | Ga0496123_0001705 | 3300048926 | Bacteria | 29367 |
| 493 | Ga0496123_0004467 | 3300048926 | Bacteria | 14671 |
| 494 | Ga0496124_0013112 | 3300048927 | Bacteria | 8115 |
| 495 | Ga0496124_0180220 | 3300048927 | Bacteria | 1626 |
| 496 | Ga0496125_0002290 | 3300048928 | Bacteria | 25316 |
| 497 | Ga0496125_0002620 | 3300048928 | Bacteria | 23073 |
| 498 | Ga0501308_001455 | 3300049128 | Bacteria | 1897 |
| 499 | Ga0495678_000110 | 3300049459 | Bacteria | 97228 |
| 500 | Ga0495678_022198 | 3300049459 | Bacteria | 2779 |
| 501 | Ga0495682_0007385 | 3300049460 | Bacteria | 4379 |
| 502 | Ga0495682_0020557 | 3300049460 | Bacteria | 2477 |
| 503 | Ga0501298_004446 | 3300049521 | Bacteria | 2210 |
| 504 | Ga0501034_0023415 | 3300049571 | Bacteria | 6293 |
| 505 | Ga0501034_0170353 | 3300049571 | Bacteria | 2145 |
| 506 | Ga0501034_0212020 | 3300049571 | Bacteria | 1892 |
| 507 | Ga0501038_0149218 | 3300049574 | Bacteria | 1907 |
| 508 | Ga0501039_0456830 | 3300049575 | Bacteria | 1003 |
| 509 | Ga0501043_0113283 | 3300049579 | Bacteria | 2130 |
| 510 | Ga0501067_0026472 | 3300049583 | Bacteria | 3212 |
| 511 | Ga0501069_0048089 | 3300049585 | Bacteria | 2368 |
| 512 | Ga0501070_0376927 | 3300049586 | Bacteria | 1149 |
| 513 | Ga0501072_0181283 | 3300049588 | Bacteria | 1680 |
| 514 | Ga0501073_0162407 | 3300049589 | Bacteria | 1547 |
| 515 | Ga0501201_000140 | 3300049651 | Bacteria | 6066 |
| 516 | Ga0501207_011209 | 3300049654 | Bacteria | 1332 |
| 517 | Ga0501217_017854 | 3300049661 | Bacteria | 1640 |
| 518 | Ga0501222_004316 | 3300049662 | Bacteria | 1930 |
| 519 | Ga0501223_001744 | 3300049663 | Bacteria | 4945 |
| 520 | Ga0501233_014174 | 3300049668 | Bacteria | 1626 |
| 521 | Ga0501235_001675 | 3300049669 | Bacteria | 4752 |
| 522 | Ga0501242_002559 | 3300049674 | Bacteria | 1918 |
| 523 | Ga0501243_001273 | 3300049675 | Bacteria | 3595 |
| 524 | Ga0501251_017977 | 3300049681 | Bacteria | 913 |
| 525 | Ga0501257_003118 | 3300049686 | Bacteria | 3530 |
| 526 | Ga0501257_004374 | 3300049686 | Bacteria | 3083 |
| 527 | Ga0501259_004374 | 3300049688 | Bacteria | 2250 |
| 528 | Ga0501234_011897 | 3300049707 | Bacteria | 1362 |
| 529 | Ga0501245_004933 | 3300049708 | Bacteria | 1842 |
| 530 | Ga0501080_0223463 | 3300049742 | Bacteria | 1722 |
| 531 | Ga0501083_0015230 | 3300049744 | Bacteria | 5383 |
| 532 | Ga0501232_001451 | 3300049757 | Bacteria | 1895 |
| 533 | Ga0501266_001738 | 3300049763 | Bacteria | 2759 |
| 534 | Ga0501035_0003078 | 3300049822 | Bacteria | 16010 |
| 535 | Ga0501035_0159292 | 3300049822 | Bacteria | 1955 |
| 536 | Ga0501035_0521741 | 3300049822 | Bacteria | 976 |
| 537 | nmdc:mga0k408_92153_c1 | 3300050493 | Bacteria | 1781 |
| 538 | Ga0500644_0063132 | 3300053088 | Bacteria | 1311 |
| 539 | Ga0500641_0025562 | 3300053096 | Bacteria | 2285 |
| 540 | Ga0500562_000077 | 3300053108 | Bacteria | 45189 |
| 541 | Ga0500568_0006155 | 3300053139 | Bacteria | 6069 |
| 542 | Ga0500622_0003322 | 3300053156 | Bacteria | 10864 |
| 543 | Ga0500645_022740 | 3300053730 | Bacteria | 1925 |
| 544 | Ga0501084_0029727 | 3300054114 | Bacteria | 4571 |
| 545 | Ga0587077_025297 | 3300059493 | Bacteria | 1088 |
| 546 | Ga0587083_0020468 | 3300059505 | Bacteria | 1219 |
| 547 | Ga0587068_008424 | 3300059641 | Bacteria | 1494 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0955706 | Ga0496108_0955706_36_716 | 220 |
| 2 | 3300053730 | Ga0500645_022740 | Ga0500645_022740_1174_1887 | 231 |
| 3 | 3300003320 | rootH2_10013019 | rootH2_100130198 | 255 |
| 4 | 3300046463 | Ga0495653_0170872 | Ga0495653_0170872_327_1100 | 257 |
| 5 | 3300046513 | Ga0495616_0000386 | Ga0495616_0000386_499_1272 | 257 |
| 6 | 3300046665 | Ga0495661_0000082 | Ga0495661_0000082_114822_115595 | 257 |
| 7 | 3300046684 | Ga0495669_0090576 | Ga0495669_0090576_449_1222 | 257 |
| 8 | 3300046810 | Ga0495660_0018048 | Ga0495660_0018048_2077_2850 | 257 |
| 9 | 3300047317 | Ga0495604_0031391 | Ga0495604_0031391_2335_3108 | 257 |
| 10 | 3300047322 | Ga0495680_0003891 | Ga0495680_0003891_1794_2567 | 257 |
| 11 | 3300047447 | Ga0495685_036381 | Ga0495685_036381_36_809 | 257 |
| 12 | 3300048089 | Ga0495614_0010053 | Ga0495614_0010053_2880_3653 | 257 |
| 13 | 3300048916 | Ga0496113_0002669 | Ga0496113_0002669_8646_9419 | 257 |
| 14 | 3300048925 | Ga0496122_0000255 | Ga0496122_0000255_117862_118635 | 257 |
| 15 | 3300048926 | Ga0496123_0000138 | Ga0496123_0000138_31984_32757 | 257 |
| 16 | 3300048928 | Ga0496125_0002620 | Ga0496125_0002620_21429_22202 | 257 |
| 17 | 3300049822 | Ga0501035_0003078 | Ga0501035_0003078_13392_14165 | 257 |
| 18 | iso_pu_bacteria | 2548876994 | 2550693359 | 260 |
| 19 | iso_pu_bacteria | 2643221556 | 2643798997 | 260 |
| 20 | iso_pu_bacteria | 2643221684 | 2644473672 | 260 |
| 21 | iso_pu_bacteria | 2818991444 | 2819590723 | 260 |
| 22 | iso_pu_bacteria | 2818991445 | 2819594937 | 260 |
| 23 | iso_pu_bacteria | 2884811622 | 2884812324 | 260 |
| 24 | iso_pu_bacteria | 2884836552 | 2884836688 | 260 |
| 25 | iso_pu_bacteria | 2884852848 | 2884852980 | 260 |
| 26 | iso_pu_bacteria | 2896154374 | 2896155903 | 260 |
| 27 | iso_pu_bacteria | 2929154850 | 2929157742 | 260 |
| 28 | iso_pu_bacteria | 3006973921 | 3006975565 | 260 |
| 29 | iso_pu_bacteria | 8047673197 | 8047679403 | 260 |
| 30 | 3300003203 | JGI25406J46586_10012099 | JGI25406J46586_100120992 | 262 |
| 31 | 3300005985 | Ga0081539_10000531 | Ga0081539_100005313 | 262 |
| 32 | 3300031616 | Ga0307508_10001325 | Ga0307508_1000132518 | 262 |
| 33 | 2162886007 | SwRhRL2b_contig_3160980 | SwRhRL2b_0077.00006020 | 264 |
| 34 | 3300001979 | JGI24740J21852_10019370 | JGI24740J21852_100193704 | 264 |
| 35 | 3300002705 | JGI25156J39149_1001190 | JGI25156J39149_10011909 | 264 |
| 36 | 3300002737 | JGI25162J39368_1004954 | JGI25162J39368_10049542 | 264 |
| 37 | 3300002738 | JGI25154J39366_1000986 | JGI25154J39366_10009861 | 264 |
| 38 | 3300002741 | JGI25157J39369_1001849 | JGI25157J39369_10018495 | 264 |
| 39 | 3300003322 | rootL2_10241602 | rootL2_102416021 | 264 |
| 40 | 3300003354 | JGI25160J50197_1000425 | JGI25160J50197_10004259 | 264 |
| 41 | 3300003758 | Ga0055532_1000077 | Ga0055532_10000771 | 264 |
| 42 | 3300003759 | Ga0055525_1000008 | Ga0055525_100000831 | 264 |
| 43 | 3300003762 | Ga0055542_1012403 | Ga0055542_10124032 | 264 |
| 44 | 3300005289 | Ga0065704_10072654 | Ga0065704_100726544 | 264 |
| 45 | 3300005327 | Ga0070658_10025472 | Ga0070658_100254722 | 264 |
| 46 | 3300005327 | Ga0070658_10028978 | Ga0070658_100289783 | 264 |
| 47 | 3300005327 | Ga0070658_10196661 | Ga0070658_101966612 | 264 |
| 48 | 3300005328 | Ga0070676_10120820 | Ga0070676_101208202 | 264 |
| 49 | 3300005329 | Ga0070683_100007781 | Ga0070683_1000077818 | 264 |
| 50 | 3300005329 | Ga0070683_100522899 | Ga0070683_1005228991 | 264 |
| 51 | 3300005331 | Ga0070670_100050548 | Ga0070670_1000505483 | 264 |
| 52 | 3300005331 | Ga0070670_100210256 | Ga0070670_1002102563 | 264 |
| 53 | 3300005334 | Ga0068869_100010056 | Ga0068869_1000100567 | 264 |
| 54 | 3300005334 | Ga0068869_100017750 | Ga0068869_1000177503 | 264 |
| 55 | 3300005335 | Ga0070666_10000736 | Ga0070666_1000073617 | 264 |
| 56 | 3300005335 | Ga0070666_10089513 | Ga0070666_100895133 | 264 |
| 57 | 3300005336 | Ga0070680_100000088 | Ga0070680_10000008853 | 264 |
| 58 | 3300005336 | Ga0070680_100038613 | Ga0070680_1000386135 | 264 |
| 59 | 3300005338 | Ga0068868_100025378 | Ga0068868_1000253782 | 264 |
| 60 | 3300005338 | Ga0068868_100045260 | Ga0068868_1000452603 | 264 |
| 61 | 3300005338 | Ga0068868_100224499 | Ga0068868_1002244992 | 264 |
| 62 | 3300005339 | Ga0070660_100042601 | Ga0070660_1000426014 | 264 |
| 63 | 3300005339 | Ga0070660_100058718 | Ga0070660_1000587182 | 264 |
| 64 | 3300005339 | Ga0070660_100080999 | Ga0070660_1000809993 | 264 |
| 65 | 3300005339 | Ga0070660_100105690 | Ga0070660_1001056903 | 264 |
| 66 | 3300005339 | Ga0070660_100132997 | Ga0070660_1001329971 | 264 |
| 67 | 3300005339 | Ga0070660_100260270 | Ga0070660_1002602701 | 264 |
| 68 | 3300005340 | Ga0070689_100026131 | Ga0070689_1000261313 | 264 |
| 69 | 3300005344 | Ga0070661_100017437 | Ga0070661_1000174375 | 264 |
| 70 | 3300005347 | Ga0070668_100036467 | Ga0070668_1000364674 | 264 |
| 71 | 3300005347 | Ga0070668_100189194 | Ga0070668_1001891942 | 264 |
| 72 | 3300005353 | Ga0070669_100147955 | Ga0070669_1001479553 | 264 |
| 73 | 3300005354 | Ga0070675_100038520 | Ga0070675_1000385201 | 264 |
| 74 | 3300005355 | Ga0070671_100014761 | Ga0070671_1000147614 | 264 |
| 75 | 3300005355 | Ga0070671_100110999 | Ga0070671_1001109992 | 264 |
| 76 | 3300005356 | Ga0070674_100121079 | Ga0070674_1001210792 | 264 |
| 77 | 3300005364 | Ga0070673_100023997 | Ga0070673_1000239974 | 264 |
| 78 | 3300005364 | Ga0070673_100536616 | Ga0070673_1005366161 | 264 |
| 79 | 3300005365 | Ga0070688_100008462 | Ga0070688_1000084622 | 264 |
| 80 | 3300005366 | Ga0070659_100010190 | Ga0070659_1000101903 | 264 |
| 81 | 3300005366 | Ga0070659_100043243 | Ga0070659_1000432434 | 264 |
| 82 | 3300005366 | Ga0070659_100078813 | Ga0070659_1000788133 | 264 |
| 83 | 3300005366 | Ga0070659_100082890 | Ga0070659_1000828902 | 264 |
| 84 | 3300005455 | Ga0070663_100375911 | Ga0070663_1003759111 | 264 |
| 85 | 3300005456 | Ga0070678_100013458 | Ga0070678_1000134584 | 264 |
| 86 | 3300005456 | Ga0070678_100131890 | Ga0070678_1001318902 | 264 |
| 87 | 3300005457 | Ga0070662_100151157 | Ga0070662_1001511572 | 264 |
| 88 | 3300005459 | Ga0068867_100008426 | Ga0068867_1000084263 | 264 |
| 89 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003220 | 264 |
| 90 | 3300005530 | Ga0070679_100075145 | Ga0070679_1000751453 | 264 |
| 91 | 3300005530 | Ga0070679_100347760 | Ga0070679_1003477601 | 264 |
| 92 | 3300005543 | Ga0070672_100027937 | Ga0070672_1000279375 | 264 |
| 93 | 3300005548 | Ga0070665_100043589 | Ga0070665_1000435894 | 264 |
| 94 | 3300005563 | Ga0068855_100045035 | Ga0068855_1000450351 | 264 |
| 95 | 3300005563 | Ga0068855_100079309 | Ga0068855_1000793092 | 264 |
| 96 | 3300005563 | Ga0068855_100737942 | Ga0068855_1007379421 | 264 |
| 97 | 3300005564 | Ga0070664_100024674 | Ga0070664_1000246746 | 264 |
| 98 | 3300005564 | Ga0070664_100048325 | Ga0070664_1000483252 | 264 |
| 99 | 3300005564 | Ga0070664_100094830 | Ga0070664_1000948302 | 264 |
| 100 | 3300005564 | Ga0070664_100273688 | Ga0070664_1002736882 | 264 |
| 101 | 3300005577 | Ga0068857_100046969 | Ga0068857_1000469694 | 264 |
| 102 | 3300005577 | Ga0068857_100075562 | Ga0068857_1000755623 | 264 |
| 103 | 3300005578 | Ga0068854_100094454 | Ga0068854_1000944542 | 264 |
| 104 | 3300005617 | Ga0068859_100000037 | Ga0068859_100000037102 | 264 |
| 105 | 3300005617 | Ga0068859_100005033 | Ga0068859_1000050332 | 264 |
| 106 | 3300005617 | Ga0068859_100154534 | Ga0068859_1001545342 | 264 |
| 107 | 3300005617 | Ga0068859_100167475 | Ga0068859_1001674753 | 264 |
| 108 | 3300005617 | Ga0068859_100338016 | Ga0068859_1003380163 | 264 |
| 109 | 3300005618 | Ga0068864_100009579 | Ga0068864_1000095792 | 264 |
| 110 | 3300005618 | Ga0068864_100053693 | Ga0068864_1000536932 | 264 |
| 111 | 3300005618 | Ga0068864_100055678 | Ga0068864_1000556783 | 264 |
| 112 | 3300005618 | Ga0068864_100303277 | Ga0068864_1003032772 | 264 |
| 113 | 3300005718 | Ga0068866_10024844 | Ga0068866_100248443 | 264 |
| 114 | 3300005719 | Ga0068861_100044059 | Ga0068861_1000440594 | 264 |
| 115 | 3300005834 | Ga0068851_10008075 | Ga0068851_100080754 | 264 |
| 116 | 3300005834 | Ga0068851_10010366 | Ga0068851_100103664 | 264 |
| 117 | 3300005834 | Ga0068851_10117872 | Ga0068851_101178723 | 264 |
| 118 | 3300005840 | Ga0068870_10012327 | Ga0068870_100123273 | 264 |
| 119 | 3300005841 | Ga0068863_100032377 | Ga0068863_1000323775 | 264 |
| 120 | 3300005842 | Ga0068858_100002312 | Ga0068858_1000023127 | 264 |
| 121 | 3300005842 | Ga0068858_100841454 | Ga0068858_1008414541 | 264 |
| 122 | 3300005843 | Ga0068860_100003825 | Ga0068860_1000038259 | 264 |
| 123 | 3300005843 | Ga0068860_100026415 | Ga0068860_1000264153 | 264 |
| 124 | 3300005843 | Ga0068860_100030783 | Ga0068860_1000307836 | 264 |
| 125 | 3300006195 | Ga0075366_10107926 | Ga0075366_101079262 | 264 |
| 126 | 3300006237 | Ga0097621_100032447 | Ga0097621_1000324473 | 264 |
| 127 | 3300006237 | Ga0097621_100068063 | Ga0097621_1000680634 | 264 |
| 128 | 3300006358 | Ga0068871_100083751 | Ga0068871_1000837513 | 264 |
| 129 | 3300006931 | Ga0097620_100000037 | Ga0097620_100000037102 | 264 |
| 130 | 3300006931 | Ga0097620_100005033 | Ga0097620_1000050332 | 264 |
| 131 | 3300006931 | Ga0097620_100154525 | Ga0097620_1001545252 | 264 |
| 132 | 3300006931 | Ga0097620_100167474 | Ga0097620_1001674742 | 264 |
| 133 | 3300006931 | Ga0097620_100338022 | Ga0097620_1003380223 | 264 |
| 134 | 3300009093 | Ga0105240_10051294 | Ga0105240_100512941 | 264 |
| 135 | 3300009098 | Ga0105245_10057483 | Ga0105245_100574833 | 264 |
| 136 | 3300009098 | Ga0105245_10181275 | Ga0105245_101812752 | 264 |
| 137 | 3300009098 | Ga0105245_10386836 | Ga0105245_103868361 | 264 |
| 138 | 3300009101 | Ga0105247_10045640 | Ga0105247_100456401 | 264 |
| 139 | 3300009174 | Ga0105241_10001242 | Ga0105241_1000124214 | 264 |
| 140 | 3300009174 | Ga0105241_10063295 | Ga0105241_100632954 | 264 |
| 141 | 3300009174 | Ga0105241_10119939 | Ga0105241_101199392 | 264 |
| 142 | 3300009176 | Ga0105242_10031141 | Ga0105242_100311414 | 264 |
| 143 | 3300009176 | Ga0105242_10119104 | Ga0105242_101191042 | 264 |
| 144 | 3300009545 | Ga0105237_10011912 | Ga0105237_100119127 | 264 |
| 145 | 3300009545 | Ga0105237_10019373 | Ga0105237_100193734 | 264 |
| 146 | 3300009551 | Ga0105238_10054006 | Ga0105238_100540063 | 264 |
| 147 | 3300010375 | Ga0105239_10050855 | Ga0105239_100508551 | 264 |
| 148 | 3300011119 | Ga0105246_10059113 | Ga0105246_100591133 | 264 |
| 149 | 3300013100 | Ga0157373_10049310 | Ga0157373_100493101 | 264 |
| 150 | 3300013102 | Ga0157371_10003328 | Ga0157371_100033286 | 264 |
| 151 | 3300013104 | Ga0157370_10058627 | Ga0157370_100586272 | 264 |
| 152 | 3300013104 | Ga0157370_10163019 | Ga0157370_101630191 | 264 |
| 153 | 3300013104 | Ga0157370_10486663 | Ga0157370_104866632 | 264 |
| 154 | 3300013105 | Ga0157369_10040311 | Ga0157369_100403116 | 264 |
| 155 | 3300013105 | Ga0157369_10109403 | Ga0157369_101094033 | 264 |
| 156 | 3300013296 | Ga0157374_10000500 | Ga0157374_1000050036 | 264 |
| 157 | 3300013296 | Ga0157374_10065573 | Ga0157374_100655734 | 264 |
| 158 | 3300013296 | Ga0157374_10148425 | Ga0157374_101484253 | 264 |
| 159 | 3300013296 | Ga0157374_10583976 | Ga0157374_105839761 | 264 |
| 160 | 3300013297 | Ga0157378_10036726 | Ga0157378_100367264 | 264 |
| 161 | 3300013297 | Ga0157378_10057003 | Ga0157378_100570031 | 264 |
| 162 | 3300013297 | Ga0157378_10057524 | Ga0157378_100575244 | 264 |
| 163 | 3300013297 | Ga0157378_10059615 | Ga0157378_100596154 | 264 |
| 164 | 3300013297 | Ga0157378_10123678 | Ga0157378_101236783 | 264 |
| 165 | 3300013297 | Ga0157378_10140088 | Ga0157378_101400882 | 264 |
| 166 | 3300013306 | Ga0163162_10004768 | Ga0163162_100047685 | 264 |
| 167 | 3300013306 | Ga0163162_10319034 | Ga0163162_103190342 | 264 |
| 168 | 3300013307 | Ga0157372_10089689 | Ga0157372_100896894 | 264 |
| 169 | 3300013307 | Ga0157372_10201163 | Ga0157372_102011632 | 264 |
| 170 | 3300013307 | Ga0157372_10352456 | Ga0157372_103524561 | 264 |
| 171 | 3300013307 | Ga0157372_10390004 | Ga0157372_103900042 | 264 |
| 172 | 3300013307 | Ga0157372_10432922 | Ga0157372_104329221 | 264 |
| 173 | 3300013308 | Ga0157375_10091600 | Ga0157375_100916002 | 264 |
| 174 | 3300013308 | Ga0157375_10149311 | Ga0157375_101493113 | 264 |
| 175 | 3300013308 | Ga0157375_10455800 | Ga0157375_104558002 | 264 |
| 176 | 3300014325 | Ga0163163_10001732 | Ga0163163_1000173222 | 264 |
| 177 | 3300014325 | Ga0163163_10018090 | Ga0163163_100180905 | 264 |
| 178 | 3300014326 | Ga0157380_10022365 | Ga0157380_100223655 | 264 |
| 179 | 3300014497 | Ga0182008_10071418 | Ga0182008_100714182 | 264 |
| 180 | 3300014745 | Ga0157377_10013348 | Ga0157377_100133481 | 264 |
| 181 | 3300014968 | Ga0157379_10058571 | Ga0157379_100585714 | 264 |
| 182 | 3300014969 | Ga0157376_10032889 | Ga0157376_100328893 | 264 |
| 183 | 3300025206 | Ga0209435_100082 | Ga0209435_10008215 | 264 |
| 184 | 3300025229 | Ga0209147_100122 | Ga0209147_100122120 | 264 |
| 185 | 3300025230 | Ga0209563_100003 | Ga0209563_1000031116 | 264 |
| 186 | 3300025233 | Ga0209437_100081 | Ga0209437_10008179 | 264 |
| 187 | 3300025242 | Ga0209258_100739 | Ga0209258_10073916 | 264 |
| 188 | 3300025246 | Ga0209646_1000152 | Ga0209646_100015215 | 264 |
| 189 | 3300025250 | Ga0209026_1000126 | Ga0209026_1000126120 | 264 |
| 190 | 3300025253 | Ga0209677_102681 | Ga0209677_1026814 | 264 |
| 191 | 3300025254 | Ga0209148_1000576 | Ga0209148_100057622 | 264 |
| 192 | 3300025256 | Ga0209759_1000193 | Ga0209759_100019315 | 264 |
| 193 | 3300025302 | Ga0207426_1000032 | Ga0207426_100003246 | 264 |
| 194 | 3300025321 | Ga0207656_10007990 | Ga0207656_100079904 | 264 |
| 195 | 3300025321 | Ga0207656_10139487 | Ga0207656_101394871 | 264 |
| 196 | 3300025893 | Ga0207682_10029991 | Ga0207682_100299912 | 264 |
| 197 | 3300025893 | Ga0207682_10039977 | Ga0207682_100399772 | 264 |
| 198 | 3300025899 | Ga0207642_10012030 | Ga0207642_100120303 | 264 |
| 199 | 3300025900 | Ga0207710_10166457 | Ga0207710_101664572 | 264 |
| 200 | 3300025901 | Ga0207688_10050439 | Ga0207688_100504393 | 264 |
| 201 | 3300025903 | Ga0207680_10002758 | Ga0207680_100027586 | 264 |
| 202 | 3300025903 | Ga0207680_10024859 | Ga0207680_100248593 | 264 |
| 203 | 3300025907 | Ga0207645_10008175 | Ga0207645_100081754 | 264 |
| 204 | 3300025907 | Ga0207645_10113229 | Ga0207645_101132292 | 264 |
| 205 | 3300025908 | Ga0207643_10061389 | Ga0207643_100613893 | 264 |
| 206 | 3300025909 | Ga0207705_10094360 | Ga0207705_100943603 | 264 |
| 207 | 3300025911 | Ga0207654_10001781 | Ga0207654_100017813 | 264 |
| 208 | 3300025911 | Ga0207654_10009833 | Ga0207654_100098332 | 264 |
| 209 | 3300025911 | Ga0207654_10364325 | Ga0207654_103643251 | 264 |
| 210 | 3300025914 | Ga0207671_10001737 | Ga0207671_100017378 | 264 |
| 211 | 3300025917 | Ga0207660_10000231 | Ga0207660_1000023120 | 264 |
| 212 | 3300025917 | Ga0207660_10144387 | Ga0207660_101443871 | 264 |
| 213 | 3300025917 | Ga0207660_10388337 | Ga0207660_103883372 | 264 |
| 214 | 3300025919 | Ga0207657_10005484 | Ga0207657_1000548410 | 264 |
| 215 | 3300025919 | Ga0207657_10071592 | Ga0207657_100715924 | 264 |
| 216 | 3300025919 | Ga0207657_10085037 | Ga0207657_100850374 | 264 |
| 217 | 3300025919 | Ga0207657_10115329 | Ga0207657_101153293 | 264 |
| 218 | 3300025919 | Ga0207657_10539017 | Ga0207657_105390171 | 264 |
| 219 | 3300025920 | Ga0207649_10010790 | Ga0207649_100107905 | 264 |
| 220 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004221 | 264 |
| 221 | 3300025921 | Ga0207652_10000101 | Ga0207652_1000010144 | 264 |
| 222 | 3300025921 | Ga0207652_10160509 | Ga0207652_101605091 | 264 |
| 223 | 3300025924 | Ga0207694_10126826 | Ga0207694_101268262 | 264 |
| 224 | 3300025926 | Ga0207659_10029066 | Ga0207659_100290661 | 264 |
| 225 | 3300025926 | Ga0207659_10077383 | Ga0207659_100773833 | 264 |
| 226 | 3300025927 | Ga0207687_10047815 | Ga0207687_100478152 | 264 |
| 227 | 3300025931 | Ga0207644_10123410 | Ga0207644_101234103 | 264 |
| 228 | 3300025932 | Ga0207690_10008026 | Ga0207690_100080264 | 264 |
| 229 | 3300025932 | Ga0207690_10025312 | Ga0207690_100253122 | 264 |
| 230 | 3300025932 | Ga0207690_10085253 | Ga0207690_100852532 | 264 |
| 231 | 3300025932 | Ga0207690_10385863 | Ga0207690_103858632 | 264 |
| 232 | 3300025934 | Ga0207686_10083724 | Ga0207686_100837243 | 264 |
| 233 | 3300025936 | Ga0207670_10045864 | Ga0207670_100458641 | 264 |
| 234 | 3300025937 | Ga0207669_10056730 | Ga0207669_100567302 | 264 |
| 235 | 3300025938 | Ga0207704_10062769 | Ga0207704_100627693 | 264 |
| 236 | 3300025940 | Ga0207691_10033299 | Ga0207691_100332995 | 264 |
| 237 | 3300025940 | Ga0207691_10050300 | Ga0207691_100503002 | 264 |
| 238 | 3300025940 | Ga0207691_10075103 | Ga0207691_100751034 | 264 |
| 239 | 3300025940 | Ga0207691_10092613 | Ga0207691_100926133 | 264 |
| 240 | 3300025942 | Ga0207689_10002113 | Ga0207689_100021138 | 264 |
| 241 | 3300025942 | Ga0207689_10004902 | Ga0207689_100049028 | 264 |
| 242 | 3300025942 | Ga0207689_10016695 | Ga0207689_100166954 | 264 |
| 243 | 3300025942 | Ga0207689_10146936 | Ga0207689_101469362 | 264 |
| 244 | 3300025944 | Ga0207661_10210677 | Ga0207661_102106772 | 264 |
| 245 | 3300025945 | Ga0207679_10012499 | Ga0207679_100124997 | 264 |
| 246 | 3300025949 | Ga0207667_10050356 | Ga0207667_100503563 | 264 |
| 247 | 3300025960 | Ga0207651_10030376 | Ga0207651_100303762 | 264 |
| 248 | 3300025960 | Ga0207651_10112157 | Ga0207651_101121573 | 264 |
| 249 | 3300025961 | Ga0207712_10040602 | Ga0207712_100406024 | 264 |
| 250 | 3300025972 | Ga0207668_10130196 | Ga0207668_101301963 | 264 |
| 251 | 3300026023 | Ga0207677_10038689 | Ga0207677_100386893 | 264 |
| 252 | 3300026023 | Ga0207677_10048022 | Ga0207677_100480222 | 264 |
| 253 | 3300026023 | Ga0207677_10053515 | Ga0207677_100535153 | 264 |
| 254 | 3300026023 | Ga0207677_10233828 | Ga0207677_102338283 | 264 |
| 255 | 3300026035 | Ga0207703_10000878 | Ga0207703_1000087815 | 264 |
| 256 | 3300026067 | Ga0207678_10319081 | Ga0207678_103190811 | 264 |
| 257 | 3300026088 | Ga0207641_10000121 | Ga0207641_1000012153 | 264 |
| 258 | 3300026089 | Ga0207648_10007071 | Ga0207648_100070714 | 264 |
| 259 | 3300026089 | Ga0207648_10008275 | Ga0207648_100082757 | 264 |
| 260 | 3300026095 | Ga0207676_10027669 | Ga0207676_100276693 | 264 |
| 261 | 3300026095 | Ga0207676_10179411 | Ga0207676_101794112 | 264 |
| 262 | 3300026116 | Ga0207674_10010770 | Ga0207674_100107707 | 264 |
| 263 | 3300026116 | Ga0207674_10061307 | Ga0207674_100613079 | 264 |
| 264 | 3300026118 | Ga0207675_100072985 | Ga0207675_1000729854 | 264 |
| 265 | 3300026118 | Ga0207675_100134258 | Ga0207675_1001342582 | 264 |
| 266 | 3300026118 | Ga0207675_100182952 | Ga0207675_1001829522 | 264 |
| 267 | 3300026118 | Ga0207675_100632143 | Ga0207675_1006321431 | 264 |
| 268 | 3300026121 | Ga0207683_10003508 | Ga0207683_100035088 | 264 |
| 269 | 3300026121 | Ga0207683_10010782 | Ga0207683_100107823 | 264 |
| 270 | 3300026121 | Ga0207683_10024062 | Ga0207683_100240623 | 264 |
| 271 | 3300026121 | Ga0207683_10325089 | Ga0207683_103250892 | 264 |
| 272 | 3300026142 | Ga0207698_10006261 | Ga0207698_100062615 | 264 |
| 273 | 3300027111 | Ga0209281_1000056 | Ga0209281_100005678 | 264 |
| 274 | 3300028380 | Ga0268265_10361576 | Ga0268265_103615762 | 264 |
| 275 | 3300028381 | Ga0268264_10002971 | Ga0268264_1000297110 | 264 |
| 276 | 3300028381 | Ga0268264_10020319 | Ga0268264_100203192 | 264 |
| 277 | 3300030736 | Ga0316180_1157605 | Ga0316180_11576052 | 264 |
| 278 | 3300030745 | Ga0316182_1221789 | Ga0316182_12217892 | 264 |
| 279 | 3300031251 | Ga0265327_10000432 | Ga0265327_1000043233 | 264 |
| 280 | 3300031824 | Ga0307413_10428649 | Ga0307413_104286491 | 264 |
| 281 | 3300031901 | Ga0307406_10309760 | Ga0307406_103097602 | 264 |
| 282 | 3300035398 | Ga0316574_0083314 | Ga0316574_0083314_445_1239 | 264 |
| 283 | 3300035398 | Ga0316574_0130205 | Ga0316574_0130205_223_1017 | 264 |
| 284 | 3300037312 | Ga0395899_0002720 | Ga0395899_0002720_12701_13495 | 264 |
| 285 | 3300037312 | Ga0395899_0023907 | Ga0395899_0023907_2134_2943 | 264 |
| 286 | 3300037418 | Ga0395900_0000028 | Ga0395900_0000028_37089_37883 | 264 |
| 287 | 3300037418 | Ga0395900_0002348 | Ga0395900_0002348_1916_2710 | 264 |
| 288 | 3300037418 | Ga0395900_0004043 | Ga0395900_0004043_13170_13979 | 264 |
| 289 | 3300037418 | Ga0395900_0128905 | Ga0395900_0128905_282_1091 | 264 |
| 290 | 3300037418 | Ga0395900_0205762 | Ga0395900_0205762_465_1259 | 264 |
| 291 | 3300037418 | Ga0395900_0741019 | Ga0395900_0741019_47_841 | 264 |
| 292 | 3300037466 | Ga0395898_0002043 | Ga0395898_0002043_12848_13657 | 264 |
| 293 | 3300037466 | Ga0395898_0259732 | Ga0395898_0259732_596_1390 | 264 |
| 294 | 3300038443 | Ga0395901_0000025 | Ga0395901_0000025_229441_230235 | 264 |
| 295 | 3300038443 | Ga0395901_0019500 | Ga0395901_0019500_230_1024 | 264 |
| 296 | 3300038443 | Ga0395901_0054633 | Ga0395901_0054633_1313_2122 | 264 |
| 297 | 3300038443 | Ga0395901_0477792 | Ga0395901_0477792_267_1061 | 264 |
| 298 | 3300038443 | Ga0395901_0687442 | Ga0395901_0687442_97_891 | 264 |
| 299 | 3300042004 | Ga0439445_0051958 | Ga0439445_0051958_54_848 | 264 |
| 300 | 3300042005 | Ga0439448_0006129 | Ga0439448_0006129_761_1555 | 264 |
| 301 | 3300042007 | Ga0439449_0015862 | Ga0439449_0015862_1837_2631 | 264 |
| 302 | 3300042156 | Ga0439446_0035090 | Ga0439446_0035090_344_1138 | 264 |
| 303 | 3300044656 | Ga0466969_0008401 | Ga0466969_0008401_55_867 | 264 |
| 304 | 3300044658 | Ga0466972_0000003 | Ga0466972_0000003_101965_102780 | 264 |
| 305 | 3300044658 | Ga0466972_0000801 | Ga0466972_0000801_12855_13649 | 264 |
| 306 | 3300044658 | Ga0466972_0119060 | Ga0466972_0119060_176_970 | 264 |
| 307 | 3300044683 | Ga0466965_0006443 | Ga0466965_0006443_3794_4588 | 264 |
| 308 | 3300044683 | Ga0466965_0025139 | Ga0466965_0025139_1786_2580 | 264 |
| 309 | 3300044683 | Ga0466965_0108388 | Ga0466965_0108388_106_900 | 264 |
| 310 | 3300044684 | Ga0466966_0087316 | Ga0466966_0087316_686_1480 | 264 |
| 311 | 3300044684 | Ga0466966_0125173 | Ga0466966_0125173_96_890 | 264 |
| 312 | 3300044684 | Ga0466966_0143467 | Ga0466966_0143467_592_1386 | 264 |
| 313 | 3300044693 | Ga0466961_0156681 | Ga0466961_0156681_592_1386 | 264 |
| 314 | 3300044706 | Ga0466964_0000574 | Ga0466964_0000574_9591_10385 | 264 |
| 315 | 3300044706 | Ga0466964_0048969 | Ga0466964_0048969_147_941 | 264 |
| 316 | 3300044712 | Ga0453684_0078879 | Ga0453684_0078879_1062_1856 | 264 |
| 317 | 3300044719 | Ga0466971_0079794 | Ga0466971_0079794_92_886 | 264 |
| 318 | 3300044735 | Ga0466968_0064983 | Ga0466968_0064983_67_861 | 264 |
| 319 | 3300044735 | Ga0466968_0090999 | Ga0466968_0090999_118_912 | 264 |
| 320 | 3300044765 | Ga0466970_0000607 | Ga0466970_0000607_4413_5228 | 264 |
| 321 | 3300044765 | Ga0466970_0143170 | Ga0466970_0143170_142_936 | 264 |
| 322 | 3300044842 | Ga0466957_0007434 | Ga0466957_0007434_1684_2478 | 264 |
| 323 | 3300044842 | Ga0466957_0033924 | Ga0466957_0033924_774_1568 | 264 |
| 324 | 3300045049 | Ga0466959_0051074 | Ga0466959_0051074_414_1208 | 264 |
| 325 | 3300045976 | Ga0466967_0093427 | Ga0466967_0093427_1180_1974 | 264 |
| 326 | 3300046453 | Ga0495627_001465 | Ga0495627_001465_6756_7550 | 264 |
| 327 | 3300046455 | Ga0495603_0117361 | Ga0495603_0117361_253_1047 | 264 |
| 328 | 3300046457 | Ga0495590_0001273 | Ga0495590_0001273_8775_9614 | 264 |
| 329 | 3300046458 | Ga0495591_000236 | Ga0495591_000236_45608_46402 | 264 |
| 330 | 3300046460 | Ga0495638_0082435 | Ga0495638_0082435_796_1590 | 264 |
| 331 | 3300046472 | Ga0495580_0070292 | Ga0495580_0070292_236_1030 | 264 |
| 332 | 3300046473 | Ga0495582_0013683 | Ga0495582_0013683_1544_2338 | 264 |
| 333 | 3300046474 | Ga0495605_0000177 | Ga0495605_0000177_77310_78104 | 264 |
| 334 | 3300046474 | Ga0495605_0001739 | Ga0495605_0001739_12938_13732 | 264 |
| 335 | 3300046474 | Ga0495605_0006538 | Ga0495605_0006538_3757_4551 | 264 |
| 336 | 3300046474 | Ga0495605_0013984 | Ga0495605_0013984_1916_2710 | 264 |
| 337 | 3300046475 | Ga0495639_0227324 | Ga0495639_0227324_102_896 | 264 |
| 338 | 3300046491 | Ga0495584_0000001 | Ga0495584_0000001_155850_156644 | 264 |
| 339 | 3300046491 | Ga0495584_0000366 | Ga0495584_0000366_1842_2636 | 264 |
| 340 | 3300046491 | Ga0495584_0000452 | Ga0495584_0000452_3495_4289 | 264 |
| 341 | 3300046491 | Ga0495584_0001551 | Ga0495584_0001551_10557_11351 | 264 |
| 342 | 3300046491 | Ga0495584_0004007 | Ga0495584_0004007_3879_4673 | 264 |
| 343 | 3300046491 | Ga0495584_0008288 | Ga0495584_0008288_512_1306 | 264 |
| 344 | 3300046491 | Ga0495584_0011200 | Ga0495584_0011200_2568_3362 | 264 |
| 345 | 3300046491 | Ga0495584_0011673 | Ga0495584_0011673_1270_2064 | 264 |
| 346 | 3300046492 | Ga0495585_0000600 | Ga0495585_0000600_1955_2749 | 264 |
| 347 | 3300046492 | Ga0495585_0000697 | Ga0495585_0000697_1912_2706 | 264 |
| 348 | 3300046492 | Ga0495585_0001480 | Ga0495585_0001480_11384_12178 | 264 |
| 349 | 3300046492 | Ga0495585_0006526 | Ga0495585_0006526_3630_4424 | 264 |
| 350 | 3300046492 | Ga0495585_0006714 | Ga0495585_0006714_478_1272 | 264 |
| 351 | 3300046492 | Ga0495585_0017738 | Ga0495585_0017738_1540_2334 | 264 |
| 352 | 3300046492 | Ga0495585_0028730 | Ga0495585_0028730_1754_2548 | 264 |
| 353 | 3300046492 | Ga0495585_0042463 | Ga0495585_0042463_938_1732 | 264 |
| 354 | 3300046492 | Ga0495585_0053236 | Ga0495585_0053236_313_1107 | 264 |
| 355 | 3300046499 | Ga0495594_0023866 | Ga0495594_0023866_1790_2584 | 264 |
| 356 | 3300046499 | Ga0495594_0245791 | Ga0495594_0245791_131_925 | 264 |
| 357 | 3300046500 | Ga0495596_0000615 | Ga0495596_0000615_2016_2810 | 264 |
| 358 | 3300046500 | Ga0495596_0000821 | Ga0495596_0000821_2170_2964 | 264 |
| 359 | 3300046500 | Ga0495596_0006977 | Ga0495596_0006977_1738_2532 | 264 |
| 360 | 3300046500 | Ga0495596_0008987 | Ga0495596_0008987_2610_3404 | 264 |
| 361 | 3300046500 | Ga0495596_0010760 | Ga0495596_0010760_1762_2556 | 264 |
| 362 | 3300046500 | Ga0495596_0018122 | Ga0495596_0018122_1028_1822 | 264 |
| 363 | 3300046500 | Ga0495596_0029061 | Ga0495596_0029061_1184_1978 | 264 |
| 364 | 3300046501 | Ga0495607_0001696 | Ga0495607_0001696_2245_3039 | 264 |
| 365 | 3300046501 | Ga0495607_0002247 | Ga0495607_0002247_14833_15627 | 264 |
| 366 | 3300046501 | Ga0495607_0011028 | Ga0495607_0011028_3680_4474 | 264 |
| 367 | 3300046501 | Ga0495607_0029059 | Ga0495607_0029059_2177_2971 | 264 |
| 368 | 3300046501 | Ga0495607_0102545 | Ga0495607_0102545_312_1106 | 264 |
| 369 | 3300046506 | Ga0495583_0000506 | Ga0495583_0000506_51434_52228 | 264 |
| 370 | 3300046507 | Ga0495606_0004705 | Ga0495606_0004705_11071_11865 | 264 |
| 371 | 3300046507 | Ga0495606_0015233 | Ga0495606_0015233_1152_1946 | 264 |
| 372 | 3300046507 | Ga0495606_0089815 | Ga0495606_0089815_179_973 | 264 |
| 373 | 3300046507 | Ga0495606_0135404 | Ga0495606_0135404_348_1142 | 264 |
| 374 | 3300046512 | Ga0495610_0010358 | Ga0495610_0010358_3446_4240 | 264 |
| 375 | 3300046513 | Ga0495616_0001634 | Ga0495616_0001634_437_1231 | 264 |
| 376 | 3300046513 | Ga0495616_0003927 | Ga0495616_0003927_3829_4755 | 264 |
| 377 | 3300046513 | Ga0495616_0008600 | Ga0495616_0008600_4445_5239 | 264 |
| 378 | 3300046513 | Ga0495616_0106653 | Ga0495616_0106653_67_861 | 264 |
| 379 | 3300046518 | Ga0495631_0006918 | Ga0495631_0006918_4982_5776 | 264 |
| 380 | 3300046518 | Ga0495631_0033138 | Ga0495631_0033138_121_915 | 264 |
| 381 | 3300046519 | Ga0495632_0000156 | Ga0495632_0000156_6607_7401 | 264 |
| 382 | 3300046519 | Ga0495632_0000537 | Ga0495632_0000537_7225_8019 | 264 |
| 383 | 3300046519 | Ga0495632_0011507 | Ga0495632_0011507_662_1456 | 264 |
| 384 | 3300046519 | Ga0495632_0035337 | Ga0495632_0035337_308_1102 | 264 |
| 385 | 3300046522 | Ga0495643_0002305 | Ga0495643_0002305_3524_4318 | 264 |
| 386 | 3300046522 | Ga0495643_0003688 | Ga0495643_0003688_9155_9949 | 264 |
| 387 | 3300046522 | Ga0495643_0008036 | Ga0495643_0008036_5861_6655 | 264 |
| 388 | 3300046522 | Ga0495643_0028675 | Ga0495643_0028675_17_811 | 264 |
| 389 | 3300046522 | Ga0495643_0031913 | Ga0495643_0031913_194_988 | 264 |
| 390 | 3300046523 | Ga0495644_0010708 | Ga0495644_0010708_1746_2540 | 264 |
| 391 | 3300046523 | Ga0495644_0019643 | Ga0495644_0019643_685_1479 | 264 |
| 392 | 3300046523 | Ga0495644_0053416 | Ga0495644_0053416_602_1396 | 264 |
| 393 | 3300046523 | Ga0495644_0064157 | Ga0495644_0064157_337_1131 | 264 |
| 394 | 3300046524 | Ga0495648_0023546 | Ga0495648_0023546_315_1109 | 264 |
| 395 | 3300046526 | Ga0495666_0002495 | Ga0495666_0002495_7608_8402 | 264 |
| 396 | 3300046526 | Ga0495666_0063882 | Ga0495666_0063882_680_1474 | 264 |
| 397 | 3300046528 | Ga0495642_0000053 | Ga0495642_0000053_63008_63802 | 264 |
| 398 | 3300046528 | Ga0495642_0000433 | Ga0495642_0000433_2386_3180 | 264 |
| 399 | 3300046528 | Ga0495642_0002723 | Ga0495642_0002723_4037_4831 | 264 |
| 400 | 3300046531 | Ga0495665_0001008 | Ga0495665_0001008_2347_3141 | 264 |
| 401 | 3300046535 | Ga0495586_0069245 | Ga0495586_0069245_138_932 | 264 |
| 402 | 3300046538 | Ga0495609_0000001 | Ga0495609_0000001_523534_524460 | 264 |
| 403 | 3300046538 | Ga0495609_0008646 | Ga0495609_0008646_3853_4647 | 264 |
| 404 | 3300046538 | Ga0495609_0020636 | Ga0495609_0020636_470_1264 | 264 |
| 405 | 3300046538 | Ga0495609_0026206 | Ga0495609_0026206_423_1217 | 264 |
| 406 | 3300046542 | Ga0495597_0000488 | Ga0495597_0000488_2356_3150 | 264 |
| 407 | 3300046542 | Ga0495597_0002178 | Ga0495597_0002178_6448_7242 | 264 |
| 408 | 3300046542 | Ga0495597_0002942 | Ga0495597_0002942_6485_7279 | 264 |
| 409 | 3300046557 | Ga0495622_0113871 | Ga0495622_0113871_365_1159 | 264 |
| 410 | 3300046558 | Ga0495633_0002380 | Ga0495633_0002380_11404_12198 | 264 |
| 411 | 3300046558 | Ga0495633_0027256 | Ga0495633_0027256_1814_2608 | 264 |
| 412 | 3300046558 | Ga0495633_0051966 | Ga0495633_0051966_762_1556 | 264 |
| 413 | 3300046615 | Ga0495656_0017719 | Ga0495656_0017719_1666_2460 | 264 |
| 414 | 3300046615 | Ga0495656_0030285 | Ga0495656_0030285_1283_2077 | 264 |
| 415 | 3300046615 | Ga0495656_0105218 | Ga0495656_0105218_96_890 | 264 |
| 416 | 3300046616 | Ga0495668_0002833 | Ga0495668_0002833_11275_12087 | 264 |
| 417 | 3300046616 | Ga0495668_0006442 | Ga0495668_0006442_5617_6411 | 264 |
| 418 | 3300046616 | Ga0495668_0006681 | Ga0495668_0006681_6487_7281 | 264 |
| 419 | 3300046616 | Ga0495668_0024499 | Ga0495668_0024499_1274_2068 | 264 |
| 420 | 3300046616 | Ga0495668_0050068 | Ga0495668_0050068_568_1362 | 264 |
| 421 | 3300046616 | Ga0495668_0089260 | Ga0495668_0089260_298_1092 | 264 |
| 422 | 3300046616 | Ga0495668_0218136 | Ga0495668_0218136_97_891 | 264 |
| 423 | 3300046648 | Ga0495611_0000960 | Ga0495611_0000960_11429_12223 | 264 |
| 424 | 3300046648 | Ga0495611_0005964 | Ga0495611_0005964_1355_2149 | 264 |
| 425 | 3300046648 | Ga0495611_0061906 | Ga0495611_0061906_137_931 | 264 |
| 426 | 3300046648 | Ga0495611_0213440 | Ga0495611_0213440_82_876 | 264 |
| 427 | 3300046660 | Ga0495625_0005815 | Ga0495625_0005815_241_1035 | 264 |
| 428 | 3300046660 | Ga0495625_0041053 | Ga0495625_0041053_2530_3324 | 264 |
| 429 | 3300046665 | Ga0495661_0000069 | Ga0495661_0000069_96074_96868 | 264 |
| 430 | 3300046665 | Ga0495661_0005217 | Ga0495661_0005217_5269_6063 | 264 |
| 431 | 3300046665 | Ga0495661_0009005 | Ga0495661_0009005_2298_3092 | 264 |
| 432 | 3300046665 | Ga0495661_0021506 | Ga0495661_0021506_3138_3932 | 264 |
| 433 | 3300046665 | Ga0495661_0050020 | Ga0495661_0050020_555_1349 | 264 |
| 434 | 3300046665 | Ga0495661_0060506 | Ga0495661_0060506_308_1102 | 264 |
| 435 | 3300046665 | Ga0495661_0135992 | Ga0495661_0135992_411_1205 | 264 |
| 436 | 3300046674 | Ga0495588_0000041 | Ga0495588_0000041_144345_145139 | 264 |
| 437 | 3300046674 | Ga0495588_0111712 | Ga0495588_0111712_11_805 | 264 |
| 438 | 3300046684 | Ga0495669_0013262 | Ga0495669_0013262_1234_2028 | 264 |
| 439 | 3300046684 | Ga0495669_0025414 | Ga0495669_0025414_927_1721 | 264 |
| 440 | 3300046691 | Ga0495670_0002666 | Ga0495670_0002666_1441_2235 | 264 |
| 441 | 3300046691 | Ga0495670_0060581 | Ga0495670_0060581_922_1716 | 264 |
| 442 | 3300046692 | Ga0495671_0008192 | Ga0495671_0008192_637_1431 | 264 |
| 443 | 3300046694 | Ga0495649_0000537 | Ga0495649_0000537_3465_4259 | 264 |
| 444 | 3300046694 | Ga0495649_0001788 | Ga0495649_0001788_3763_4557 | 264 |
| 445 | 3300046694 | Ga0495649_0020176 | Ga0495649_0020176_2482_3276 | 264 |
| 446 | 3300046794 | Ga0495589_0000061 | Ga0495589_0000061_39521_40447 | 264 |
| 447 | 3300046794 | Ga0495589_0000072 | Ga0495589_0000072_3770_4564 | 264 |
| 448 | 3300046794 | Ga0495589_0014127 | Ga0495589_0014127_1321_2115 | 264 |
| 449 | 3300046794 | Ga0495589_0030024 | Ga0495589_0030024_696_1490 | 264 |
| 450 | 3300046794 | Ga0495589_0046286 | Ga0495589_0046286_343_1137 | 264 |
| 451 | 3300046810 | Ga0495660_0000243 | Ga0495660_0000243_11810_12604 | 264 |
| 452 | 3300046810 | Ga0495660_0008501 | Ga0495660_0008501_362_1156 | 264 |
| 453 | 3300046810 | Ga0495660_0074213 | Ga0495660_0074213_847_1680 | 264 |
| 454 | 3300047317 | Ga0495604_0154424 | Ga0495604_0154424_165_959 | 264 |
| 455 | 3300047318 | Ga0495636_0000011 | Ga0495636_0000011_11268_12062 | 264 |
| 456 | 3300047318 | Ga0495636_0003018 | Ga0495636_0003018_2681_3475 | 264 |
| 457 | 3300047320 | Ga0495672_0000258 | Ga0495672_0000258_3693_4487 | 264 |
| 458 | 3300047320 | Ga0495672_0010604 | Ga0495672_0010604_3941_4750 | 264 |
| 459 | 3300047320 | Ga0495672_0020962 | Ga0495672_0020962_1556_2350 | 264 |
| 460 | 3300047321 | Ga0495676_0039316 | Ga0495676_0039316_2518_3312 | 264 |
| 461 | 3300047323 | Ga0495683_0000009 | Ga0495683_0000009_46997_47791 | 264 |
| 462 | 3300047323 | Ga0495683_0000446 | Ga0495683_0000446_3914_4708 | 264 |
| 463 | 3300047323 | Ga0495683_0015742 | Ga0495683_0015742_492_1286 | 264 |
| 464 | 3300047443 | Ga0495687_000027 | Ga0495687_000027_181806_182732 | 264 |
| 465 | 3300047443 | Ga0495687_000630 | Ga0495687_000630_26531_27325 | 264 |
| 466 | 3300047443 | Ga0495687_001824 | Ga0495687_001824_15864_16658 | 264 |
| 467 | 3300047443 | Ga0495687_002017 | Ga0495687_002017_5136_5930 | 264 |
| 468 | 3300047444 | Ga0495675_0030627 | Ga0495675_0030627_2217_3011 | 264 |
| 469 | 3300047445 | Ga0495677_0000001 | Ga0495677_0000001_181887_182813 | 264 |
| 470 | 3300047445 | Ga0495677_0000195 | Ga0495677_0000195_2935_3729 | 264 |
| 471 | 3300047445 | Ga0495677_0001118 | Ga0495677_0001118_7707_8501 | 264 |
| 472 | 3300047445 | Ga0495677_0001701 | Ga0495677_0001701_487_1281 | 264 |
| 473 | 3300047445 | Ga0495677_0006543 | Ga0495677_0006543_3433_4227 | 264 |
| 474 | 3300047446 | Ga0495679_001482 | Ga0495679_001482_12226_13020 | 264 |
| 475 | 3300047446 | Ga0495679_016971 | Ga0495679_016971_614_1408 | 264 |
| 476 | 3300047470 | Ga0495681_0000428 | Ga0495681_0000428_5395_6189 | 264 |
| 477 | 3300047470 | Ga0495681_0015193 | Ga0495681_0015193_2117_2911 | 264 |
| 478 | 3300047470 | Ga0495681_0024964 | Ga0495681_0024964_1502_2296 | 264 |
| 479 | 3300047472 | Ga0495686_0000146 | Ga0495686_0000146_655_1449 | 264 |
| 480 | 3300047472 | Ga0495686_0000373 | Ga0495686_0000373_34521_35315 | 264 |
| 481 | 3300047472 | Ga0495686_0001101 | Ga0495686_0001101_28408_29202 | 264 |
| 482 | 3300047472 | Ga0495686_0006503 | Ga0495686_0006503_7674_8468 | 264 |
| 483 | 3300047472 | Ga0495686_0047236 | Ga0495686_0047236_1270_2064 | 264 |
| 484 | 3300047673 | Ga0495593_0213731 | Ga0495593_0213731_37_831 | 264 |
| 485 | 3300048091 | Ga0495626_0000027 | Ga0495626_0000027_166356_167150 | 264 |
| 486 | 3300048091 | Ga0495626_0000135 | Ga0495626_0000135_90741_91535 | 264 |
| 487 | 3300048091 | Ga0495626_0000193 | Ga0495626_0000193_32356_33150 | 264 |
| 488 | 3300048091 | Ga0495626_0039499 | Ga0495626_0039499_787_1581 | 264 |
| 489 | 3300048091 | Ga0495626_0067380 | Ga0495626_0067380_266_1060 | 264 |
| 490 | 3300048904 | Ga0496101_0066030 | Ga0496101_0066030_1016_1810 | 264 |
| 491 | 3300048905 | Ga0496102_0000058 | Ga0496102_0000058_122186_122980 | 264 |
| 492 | 3300048907 | Ga0496104_0443251 | Ga0496104_0443251_188_982 | 264 |
| 493 | 3300048909 | Ga0496106_0297027 | Ga0496106_0297027_326_1120 | 264 |
| 494 | 3300048910 | Ga0496107_0170968 | Ga0496107_0170968_450_1244 | 264 |
| 495 | 3300048912 | Ga0496109_0347154 | Ga0496109_0347154_548_1342 | 264 |
| 496 | 3300048913 | Ga0496110_0000251 | Ga0496110_0000251_1880_2674 | 264 |
| 497 | 3300048913 | Ga0496110_0009047 | Ga0496110_0009047_1092_1886 | 264 |
| 498 | 3300048913 | Ga0496110_0021952 | Ga0496110_0021952_2961_3755 | 264 |
| 499 | 3300048915 | Ga0496112_0240363 | Ga0496112_0240363_358_1152 | 264 |
| 500 | 3300048916 | Ga0496113_0405827 | Ga0496113_0405827_77_871 | 264 |
| 501 | 3300048918 | Ga0496115_0112393 | Ga0496115_0112393_456_1250 | 264 |
| 502 | 3300048919 | Ga0496116_0003966 | Ga0496116_0003966_8593_9387 | 264 |
| 503 | 3300048924 | Ga0496121_0161506 | Ga0496121_0161506_213_1007 | 264 |
| 504 | 3300048925 | Ga0496122_0002056 | Ga0496122_0002056_10530_11324 | 264 |
| 505 | 3300048925 | Ga0496122_0007048 | Ga0496122_0007048_4548_5342 | 264 |
| 506 | 3300048925 | Ga0496122_0022678 | Ga0496122_0022678_2543_3337 | 264 |
| 507 | 3300048926 | Ga0496123_0001705 | Ga0496123_0001705_23243_24037 | 264 |
| 508 | 3300048926 | Ga0496123_0004467 | Ga0496123_0004467_11288_12082 | 264 |
| 509 | 3300048927 | Ga0496124_0013112 | Ga0496124_0013112_6404_7198 | 264 |
| 510 | 3300048927 | Ga0496124_0180220 | Ga0496124_0180220_80_895 | 264 |
| 511 | 3300048928 | Ga0496125_0002290 | Ga0496125_0002290_10215_11009 | 264 |
| 512 | 3300049128 | Ga0501308_001455 | Ga0501308_001455_907_1701 | 264 |
| 513 | 3300049459 | Ga0495678_000110 | Ga0495678_000110_3584_4378 | 264 |
| 514 | 3300049459 | Ga0495678_022198 | Ga0495678_022198_1256_2050 | 264 |
| 515 | 3300049460 | Ga0495682_0007385 | Ga0495682_0007385_1933_2727 | 264 |
| 516 | 3300049460 | Ga0495682_0020557 | Ga0495682_0020557_438_1232 | 264 |
| 517 | 3300049521 | Ga0501298_004446 | Ga0501298_004446_246_1040 | 264 |
| 518 | 3300049571 | Ga0501034_0023415 | Ga0501034_0023415_2412_3227 | 264 |
| 519 | 3300049571 | Ga0501034_0170353 | Ga0501034_0170353_156_965 | 264 |
| 520 | 3300049571 | Ga0501034_0212020 | Ga0501034_0212020_753_1562 | 264 |
| 521 | 3300049574 | Ga0501038_0149218 | Ga0501038_0149218_104_913 | 264 |
| 522 | 3300049575 | Ga0501039_0456830 | Ga0501039_0456830_37_846 | 264 |
| 523 | 3300049579 | Ga0501043_0113283 | Ga0501043_0113283_573_1382 | 264 |
| 524 | 3300049583 | Ga0501067_0026472 | Ga0501067_0026472_1668_2483 | 264 |
| 525 | 3300049585 | Ga0501069_0048089 | Ga0501069_0048089_922_1737 | 264 |
| 526 | 3300049586 | Ga0501070_0376927 | Ga0501070_0376927_321_1136 | 264 |
| 527 | 3300049588 | Ga0501072_0181283 | Ga0501072_0181283_519_1334 | 264 |
| 528 | 3300049589 | Ga0501073_0162407 | Ga0501073_0162407_586_1401 | 264 |
| 529 | 3300049651 | Ga0501201_000140 | Ga0501201_000140_1995_2789 | 264 |
| 530 | 3300049654 | Ga0501207_011209 | Ga0501207_011209_92_886 | 264 |
| 531 | 3300049661 | Ga0501217_017854 | Ga0501217_017854_129_923 | 264 |
| 532 | 3300049662 | Ga0501222_004316 | Ga0501222_004316_835_1629 | 264 |
| 533 | 3300049663 | Ga0501223_001744 | Ga0501223_001744_543_1337 | 264 |
| 534 | 3300049668 | Ga0501233_014174 | Ga0501233_014174_426_1220 | 264 |
| 535 | 3300049669 | Ga0501235_001675 | Ga0501235_001675_3859_4653 | 264 |
| 536 | 3300049674 | Ga0501242_002559 | Ga0501242_002559_253_1047 | 264 |
| 537 | 3300049675 | Ga0501243_001273 | Ga0501243_001273_358_1152 | 264 |
| 538 | 3300049681 | Ga0501251_017977 | Ga0501251_017977_39_833 | 264 |
| 539 | 3300049686 | Ga0501257_003118 | Ga0501257_003118_2591_3385 | 264 |
| 540 | 3300049686 | Ga0501257_004374 | Ga0501257_004374_289_1083 | 264 |
| 541 | 3300049688 | Ga0501259_004374 | Ga0501259_004374_259_1053 | 264 |
| 542 | 3300049707 | Ga0501234_011897 | Ga0501234_011897_172_966 | 264 |
| 543 | 3300049708 | Ga0501245_004933 | Ga0501245_004933_280_1074 | 264 |
| 544 | 3300049742 | Ga0501080_0223463 | Ga0501080_0223463_778_1593 | 264 |
| 545 | 3300049744 | Ga0501083_0015230 | Ga0501083_0015230_1629_2444 | 264 |
| 546 | 3300049757 | Ga0501232_001451 | Ga0501232_001451_804_1598 | 264 |
| 547 | 3300049763 | Ga0501266_001738 | Ga0501266_001738_656_1450 | 264 |
| 548 | 3300049822 | Ga0501035_0159292 | Ga0501035_0159292_179_988 | 264 |
| 549 | 3300049822 | Ga0501035_0521741 | Ga0501035_0521741_35_850 | 264 |
| 550 | 3300050493 | nmdc:mga0k408_92153_c1 | nmdc:mga0k408_92153_c1_227_1021 | 264 |
| 551 | 3300053088 | Ga0500644_0063132 | Ga0500644_0063132_379_1173 | 264 |
| 552 | 3300053096 | Ga0500641_0025562 | Ga0500641_0025562_719_1513 | 264 |
| 553 | 3300053108 | Ga0500562_000077 | Ga0500562_000077_5731_6525 | 264 |
| 554 | 3300053139 | Ga0500568_0006155 | Ga0500568_0006155_4689_5510 | 264 |
| 555 | 3300053156 | Ga0500622_0003322 | Ga0500622_0003322_6716_7510 | 264 |
| 556 | 3300054114 | Ga0501084_0029727 | Ga0501084_0029727_3434_4249 | 264 |
| 557 | 3300059493 | Ga0587077_025297 | Ga0587077_025297_225_1019 | 264 |
| 558 | 3300059505 | Ga0587083_0020468 | Ga0587083_0020468_276_1070 | 264 |
| 559 | 3300059641 | Ga0587068_008424 | Ga0587068_008424_646_1440 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h0r-assembly1.cif.gz_A | crystal structure of thymidylate synthase from corynebacterium glutamicum | 0.9746 | 3 | 258 |
| 6auj-assembly2.cif.gz_C | crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 | 0.9743 | 1 | 251 |
| 2g8x-assembly1.cif.gz_B | escherichia coli y209w apoprotein | 0.9726 | 3 | 262 |
| 4h0r-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum | 0.9718 | 3 | 258 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.9716 | 1 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9593 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9466 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9443 | 2 | 262 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9397 | 2 | 264 | 3.30.572.10 |
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.933 | 2 | 251 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377CVI5-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9826 | 99 | 228 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A4Z0P2P4-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9778 | 51 | 259 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A3Q3X194-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9759 | 107 | 243 |
GO:0004799
GO:0005739 GO:0005829 GO:0006231 GO:0006235 GO:0032259 |
| AF-A0A3B8HDY4-F1-model_v4 | deleted | 0.9743 | 119 | 250 |
|
| AF-A0A355C418-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9742 | 1 | 222 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar