F463558

General Info

Members Datasets Scaffolds Average Seq Length
559 241 548 435

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10081510|Ga0157372_100815103
Length 490
Sequence MWYILSNVKKNSKQSFSSKNDFANKVLKKNIFITKLKFFKCIADYIFHLNVFMAELDRKLGLWHASAINMTDMVGIGPFITLPMVIGMMNGPYFLYAWIAGAFLSIVDGMVWSELGAAFPRAGGSYNFLKEAYGKKAGGRMMSFLFVWQTMIQAPLVIASAAIGFAKYFSFIVPLTAYTEKLVSGGYRKIEAIGKISVFLWSGVIITMFWIIGGGILHGNFLMPLKNINNGLTVDYAFVTAIGFASVKSVYSYLGYYNICHLGGEIKNPSKNIPKSMFISIIVIAVLYLLMNISVVSVLPWQQAKDSEFVVSEFMQVLLGHTAATVITCLILWVAFASVFSATLGYSRIPYAAAEDGEFFKIFAKLHPTKHFPYVSLLFLGGVAFVFSMLFKLSETISAILAMRIMIQFIGQAVGLLILRSKKNEAAFPYKMPLFPLPVLAAIAMWLFILISTGTKLMLSGLFVIFLGVIVYFIKAKFQKEWPFVSVGKQ

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2914759650 Rhizosphaericola mali Isolate Rhizosphere
9 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
217 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0.18
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.36
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10012803 3300002459 Bacteria 1730
2 JGI25406J46586_10001059 3300003203 Bacteria 12890
3 rootH1_10018150 3300003316 Bacteria 2033
4 rootH1_10052371 3300003316 Bacteria 31617
5 rootH1_10117803 3300003316 Bacteria 3402
6 rootH2_10015699 3300003320 Bacteria 2370
7 rootH2_10114781 3300003320 Bacteria 2445
8 rootL2_10004033 3300003322 Bacteria 45524
9 rootL2_10065261 3300003322 Bacteria 18155
10 rootL2_10075642 3300003322 Bacteria 2868
11 rootL2_10132181 3300003322 Bacteria 15845
12 rootL2_10160375 3300003322 Bacteria 4188
13 rootL2_10194414 3300003322 Bacteria 2974
14 rootL2_10226720 3300003322 Bacteria 4711
15 rootH1_10015492 3300003323 Bacteria 90717
16 rootH1_10041902 3300003323 Bacteria 5968
17 rootH1_10098526 3300003323 Bacteria 5269
18 rootH1_10119581 3300003323 Bacteria 6300
19 rootH1_10251219 3300003323 Bacteria 4867
20 rootH1_10256724 3300003323 Bacteria 2944
21 Ga0055535_1000572 3300003761 Bacteria 31004
22 Ga0055531_10000041 3300003794 Bacteria 135600
23 Ga0065165_1001983 3300005262 Bacteria 19290
24 Ga0065712_10086646 3300005290 Bacteria 2623
25 Ga0065712_10107515 3300005290 Bacteria 1894
26 Ga0065712_10129417 3300005290 Bacteria 1567
27 Ga0070658_10009494 3300005327 Bacteria 7819
28 Ga0070658_10074535 3300005327 Bacteria 2783
29 Ga0070658_10086763 3300005327 Bacteria 2575
30 Ga0070658_10167895 3300005327 Bacteria 1843
31 Ga0070683_100000417 3300005329 Bacteria 29450
32 Ga0070683_100014920 3300005329 Bacteria 6809
33 Ga0070683_100024493 3300005329 Bacteria 5407
34 Ga0070683_100025718 3300005329 Bacteria 5291
35 Ga0070683_100045687 3300005329 Bacteria 4043
36 Ga0070683_100046675 3300005329 Bacteria 4003
37 Ga0070683_100102110 3300005329 Bacteria 2701
38 Ga0070670_100033275 3300005331 Bacteria 4440
39 Ga0070670_100060120 3300005331 Bacteria 3262
40 Ga0070670_100166206 3300005331 Bacteria 1913
41 Ga0070670_100200868 3300005331 Bacteria 1732
42 Ga0068869_100009198 3300005334 Bacteria 6402
43 Ga0068869_100110952 3300005334 Bacteria 2087
44 Ga0070666_10002958 3300005335 Bacteria 10296
45 Ga0070666_10003367 3300005335 Bacteria 9695
46 Ga0070680_100004033 3300005336 Bacteria 10986
47 Ga0070680_100032104 3300005336 Bacteria 4224
48 Ga0070680_100137441 3300005336 Unclassified 2048
49 Ga0070682_100000190 3300005337 Bacteria 46394
50 Ga0070682_100018940 3300005337 Bacteria 4032
51 Ga0068868_100000524 3300005338 Bacteria 25677
52 Ga0068868_100042742 3300005338 Bacteria 3539
53 Ga0068868_100095244 3300005338 Bacteria 2403
54 Ga0068868_100165131 3300005338 Bacteria 1831
55 Ga0070660_100006675 3300005339 Bacteria 8011
56 Ga0070660_100190825 3300005339 Bacteria 1660
57 Ga0070689_100002023 3300005340 Bacteria 13154
58 Ga0070661_100020138 3300005344 Bacteria 4756
59 Ga0070668_100013224 3300005347 Bacteria 6156
60 Ga0070669_100023893 3300005353 Bacteria 4379
61 Ga0070669_100096607 3300005353 Bacteria 2223
62 Ga0070675_100006657 3300005354 Bacteria 8885
63 Ga0070675_100087564 3300005354 Unclassified 2604
64 Ga0070671_100105816 3300005355 Unclassified 2361
65 Ga0070673_100093991 3300005364 Bacteria 2457
66 Ga0070673_100178932 3300005364 Bacteria 1814
67 Ga0070688_100015633 3300005365 Bacteria 4323
68 Ga0070659_100022425 3300005366 Bacteria 4820
69 Ga0070659_100033893 3300005366 Bacteria 3970
70 Ga0070659_100116503 3300005366 Unclassified 2160
71 Ga0070659_100179132 3300005366 Bacteria 1739
72 Ga0070667_100023184 3300005367 Bacteria 5150
73 Ga0070667_100072478 3300005367 Bacteria 2935
74 Ga0070714_100000093 3300005435 Bacteria 75455
75 Ga0070700_100125917 3300005441 Bacteria 1723
76 Ga0070678_100022194 3300005456 Bacteria 4200
77 Ga0070662_100002459 3300005457 Bacteria 11410
78 Ga0070662_100003891 3300005457 Bacteria 9359
79 Ga0070681_10033322 3300005458 Bacteria 5171
80 Ga0070681_10257137 3300005458 Bacteria 1658
81 Ga0068867_100003552 3300005459 Bacteria 10963
82 Ga0070685_10011485 3300005466 Bacteria 4635
83 Ga0070685_10016179 3300005466 Bacteria 3970
84 Ga0070698_100011518 3300005471 Bacteria 9387
85 Ga0070698_100029257 3300005471 Bacteria 5717
86 Ga0070698_100084618 3300005471 Bacteria 3159
87 Ga0070699_100033198 3300005518 Bacteria 4458
88 Ga0070679_100001265 3300005530 Bacteria 22305
89 Ga0070679_100023347 3300005530 Bacteria 6052
90 Ga0070679_100031623 3300005530 Bacteria 5230
91 Ga0070679_100121412 3300005530 Bacteria 2598
92 Ga0070679_100163105 3300005530 Bacteria 2202
93 Ga0070684_100000433 3300005535 Bacteria 28743
94 Ga0070684_100004933 3300005535 Bacteria 10180
95 Ga0070684_100010691 3300005535 Bacteria 7280
96 Ga0070697_100018471 3300005536 Bacteria 5498
97 Ga0068853_100001703 3300005539 Bacteria 16107
98 Ga0068853_100024478 3300005539 Bacteria 5062
99 Ga0068853_100040540 3300005539 Bacteria 3973
100 Ga0068853_100180730 3300005539 Bacteria 1913
101 Ga0070686_100143059 3300005544 Bacteria 1667
102 Ga0070665_100011246 3300005548 Bacteria 9051
103 Ga0068855_100004062 3300005563 Bacteria 17861
104 Ga0068855_100016626 3300005563 Bacteria 8845
105 Ga0068855_100052249 3300005563 Bacteria 4812
106 Ga0068855_100346773 3300005563 Bacteria 1636
107 Ga0070664_100006889 3300005564 Bacteria 9161
108 Ga0070664_100025629 3300005564 Bacteria 4890
109 Ga0070664_100073927 3300005564 Bacteria 2925
110 Ga0068857_100011323 3300005577 Bacteria 7760
111 Ga0068854_100084271 3300005578 Bacteria 2352
112 Ga0068854_100086644 3300005578 Bacteria 2322
113 Ga0068856_100017565 3300005614 Bacteria 6932
114 Ga0068856_100077102 3300005614 Bacteria 3302
115 Ga0068856_100083052 3300005614 Bacteria 3180
116 Ga0068852_100001894 3300005616 Bacteria 14234
117 Ga0068852_100004963 3300005616 Bacteria 9456
118 Ga0068852_100005740 3300005616 Bacteria 8904
119 Ga0068852_100033029 3300005616 Bacteria 4292
120 Ga0068852_100300290 3300005616 Bacteria 1554
121 Ga0068859_100000023 3300005617 Bacteria 221914
122 Ga0068859_100015184 3300005617 Bacteria 7730
123 Ga0068859_100019080 3300005617 Bacteria 6886
124 Ga0068864_100004780 3300005618 Bacteria 11099
125 Ga0068864_100007894 3300005618 Bacteria 8770
126 Ga0068864_100009090 3300005618 Bacteria 8190
127 Ga0068864_100014772 3300005618 Bacteria 6487
128 Ga0068864_100048489 3300005618 Bacteria 3652
129 Ga0068861_100020844 3300005719 Bacteria 4702
130 Ga0068861_100108203 3300005719 Bacteria 2224
131 Ga0068861_100160611 3300005719 Bacteria 1853
132 Ga0068863_100013333 3300005841 Bacteria 7926
133 Ga0068863_100120840 3300005841 Unclassified 2497
134 Ga0068863_100161442 3300005841 Bacteria 2147
135 Ga0068858_100013810 3300005842 Bacteria 7624
136 Ga0068858_100103472 3300005842 Unclassified 2656
137 Ga0068860_100056458 3300005843 Bacteria 3732
138 Ga0068860_100244507 3300005843 Bacteria 1746
139 Ga0068862_100061127 3300005844 Bacteria 3238
140 Ga0068862_100063460 3300005844 Bacteria 3178
141 Ga0068862_100109651 3300005844 Bacteria 2422
142 Ga0081540_1016967 3300005983 Unclassified 4528
143 Ga0081539_10002864 3300005985 Bacteria 22927
144 Ga0081539_10027982 3300005985 Unclassified 3555
145 Ga0070715_10014634 3300006163 Unclassified 2909
146 Ga0075367_10012918 3300006178 Bacteria 4474
147 Ga0075366_10014817 3300006195 Bacteria 4458
148 Ga0097621_100001040 3300006237 Bacteria 19470
149 Ga0097621_100006660 3300006237 Bacteria 8211
150 Ga0097621_100035192 3300006237 Bacteria 4000
151 Ga0068871_100007865 3300006358 Bacteria 7640
152 Ga0068871_100008736 3300006358 Bacteria 7292
153 Ga0068871_100018190 3300006358 Bacteria 5337
154 Ga0068871_100027376 3300006358 Bacteria 4458
155 Ga0068871_100037063 3300006358 Bacteria 3886
156 Ga0068871_100084776 3300006358 Bacteria 2630
157 Ga0075428_100015198 3300006844 Bacteria 8539
158 Ga0075428_100318420 3300006844 Bacteria 1672
159 Ga0075430_100036205 3300006846 Bacteria 4185
160 Ga0075429_100005844 3300006880 Bacteria 10616
161 Ga0075429_100058294 3300006880 Bacteria 3363
162 Ga0068865_100067325 3300006881 Bacteria 2529
163 Ga0068865_100075117 3300006881 Bacteria 2409
164 Ga0068865_100085420 3300006881 Bacteria 2276
165 Ga0097620_100000023 3300006931 Bacteria 221914
166 Ga0097620_100015184 3300006931 Bacteria 7730
167 Ga0097620_100019082 3300006931 Bacteria 6886
168 Ga0099794_10006332 3300007265 Bacteria 4785
169 Ga0105240_10000283 3300009093 Bacteria 99553
170 Ga0105240_10000390 3300009093 Bacteria 82256
171 Ga0105240_10018885 3300009093 Bacteria 9230
172 Ga0105240_10099952 3300009093 Bacteria 3530
173 Ga0105240_10141183 3300009093 Bacteria 2880
174 Ga0111539_10120581 3300009094 Bacteria 3073
175 Ga0105247_10001787 3300009101 Bacteria 15121
176 Ga0105243_10063645 3300009148 Bacteria 2956
177 Ga0105241_10000409 3300009174 Bacteria 32453
178 Ga0105241_10001396 3300009174 Bacteria 18470
179 Ga0105241_10083840 3300009174 Bacteria 2501
180 Ga0105241_10130201 3300009174 Bacteria 2036
181 Ga0105242_10019529 3300009176 Bacteria 5311
182 Ga0105242_10054087 3300009176 Bacteria 3280
183 Ga0105242_10231266 3300009176 Bacteria 1657
184 Ga0105237_10003688 3300009545 Bacteria 18053
185 Ga0105237_10030065 3300009545 Bacteria 5518
186 Ga0105237_10095659 3300009545 Bacteria 2960
187 Ga0105237_10307377 3300009545 Bacteria 1588
188 Ga0105238_10008637 3300009551 Bacteria 10194
189 Ga0105249_10001211 3300009553 Bacteria 22772
190 Ga0105249_10007479 3300009553 Bacteria 9529
191 Ga0105249_10008699 3300009553 Bacteria 8849
192 Ga0105249_10009806 3300009553 Bacteria 8393
193 Ga0105249_10012755 3300009553 Bacteria 7408
194 Ga0105249_10013556 3300009553 Bacteria 7200
195 Ga0105249_10030935 3300009553 Bacteria 4839
196 Ga0105249_10053900 3300009553 Bacteria 3676
197 Ga0105239_10000184 3300010375 Bacteria 91348
198 Ga0105239_10060135 3300010375 Bacteria 4169
199 Ga0105239_10070500 3300010375 Bacteria 3840
200 Ga0105239_10092949 3300010375 Bacteria 3330
201 Ga0105239_10182435 3300010375 Bacteria 2348
202 Ga0157373_10000350 3300013100 Bacteria 37264
203 Ga0157373_10002372 3300013100 Bacteria 14308
204 Ga0157371_10001497 3300013102 Bacteria 24172
205 Ga0157371_10002643 3300013102 Bacteria 16991
206 Ga0157371_10003906 3300013102 Bacteria 13268
207 Ga0157371_10004594 3300013102 Bacteria 11988
208 Ga0157371_10007068 3300013102 Bacteria 9132
209 Ga0157371_10008419 3300013102 Bacteria 8215
210 Ga0157371_10012637 3300013102 Bacteria 6443
211 Ga0157371_10018133 3300013102 Bacteria 5211
212 Ga0157371_10057765 3300013102 Bacteria 2752
213 Ga0157371_10067778 3300013102 Unclassified 2526
214 Ga0157370_10000839 3300013104 Bacteria 39014
215 Ga0157370_10004162 3300013104 Bacteria 16742
216 Ga0157370_10012033 3300013104 Bacteria 9009
217 Ga0157370_10023019 3300013104 Bacteria 6192
218 Ga0157370_10062692 3300013104 Bacteria 3525
219 Ga0157370_10087093 3300013104 Bacteria 2934
220 Ga0157370_10119709 3300013104 Bacteria 2458
221 Ga0157370_10136300 3300013104 Bacteria 2288
222 Ga0157369_10007843 3300013105 Bacteria 12282
223 Ga0157369_10033474 3300013105 Bacteria 5647
224 Ga0157369_10071888 3300013105 Bacteria 3713
225 Ga0157374_10008934 3300013296 Bacteria 8585
226 Ga0157374_10008935 3300013296 Bacteria 8585
227 Ga0157374_10016485 3300013296 Bacteria 6497
228 Ga0157374_10134602 3300013296 Bacteria 2395
229 Ga0157374_10152079 3300013296 Bacteria 2250
230 Ga0157374_10349969 3300013296 Bacteria 1468
231 Ga0157378_10001602 3300013297 Bacteria 20452
232 Ga0157378_10008492 3300013297 Bacteria 8946
233 Ga0157378_10037390 3300013297 Bacteria 4299
234 Ga0157378_10073004 3300013297 Bacteria 3084
235 Ga0157378_10193193 3300013297 Bacteria 1921
236 Ga0157378_10212930 3300013297 Bacteria 1833
237 Ga0163162_10000705 3300013306 Bacteria 30921
238 Ga0163162_10001117 3300013306 Bacteria 24935
239 Ga0163162_10009987 3300013306 Bacteria 9231
240 Ga0163162_10011005 3300013306 Bacteria 8810
241 Ga0163162_10024996 3300013306 Bacteria 5900
242 Ga0163162_10162881 3300013306 Bacteria 2353
243 Ga0163162_10185254 3300013306 Bacteria 2209
244 Ga0157372_10002887 3300013307 Bacteria 18572
245 Ga0157372_10008365 3300013307 Bacteria 10999
246 Ga0157372_10024406 3300013307 Bacteria 6567
247 Ga0157372_10034569 3300013307 Bacteria 5557
248 Ga0157372_10039913 3300013307 Bacteria 5183
249 Ga0157372_10041668 3300013307 Bacteria 5076
250 Ga0157372_10054732 3300013307 Bacteria 4453
251 Ga0157372_10081510 3300013307 Bacteria 3662
252 Ga0157372_10191202 3300013307 Unclassified 2371
253 Ga0157372_10346872 3300013307 Bacteria 1730
254 Ga0157375_10007105 3300013308 Bacteria 9779
255 Ga0157375_10010656 3300013308 Bacteria 8095
256 Ga0157375_10086371 3300013308 Unclassified 3188
257 Ga0157375_10157660 3300013308 Bacteria 2410
258 Ga0157375_10176067 3300013308 Bacteria 2289
259 Ga0157375_10262465 3300013308 Unclassified 1889
260 Ga0163163_10000198 3300014325 Bacteria 62120
261 Ga0163163_10000557 3300014325 Bacteria 32741
262 Ga0163163_10026596 3300014325 Bacteria 5534
263 Ga0163163_10091728 3300014325 Bacteria 3053
264 Ga0163163_10106051 3300014325 Bacteria 2836
265 Ga0163163_10164040 3300014325 Bacteria 2268
266 Ga0157377_10053067 3300014745 Bacteria 2291
267 Ga0157377_10063330 3300014745 Bacteria 2118
268 Ga0157379_10051444 3300014968 Bacteria 3680
269 Ga0157379_10076667 3300014968 Bacteria 2994
270 Ga0157379_10080203 3300014968 Bacteria 2923
271 Ga0157379_10112234 3300014968 Bacteria 2449
272 Ga0157379_10174549 3300014968 Bacteria 1940
273 Ga0157379_10206863 3300014968 Bacteria 1776
274 Ga0157376_10066557 3300014969 Unclassified 3046
275 Ga0157376_10077425 3300014969 Bacteria 2845
276 Ga0157376_10082958 3300014969 Bacteria 2756
277 Ga0157376_10132271 3300014969 Bacteria 2228
278 Ga0182005_1000109 3300015265 Bacteria 59696
279 Ga0163161_10000189 3300017792 Bacteria 56683
280 Ga0163161_10013189 3300017792 Bacteria 5744
281 Ga0163161_10026859 3300017792 Bacteria 4081
282 Ga0213876_10014288 3300021384 Bacteria 4209
283 Ga0213876_10015759 3300021384 Bacteria 4001
284 Ga0209436_100626 3300025208 Bacteria 15103
285 Ga0209258_100378 3300025242 Bacteria 57308
286 Ga0209148_1000391 3300025254 Bacteria 51783
287 Ga0207426_1007502 3300025302 Bacteria 4553
288 Ga0209257_1000001 3300025304 Bacteria 2274655
289 Ga0207682_10029421 3300025893 Bacteria 2196
290 Ga0207710_10009235 3300025900 Bacteria 4146
291 Ga0207680_10000834 3300025903 Bacteria 14542
292 Ga0207680_10042985 3300025903 Bacteria 2647
293 Ga0207647_10001371 3300025904 Bacteria 18715
294 Ga0207647_10009967 3300025904 Bacteria 6730
295 Ga0207647_10016593 3300025904 Bacteria 5022
296 Ga0207685_10012112 3300025905 Bacteria 2620
297 Ga0207645_10010374 3300025907 Bacteria 6396
298 Ga0207645_10011044 3300025907 Bacteria 6181
299 Ga0207643_10038872 3300025908 Bacteria 2675
300 Ga0207705_10005162 3300025909 Bacteria 9789
301 Ga0207705_10017399 3300025909 Bacteria 5148
302 Ga0207705_10063880 3300025909 Bacteria 2660
303 Ga0207705_10082967 3300025909 Unclassified 2338
304 Ga0207705_10091242 3300025909 Unclassified 2231
305 Ga0207654_10000685 3300025911 Bacteria 18960
306 Ga0207654_10007011 3300025911 Bacteria 5676
307 Ga0207707_10015678 3300025912 Bacteria 6603
308 Ga0207707_10015774 3300025912 Bacteria 6586
309 Ga0207707_10118863 3300025912 Bacteria 2310
310 Ga0207695_10000020 3300025913 Bacteria 723025
311 Ga0207695_10003728 3300025913 Bacteria 21215
312 Ga0207695_10023032 3300025913 Bacteria 7051
313 Ga0207695_10068921 3300025913 Bacteria 3622
314 Ga0207695_10076614 3300025913 Bacteria 3399
315 Ga0207671_10000025 3300025914 Bacteria 271617
316 Ga0207671_10001126 3300025914 Bacteria 32182
317 Ga0207671_10007029 3300025914 Bacteria 9862
318 Ga0207671_10039959 3300025914 Bacteria 3473
319 Ga0207671_10093699 3300025914 Bacteria 2265
320 Ga0207660_10004753 3300025917 Bacteria 8844
321 Ga0207660_10095889 3300025917 Bacteria 2207
322 Ga0207662_10091740 3300025918 Bacteria 1869
323 Ga0207657_10004855 3300025919 Bacteria 14159
324 Ga0207657_10011713 3300025919 Bacteria 8689
325 Ga0207657_10089855 3300025919 Bacteria 2564
326 Ga0207657_10120429 3300025919 Bacteria 2159
327 Ga0207649_10002116 3300025920 Bacteria 11250
328 Ga0207649_10073520 3300025920 Unclassified 2190
329 Ga0207652_10000011 3300025921 Bacteria 246742
330 Ga0207652_10001308 3300025921 Bacteria 22126
331 Ga0207652_10003341 3300025921 Bacteria 13262
332 Ga0207681_10094932 3300025923 Bacteria 2138
333 Ga0207650_10003727 3300025925 Bacteria 10424
334 Ga0207659_10011219 3300025926 Bacteria 5656
335 Ga0207664_10000048 3300025929 Bacteria 138515
336 Ga0207706_10001784 3300025933 Bacteria 21146
337 Ga0207706_10002489 3300025933 Bacteria 17951
338 Ga0207706_10007739 3300025933 Bacteria 9918
339 Ga0207706_10077167 3300025933 Bacteria 2930
340 Ga0207686_10000715 3300025934 Bacteria 20597
341 Ga0207686_10033261 3300025934 Bacteria 3076
342 Ga0207670_10006016 3300025936 Bacteria 6705
343 Ga0207691_10085710 3300025940 Bacteria 2827
344 Ga0207689_10001497 3300025942 Bacteria 22310
345 Ga0207689_10002441 3300025942 Bacteria 17314
346 Ga0207689_10053082 3300025942 Bacteria 3339
347 Ga0207689_10053580 3300025942 Unclassified 3324
348 Ga0207689_10058662 3300025942 Bacteria 3165
349 Ga0207661_10003258 3300025944 Bacteria 11254
350 Ga0207661_10010722 3300025944 Bacteria 6605
351 Ga0207661_10018303 3300025944 Bacteria 5204
352 Ga0207661_10023950 3300025944 Bacteria 4619
353 Ga0207679_10000915 3300025945 Bacteria 18846
354 Ga0207679_10007237 3300025945 Bacteria 7035
355 Ga0207679_10097647 3300025945 Bacteria 2289
356 Ga0207679_10164514 3300025945 Bacteria 1820
357 Ga0207667_10000222 3300025949 Bacteria 79873
358 Ga0207667_10053470 3300025949 Bacteria 4249
359 Ga0207667_10093867 3300025949 Bacteria 3098
360 Ga0207667_10133916 3300025949 Bacteria 2552
361 Ga0207667_10218890 3300025949 Bacteria 1951
362 Ga0207651_10065340 3300025960 Bacteria 2551
363 Ga0207651_10067053 3300025960 Bacteria 2524
364 Ga0207651_10107050 3300025960 Bacteria 2089
365 Ga0207651_10178936 3300025960 Unclassified 1680
366 Ga0207712_10001188 3300025961 Bacteria 17998
367 Ga0207712_10003348 3300025961 Bacteria 10149
368 Ga0207712_10012872 3300025961 Bacteria 5352
369 Ga0207712_10033185 3300025961 Bacteria 3488
370 Ga0207712_10063540 3300025961 Bacteria 2628
371 Ga0207712_10077614 3300025961 Bacteria 2408
372 Ga0207640_10070234 3300025981 Bacteria 2354
373 Ga0207640_10112472 3300025981 Bacteria 1933
374 Ga0207658_10035215 3300025986 Bacteria 3584
375 Ga0207658_10099259 3300025986 Bacteria 2277
376 Ga0207677_10040572 3300026023 Bacteria 3070
377 Ga0207677_10120049 3300026023 Bacteria 1975
378 Ga0207677_10227030 3300026023 Bacteria 1501
379 Ga0207703_10017694 3300026035 Bacteria 5564
380 Ga0207639_10015099 3300026041 Bacteria 5441
381 Ga0207639_10017528 3300026041 Bacteria 5078
382 Ga0207639_10089995 3300026041 Bacteria 2454
383 Ga0207639_10197452 3300026041 Bacteria 1723
384 Ga0207639_10239888 3300026041 Bacteria 1575
385 Ga0207678_10005810 3300026067 Bacteria 10998
386 Ga0207678_10161103 3300026067 Bacteria 1916
387 Ga0207702_10065338 3300026078 Bacteria 3116
388 Ga0207702_10073034 3300026078 Bacteria 2957
389 Ga0207641_10000213 3300026088 Bacteria 75051
390 Ga0207641_10002072 3300026088 Bacteria 19005
391 Ga0207641_10046045 3300026088 Bacteria 3676
392 Ga0207641_10095701 3300026088 Bacteria 2607
393 Ga0207648_10002070 3300026089 Bacteria 21873
394 Ga0207648_10015356 3300026089 Bacteria 7045
395 Ga0207676_10006342 3300026095 Bacteria 8354
396 Ga0207676_10007606 3300026095 Bacteria 7693
397 Ga0207676_10031454 3300026095 Bacteria 3992
398 Ga0207676_10058002 3300026095 Bacteria 3052
399 Ga0207676_10079700 3300026095 Bacteria 2656
400 Ga0207676_10092097 3300026095 Bacteria 2492
401 Ga0207676_10126522 3300026095 Bacteria 2165
402 Ga0207674_10003090 3300026116 Bacteria 20578
403 Ga0207674_10043911 3300026116 Bacteria 4607
404 Ga0207674_10284343 3300026116 Bacteria 1602
405 Ga0207675_100015939 3300026118 Bacteria 7011
406 Ga0207675_100034661 3300026118 Bacteria 4708
407 Ga0207675_100069249 3300026118 Bacteria 3298
408 Ga0207683_10028015 3300026121 Bacteria 4870
409 Ga0207683_10120621 3300026121 Bacteria 2354
410 Ga0207698_10013920 3300026142 Bacteria 5327
411 Ga0207698_10034075 3300026142 Bacteria 3708
412 Ga0207698_10035341 3300026142 Unclassified 3655
413 Ga0207698_10117317 3300026142 Bacteria 2245
414 Ga0207698_10245657 3300026142 Bacteria 1634
415 Ga0209974_10017345 3300027876 Bacteria 2388
416 Ga0268266_10019494 3300028379 Bacteria 5779
417 Ga0268266_10050321 3300028379 Bacteria 3575
418 Ga0268266_10168931 3300028379 Bacteria 1984
419 Ga0268265_10156368 3300028380 Bacteria 1930
420 Ga0268265_10203632 3300028380 Bacteria 1719
421 Ga0268264_10004982 3300028381 Bacteria 11244
422 Ga0268264_10026700 3300028381 Bacteria 4718
423 Ga0268264_10047532 3300028381 Bacteria 3568
424 Ga0268264_10074819 3300028381 Bacteria 2878
425 Ga0307515_10000002 3300028794 Bacteria 1231751
426 Ga0307515_10000003 3300028794 Bacteria 891317
427 Ga0307515_10000057 3300028794 Bacteria 261695
428 Ga0265770_1004706 3300030878 Unclassified 1866
429 Ga0265339_10033963 3300031249 Bacteria 2869
430 Ga0265327_10000022 3300031251 Bacteria 402724
431 Ga0265327_10000508 3300031251 Bacteria 67561
432 Ga0265327_10000531 3300031251 Bacteria 65562
433 Ga0265327_10002921 3300031251 Bacteria 17111
434 Ga0265327_10008280 3300031251 Bacteria 7786
435 Ga0265316_10102991 3300031344 Unclassified 2168
436 Ga0307513_10165914 3300031456 Bacteria 2093
437 Ga0307509_10019004 3300031507 Bacteria 7863
438 Ga0307509_10085076 3300031507 Bacteria 3256
439 Ga0307408_100001708 3300031548 Bacteria 16126
440 Ga0307408_100128506 3300031548 Unclassified 1974
441 Ga0265313_10028008 3300031595 Bacteria 2937
442 Ga0307516_10002728 3300031730 Bacteria 23265
443 Ga0307406_10038797 3300031901 Bacteria 2951
444 Ga0373925_0128101 3300037068 Unclassified 1977
445 Ga0395899_0010903 3300037312 Bacteria 6965
446 Ga0395899_0022227 3300037312 Bacteria 4810
447 Ga0395899_0034322 3300037312 Bacteria 3809
448 Ga0395900_0001729 3300037418 Bacteria 25209
449 Ga0395900_0017872 3300037418 Bacteria 7238
450 Ga0395900_0034145 3300037418 Bacteria 5236
451 Ga0395900_0071909 3300037418 Bacteria 3556
452 Ga0395898_0001712 3300037466 Bacteria 29076
453 Ga0395898_0031083 3300037466 Bacteria 5340
454 Ga0395898_0128909 3300037466 Bacteria 2423
455 Ga0395905_0007067 3300037471 Bacteria 11222
456 Ga0395905_0021319 3300037471 Bacteria 6130
457 Ga0395905_0053813 3300037471 Bacteria 3767
458 Ga0395901_0008316 3300038443 Bacteria 10488
459 Ga0395901_0009041 3300038443 Bacteria 10087
460 Ga0395901_0033777 3300038443 Bacteria 5282
461 Ga0395901_0043947 3300038443 Bacteria 4634
462 Ga0395901_0058758 3300038443 Bacteria 4000
463 Ga0436365_0577581 3300039437 Bacteria 30054
464 Ga0436365_0905724 3300039437 Bacteria 1408
465 Ga0436365_1553484 3300039437 Bacteria 10706
466 Ga0451577_0000202 3300042876 Bacteria 124050
467 Ga0451577_0291577 3300042876 Unclassified 1479
468 Ga0466972_0000003 3300044658 Bacteria 391452
469 Ga0466972_0016561 3300044658 Bacteria 3686
470 Ga0466982_0091555 3300044672 Bacteria 1884
471 Ga0453684_0000004 3300044712 Bacteria 1469893
472 Ga0453684_0146283 3300044712 Bacteria 2814
473 Ga0466968_0008949 3300044735 Bacteria 3845
474 Ga0466970_0005150 3300044765 Bacteria 6464
475 Ga0466970_0065640 3300044765 Bacteria 1948
476 Ga0466959_0058878 3300045049 Bacteria 2798
477 Ga0466967_0079540 3300045976 Bacteria 2956
478 Ga0466967_0361760 3300045976 Bacteria 1406
479 Ga0495618_0100987 3300046514 Unclassified 1847
480 Ga0495598_0030983 3300046537 Bacteria 1502
481 Ga0495645_0086927 3300046543 Unclassified 2237
482 Ga0495668_0000367 3300046616 Bacteria 59531
483 Ga0495668_0002380 3300046616 Bacteria 15605
484 Ga0495634_0027616 3300046642 Bacteria 3948
485 Ga0495670_0086465 3300046691 Bacteria 1601
486 Ga0495604_0087105 3300047317 Unclassified 2327
487 Ga0495636_0000037 3300047318 Bacteria 56866
488 Ga0495672_0067722 3300047320 Bacteria 2033
489 Ga0495686_0006810 3300047472 Bacteria 8674
490 Ga0495686_0014544 3300047472 Bacteria 5412
491 Ga0496101_0150373 3300048904 Bacteria 1781
492 Ga0496110_0136356 3300048913 Bacteria 2218
493 Ga0496121_0000054 3300048924 Bacteria 307236
494 Ga0496124_0074226 3300048927 Bacteria 2812
495 Ga0496126_0005325 3300048929 Bacteria 14746
496 Ga0501031_0004536 3300049568 Bacteria 9001
497 Ga0501031_0082837 3300049568 Unclassified 2091
498 Ga0501032_0019989 3300049569 Bacteria 4673
499 Ga0501034_0000002 3300049571 Bacteria 565510
500 Ga0501036_0000630 3300049572 Bacteria 25708
501 Ga0501036_0001356 3300049572 Bacteria 18774
502 Ga0501037_0041256 3300049573 Bacteria 3394
503 Ga0501038_0029224 3300049574 Bacteria 4887
504 Ga0501039_0045873 3300049575 Unclassified 3377
505 Ga0501043_0005661 3300049579 Bacteria 10068
506 Ga0501043_0083719 3300049579 Bacteria 2507
507 Ga0501047_0004450 3300049581 Bacteria 13194
508 Ga0501047_0064657 3300049581 Bacteria 3528
509 Ga0501070_0008454 3300049586 Bacteria 8694
510 Ga0501070_0113866 3300049586 Unclassified 2235
511 Ga0501072_0245875 3300049588 Unclassified 1425
512 Ga0501073_0004829 3300049589 Bacteria 10114
513 Ga0501074_0010705 3300049590 Bacteria 6660
514 Ga0501247_000069 3300049677 Bacteria 5677
515 Ga0501251_002312 3300049681 Bacteria 1839
516 Ga0501080_0015066 3300049742 Bacteria 7125
517 Ga0501081_0015376 3300049743 Bacteria 5049
518 Ga0501083_0047809 3300049744 Unclassified 2889
519 Ga0501269_002671 3300049766 Bacteria 2178
520 Ga0501035_0023263 3300049822 Bacteria 5683
521 Ga0501035_0029077 3300049822 Bacteria 5040
522 Ga0501035_0083413 3300049822 Bacteria 2820
523 Ga0501044_0015980 3300049823 Bacteria 8076
524 Ga0501044_0018446 3300049823 Bacteria 7476
525 Ga0501044_0039768 3300049823 Bacteria 4904
526 nmdc:mga0k408_27056_c1 3300050493 Unclassified 3255
527 nmdc:mga0k408_44427_c1 3300050493 Bacteria 2562
528 nmdc:mga09592_16021_c1 3300050508 Bacteria 6126
529 nmdc:mga09592_4462_c1 3300050508 Bacteria 11320
530 nmdc:mga0qj67_39163_c1 3300050509 Bacteria 3721
531 nmdc:mga08y16_171971_c1 3300050511 Bacteria 2250
532 Ga0495619_0027624 3300053085 Unclassified 3657
533 Ga0500644_0000048 3300053088 Bacteria 73311
534 Ga0500581_076207 3300053089 Bacteria 1682
535 Ga0500562_000029 3300053108 Bacteria 94705
536 Ga0500569_002995 3300053109 Unclassified 3394
537 Ga0500642_0009154 3300053130 Unclassified 3422
538 Ga0500658_0010954 3300053134 Bacteria 3343
539 Ga0500568_0003381 3300053139 Bacteria 8919
540 Ga0500604_0002867 3300053151 Unclassified 4675
541 Ga0500616_0004167 3300053153 Bacteria 10435
542 Ga0500622_0000015 3300053156 Bacteria 346227
543 Ga0500622_0000022 3300053156 Bacteria 267246
544 Ga0500622_0000193 3300053156 Bacteria 64805
545 Ga0500622_0001004 3300053156 Bacteria 23799
546 Ga0500611_000069 3300053727 Bacteria 41999
547 Ga0500645_036197 3300053730 Bacteria 1469
548 Ga0501084_0114609 3300054114 Unclassified 2266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049766 Ga0501269_002671 Ga0501269_002671_12_1082 330
2 3300005536 Ga0070697_100018471 Ga0070697_1000184712 362
3 3300005518 Ga0070699_100033198 Ga0070699_1000331983 363
4 3300007265 Ga0099794_10006332 Ga0099794_100063322 363
5 3300049677 Ga0501247_000069 Ga0501247_000069_4357_5640 375
6 3300010375 Ga0105239_10000184 Ga0105239_1000018433 376
7 3300013102 Ga0157371_10004594 Ga0157371_100045942 381
8 3300013307 Ga0157372_10008365 Ga0157372_100083655 381
9 3300039437 Ga0436365_0905724 Ga0436365_0905724_169_1380 382
10 3300042876 Ga0451577_0291577 Ga0451577_0291577_64_1368 382
11 3300048904 Ga0496101_0150373 Ga0496101_0150373_545_1756 382
12 3300025914 Ga0207671_10039959 Ga0207671_100399592 385
13 3300013297 Ga0157378_10212930 Ga0157378_102129302 386
14 3300031344 Ga0265316_10102991 Ga0265316_101029912 386
15 3300009553 Ga0105249_10008699 Ga0105249_100086992 387
16 3300013296 Ga0157374_10016485 Ga0157374_100164854 387
17 3300013306 Ga0163162_10011005 Ga0163162_100110056 387
18 3300013308 Ga0157375_10157660 Ga0157375_101576602 387
19 3300014968 Ga0157379_10051444 Ga0157379_100514442 387
20 3300028379 Ga0268266_10168931 Ga0268266_101689312 387
21 3300048913 Ga0496110_0136356 Ga0496110_0136356_40_1302 387
22 3300049822 Ga0501035_0029077 Ga0501035_0029077_1289_2632 387
23 3300009093 Ga0105240_10018885 Ga0105240_100188853 388
24 3300025913 Ga0207695_10076614 Ga0207695_100766142 388
25 3300003322 rootL2_10065261 rootL2_100652618 391
26 3300003320 rootH2_10114781 rootH2_101147812 392
27 3300048927 Ga0496124_0074226 Ga0496124_0074226_1007_2308 392
28 3300005339 Ga0070660_100190825 Ga0070660_1001908252 393
29 3300014325 Ga0163163_10106051 Ga0163163_101060513 393
30 3300026023 Ga0207677_10120049 Ga0207677_101200492 393
31 3300005578 Ga0068854_100086644 Ga0068854_1000866442 394
32 3300025914 Ga0207671_10000025 Ga0207671_1000002536 394
33 3300031251 Ga0265327_10008280 Ga0265327_100082806 394
34 3300009553 Ga0105249_10030935 Ga0105249_100309351 395
35 3300026067 Ga0207678_10161103 Ga0207678_101611032 395
36 3300005539 Ga0068853_100024478 Ga0068853_1000244784 397
37 3300005539 Ga0068853_100180730 Ga0068853_1001807302 397
38 3300026041 Ga0207639_10017528 Ga0207639_100175285 397
39 3300009093 Ga0105240_10000390 Ga0105240_1000039035 398
40 3300017792 Ga0163161_10000189 Ga0163161_1000018943 398
41 3300025913 Ga0207695_10000020 Ga0207695_1000002096 398
42 3300003323 rootH1_10256724 rootH1_102567243 399
43 3300013297 Ga0157378_10037390 Ga0157378_100373904 399
44 3300053156 Ga0500622_0000193 Ga0500622_0000193_26841_28109 399
45 3300005327 Ga0070658_10074535 Ga0070658_100745353 400
46 3300005329 Ga0070683_100046675 Ga0070683_1000466752 400
47 3300005336 Ga0070680_100032104 Ga0070680_1000321046 400
48 3300005458 Ga0070681_10033322 Ga0070681_100333225 400
49 3300005530 Ga0070679_100031623 Ga0070679_1000316236 400
50 3300005563 Ga0068855_100016626 Ga0068855_1000166266 400
51 3300010375 Ga0105239_10092949 Ga0105239_100929495 400
52 3300013102 Ga0157371_10018133 Ga0157371_100181332 400
53 3300013104 Ga0157370_10087093 Ga0157370_100870932 400
54 3300013306 Ga0163162_10000705 Ga0163162_1000070520 400
55 3300013307 Ga0157372_10034569 Ga0157372_100345693 400
56 3300014968 Ga0157379_10112234 Ga0157379_101122342 400
57 3300025909 Ga0207705_10005162 Ga0207705_1000516211 400
58 3300025912 Ga0207707_10015678 Ga0207707_100156782 400
59 3300025917 Ga0207660_10004753 Ga0207660_100047536 400
60 3300025921 Ga0207652_10001308 Ga0207652_100013086 400
61 3300025921 Ga0207652_10003341 Ga0207652_100033419 400
62 3300025944 Ga0207661_10023950 Ga0207661_100239502 400
63 3300025949 Ga0207667_10000222 Ga0207667_1000022274 400
64 3300026067 Ga0207678_10005810 Ga0207678_100058108 400
65 3300031548 Ga0307408_100128506 Ga0307408_1001285061 400
66 3300037312 Ga0395899_0022227 Ga0395899_0022227_2541_3869 400
67 3300037418 Ga0395900_0071909 Ga0395900_0071909_1422_2750 400
68 3300037466 Ga0395898_0031083 Ga0395898_0031083_3251_4579 400
69 3300038443 Ga0395901_0033777 Ga0395901_0033777_1168_2496 400
70 3300049568 Ga0501031_0004536 Ga0501031_0004536_1673_3004 400
71 3300049569 Ga0501032_0019989 Ga0501032_0019989_347_1678 400
72 3300049572 Ga0501036_0001356 Ga0501036_0001356_8322_9653 400
73 3300049573 Ga0501037_0041256 Ga0501037_0041256_1023_2354 400
74 3300049574 Ga0501038_0029224 Ga0501038_0029224_3065_4396 400
75 3300049579 Ga0501043_0005661 Ga0501043_0005661_7137_8468 400
76 3300049823 Ga0501044_0039768 Ga0501044_0039768_344_1675 400
77 3300009176 Ga0105242_10231266 Ga0105242_102312661 401
78 3300013307 Ga0157372_10054732 Ga0157372_100547323 401
79 3300025904 Ga0207647_10009967 Ga0207647_100099678 401
80 3300025909 Ga0207705_10017399 Ga0207705_100173993 401
81 3300037312 Ga0395899_0034322 Ga0395899_0034322_2508_3788 401
82 3300037418 Ga0395900_0017872 Ga0395900_0017872_590_1921 401
83 3300037466 Ga0395898_0128909 Ga0395898_0128909_800_2131 401
84 3300038443 Ga0395901_0058758 Ga0395901_0058758_257_1588 401
85 3300049822 Ga0501035_0083413 Ga0501035_0083413_1120_2451 401
86 3300005335 Ga0070666_10002958 Ga0070666_100029589 402
87 3300005354 Ga0070675_100087564 Ga0070675_1000875642 402
88 3300005355 Ga0070671_100105816 Ga0070671_1001058162 402
89 3300005456 Ga0070678_100022194 Ga0070678_1000221942 402
90 3300005457 Ga0070662_100002459 Ga0070662_1000024596 402
91 3300005544 Ga0070686_100143059 Ga0070686_1001430592 402
92 3300005841 Ga0068863_100120840 Ga0068863_1001208402 402
93 3300006163 Ga0070715_10014634 Ga0070715_100146342 402
94 3300006358 Ga0068871_100027376 Ga0068871_1000273763 402
95 3300017792 Ga0163161_10013189 Ga0163161_100131893 402
96 3300025905 Ga0207685_10012112 Ga0207685_100121122 402
97 3300025933 Ga0207706_10002489 Ga0207706_100024899 402
98 3300025934 Ga0207686_10033261 Ga0207686_100332612 402
99 3300026088 Ga0207641_10095701 Ga0207641_100957013 402
100 3300026121 Ga0207683_10120621 Ga0207683_101206212 402
101 3300031249 Ga0265339_10033963 Ga0265339_100339632 402
102 3300031595 Ga0265313_10028008 Ga0265313_100280082 402
103 3300031730 Ga0307516_10002728 Ga0307516_100027282 402
104 3300005329 Ga0070683_100000417 Ga0070683_10000041727 403
105 3300005329 Ga0070683_100045687 Ga0070683_1000456872 403
106 3300005339 Ga0070660_100006675 Ga0070660_1000066752 403
107 3300005366 Ga0070659_100179132 Ga0070659_1001791321 403
108 3300005535 Ga0070684_100000433 Ga0070684_1000004334 403
109 3300005539 Ga0068853_100001703 Ga0068853_10000170313 403
110 3300005564 Ga0070664_100006889 Ga0070664_1000068895 403
111 3300005577 Ga0068857_100011323 Ga0068857_1000113235 403
112 3300005616 Ga0068852_100033029 Ga0068852_1000330292 403
113 3300005618 Ga0068864_100009090 Ga0068864_1000090905 403
114 3300005842 Ga0068858_100103472 Ga0068858_1001034722 403
115 3300006358 Ga0068871_100084776 Ga0068871_1000847762 403
116 3300013100 Ga0157373_10000350 Ga0157373_1000035011 403
117 3300013102 Ga0157371_10002643 Ga0157371_100026439 403
118 3300013105 Ga0157369_10071888 Ga0157369_100718883 403
119 3300025919 Ga0207657_10089855 Ga0207657_100898552 403
120 3300025920 Ga0207649_10002116 Ga0207649_100021169 403
121 3300025944 Ga0207661_10010722 Ga0207661_100107224 403
122 3300025945 Ga0207679_10000915 Ga0207679_100009154 403
123 3300025961 Ga0207712_10063540 Ga0207712_100635402 403
124 3300026041 Ga0207639_10015099 Ga0207639_100150994 403
125 3300026095 Ga0207676_10007606 Ga0207676_100076064 403
126 3300026116 Ga0207674_10003090 Ga0207674_100030904 403
127 3300026142 Ga0207698_10013920 Ga0207698_100139204 403
128 3300037418 Ga0395900_0034145 Ga0395900_0034145_644_1975 403
129 3300006178 Ga0075367_10012918 Ga0075367_100129182 404
130 3300013102 Ga0157371_10003906 Ga0157371_100039066 404
131 3300013104 Ga0157370_10023019 Ga0157370_100230192 404
132 3300046537 Ga0495598_0030983 Ga0495598_0030983_212_1474 404
133 3300050493 nmdc:mga0k408_27056_c1 nmdc:mga0k408_27056_c1_718_1983 404
134 3300005353 Ga0070669_100096607 Ga0070669_1000966072 405
135 3300005841 Ga0068863_100161442 Ga0068863_1001614422 405
136 3300005843 Ga0068860_100244507 Ga0068860_1002445072 405
137 3300005844 Ga0068862_100063460 Ga0068862_1000634603 405
138 3300005985 Ga0081539_10027982 Ga0081539_100279822 405
139 3300006881 Ga0068865_100085420 Ga0068865_1000854201 405
140 3300009174 Ga0105241_10083840 Ga0105241_100838402 405
141 3300009176 Ga0105242_10054087 Ga0105242_100540874 405
142 3300009553 Ga0105249_10001211 Ga0105249_1000121115 405
143 3300009553 Ga0105249_10013556 Ga0105249_100135561 405
144 3300009553 Ga0105249_10053900 Ga0105249_100539002 405
145 3300010375 Ga0105239_10070500 Ga0105239_100705003 405
146 3300013296 Ga0157374_10008934 Ga0157374_100089345 405
147 3300013296 Ga0157374_10008935 Ga0157374_100089357 405
148 3300013296 Ga0157374_10349969 Ga0157374_103499692 405
149 3300013297 Ga0157378_10193193 Ga0157378_101931932 405
150 3300013306 Ga0163162_10001117 Ga0163162_100011178 405
151 3300013306 Ga0163162_10024996 Ga0163162_100249964 405
152 3300013306 Ga0163162_10162881 Ga0163162_101628812 405
153 3300013308 Ga0157375_10007105 Ga0157375_100071056 405
154 3300013308 Ga0157375_10010656 Ga0157375_100106561 405
155 3300013308 Ga0157375_10176067 Ga0157375_101760672 405
156 3300014325 Ga0163163_10000198 Ga0163163_1000019834 405
157 3300014325 Ga0163163_10091728 Ga0163163_100917283 405
158 3300014745 Ga0157377_10063330 Ga0157377_100633302 405
159 3300014968 Ga0157379_10206863 Ga0157379_102068632 405
160 3300014969 Ga0157376_10077425 Ga0157376_100774252 405
161 3300025940 Ga0207691_10085710 Ga0207691_100857104 405
162 3300025986 Ga0207658_10099259 Ga0207658_100992592 405
163 3300026023 Ga0207677_10227030 Ga0207677_102270301 405
164 3300037068 Ga0373925_0128101 Ga0373925_0128101_145_1407 405
165 3300046514 Ga0495618_0100987 Ga0495618_0100987_379_1641 405
166 3300046543 Ga0495645_0086927 Ga0495645_0086927_343_1605 405
167 3300046642 Ga0495634_0027616 Ga0495634_0027616_325_1587 405
168 3300047317 Ga0495604_0087105 Ga0495604_0087105_55_1317 405
169 3300049568 Ga0501031_0082837 Ga0501031_0082837_48_1319 405
170 3300049572 Ga0501036_0000630 Ga0501036_0000630_10307_11578 405
171 3300049575 Ga0501039_0045873 Ga0501039_0045873_784_2055 405
172 3300049579 Ga0501043_0083719 Ga0501043_0083719_1123_2394 405
173 3300049581 Ga0501047_0004450 Ga0501047_0004450_8084_9355 405
174 3300049586 Ga0501070_0008454 Ga0501070_0008454_6605_7876 405
175 3300049588 Ga0501072_0245875 Ga0501072_0245875_81_1352 405
176 3300049589 Ga0501073_0004829 Ga0501073_0004829_8730_10001 405
177 3300049590 Ga0501074_0010705 Ga0501074_0010705_2028_3299 405
178 3300049742 Ga0501080_0015066 Ga0501080_0015066_5741_7012 405
179 3300049744 Ga0501083_0047809 Ga0501083_0047809_818_2089 405
180 3300049822 Ga0501035_0023263 Ga0501035_0023263_2411_3682 405
181 3300049823 Ga0501044_0018446 Ga0501044_0018446_5723_6994 405
182 3300050493 nmdc:mga0k408_44427_c1 nmdc:mga0k408_44427_c1_114_1400 405
183 3300053085 Ga0495619_0027624 Ga0495619_0027624_1131_2393 405
184 3300054114 Ga0501084_0114609 Ga0501084_0114609_519_1790 405
185 3300013307 Ga0157372_10039913 Ga0157372_100399134 406
186 3300030878 Ga0265770_1004706 Ga0265770_10047062 406
187 3300003322 rootL2_10004033 rootL2_1000403310 407
188 3300005331 Ga0070670_100033275 Ga0070670_1000332751 407
189 3300009545 Ga0105237_10030065 Ga0105237_100300654 407
190 3300013297 Ga0157378_10001602 Ga0157378_100016023 407
191 3300025960 Ga0207651_10178936 Ga0207651_101789362 407
192 3300003322 rootL2_10226720 rootL2_102267202 408
193 3300005336 Ga0070680_100004033 Ga0070680_1000040332 408
194 3300005563 Ga0068855_100346773 Ga0068855_1003467732 408
195 3300025919 Ga0207657_10004855 Ga0207657_100048555 408
196 3300028794 Ga0307515_10000003 Ga0307515_1000000326 408
197 3300003316 rootH1_10018150 rootH1_100181502 409
198 3300013102 Ga0157371_10067778 Ga0157371_100677782 409
199 3300046616 Ga0495668_0002380 Ga0495668_0002380_10639_11976 409
200 3300053130 Ga0500642_0009154 Ga0500642_0009154_93_1421 409
201 3300003322 rootL2_10075642 rootL2_100756422 410
202 3300005337 Ga0070682_100000190 Ga0070682_10000019022 410
203 3300005614 Ga0068856_100017565 Ga0068856_1000175656 410
204 3300013297 Ga0157378_10008492 Ga0157378_100084923 410
205 3300026078 Ga0207702_10065338 Ga0207702_100653382 410
206 3300005347 Ga0070668_100013224 Ga0070668_1000132245 411
207 3300005366 Ga0070659_100033893 Ga0070659_1000338932 411
208 3300005563 Ga0068855_100004062 Ga0068855_10000406214 411
209 3300005719 Ga0068861_100020844 Ga0068861_1000208442 411
210 3300005844 Ga0068862_100061127 Ga0068862_1000611273 411
211 3300006881 Ga0068865_100075117 Ga0068865_1000751171 411
212 3300013102 Ga0157371_10007068 Ga0157371_100070685 411
213 3300013104 Ga0157370_10012033 Ga0157370_100120334 411
214 3300013307 Ga0157372_10041668 Ga0157372_100416682 411
215 3300013307 Ga0157372_10081510 Ga0157372_100815103 411
216 3300025942 Ga0207689_10053082 Ga0207689_100530822 411
217 3300025949 Ga0207667_10093867 Ga0207667_100938674 411
218 3300026118 Ga0207675_100034661 Ga0207675_1000346614 411
219 3300028380 Ga0268265_10203632 Ga0268265_102036321 411
220 3300038443 Ga0395901_0008316 Ga0395901_0008316_7097_8428 411
221 3300005337 Ga0070682_100018940 Ga0070682_1000189404 412
222 3300005353 Ga0070669_100023893 Ga0070669_1000238933 412
223 3300005530 Ga0070679_100163105 Ga0070679_1001631052 412
224 3300005616 Ga0068852_100004963 Ga0068852_1000049638 412
225 3300006881 Ga0068865_100067325 Ga0068865_1000673251 412
226 3300013104 Ga0157370_10136300 Ga0157370_101363002 412
227 3300013307 Ga0157372_10024406 Ga0157372_100244065 412
228 3300025907 Ga0207645_10010374 Ga0207645_100103741 412
229 3300025909 Ga0207705_10063880 Ga0207705_100638802 412
230 3300025919 Ga0207657_10120429 Ga0207657_101204291 412
231 3300025942 Ga0207689_10002441 Ga0207689_1000244113 412
232 3300025981 Ga0207640_10112472 Ga0207640_101124722 412
233 3300026089 Ga0207648_10015356 Ga0207648_100153564 412
234 3300026095 Ga0207676_10058002 Ga0207676_100580022 412
235 3300026121 Ga0207683_10028015 Ga0207683_100280154 412
236 3300026142 Ga0207698_10245657 Ga0207698_102456572 412
237 3300028381 Ga0268264_10026700 Ga0268264_100267004 412
238 3300028381 Ga0268264_10074819 Ga0268264_100748192 412
239 3300049581 Ga0501047_0064657 Ga0501047_0064657_1702_3192 413
240 3300003322 rootL2_10194414 rootL2_101944142 414
241 3300003323 rootH1_10251219 rootH1_102512192 414
242 3300009094 Ga0111539_10120581 Ga0111539_101205813 414
243 3300025961 Ga0207712_10033185 Ga0207712_100331853 414
244 3300026088 Ga0207641_10000213 Ga0207641_1000021362 414
245 3300050511 nmdc:mga08y16_171971_c1 nmdc:mga08y16_171971_c1_384_1739 414
246 3300003322 rootL2_10132181 rootL2_101321813 415
247 3300003323 rootH1_10015492 rootH1_1001549247 415
248 3300014325 Ga0163163_10164040 Ga0163163_101640401 415
249 3300047472 Ga0495686_0006810 Ga0495686_0006810_7338_8657 415
250 3300049681 Ga0501251_002312 Ga0501251_002312_125_1453 415
251 3300053153 Ga0500616_0004167 Ga0500616_0004167_6700_8037 415
252 3300003316 rootH1_10052371 rootH1_1005237120 416
253 3300003323 rootH1_10098526 rootH1_100985264 416
254 3300005548 Ga0070665_100011246 Ga0070665_1000112465 416
255 3300009545 Ga0105237_10003688 Ga0105237_100036889 416
256 3300013307 Ga0157372_10002887 Ga0157372_100028879 416
257 3300028379 Ga0268266_10019494 Ga0268266_100194943 416
258 iso_pu_bacteria 2818991442 2819574187 416
259 iso_pu_bacteria 2818991444 2819588655 416
260 iso_pu_bacteria 2821136567 2821137499 416
261 iso_pu_bacteria 2852623160 2852625544 416
262 iso_pu_bacteria 2884933994 2884934549 416
263 iso_pu_bacteria 2904467357 2904467760 416
264 iso_pu_bacteria 2914759650 2914762787 416
265 iso_pu_bacteria 2929154850 2929157664 416
266 iso_pu_bacteria 2977232053 2977233084 416
267 3300005618 Ga0068864_100048489 Ga0068864_1000484892 417
268 3300005841 Ga0068863_100013333 Ga0068863_1000133333 417
269 3300006237 Ga0097621_100035192 Ga0097621_1000351923 417
270 3300006358 Ga0068871_100037063 Ga0068871_1000370634 417
271 3300006844 Ga0075428_100318420 Ga0075428_1003184202 417
272 3300013308 Ga0157375_10086371 Ga0157375_100863712 417
273 3300014969 Ga0157376_10066557 Ga0157376_100665572 417
274 3300025934 Ga0207686_10000715 Ga0207686_1000071515 417
275 3300026088 Ga0207641_10046045 Ga0207641_100460452 417
276 3300026095 Ga0207676_10079700 Ga0207676_100797002 417
277 3300026095 Ga0207676_10126522 Ga0207676_101265222 417
278 3300031251 Ga0265327_10000022 Ga0265327_10000022133 417
279 3300038443 Ga0395901_0043947 Ga0395901_0043947_2534_3889 417
280 3300044765 Ga0466970_0065640 Ga0466970_0065640_94_1431 417
281 3300003316 rootH1_10117803 rootH1_101178032 418
282 3300003323 rootH1_10119581 rootH1_101195814 418
283 3300005327 Ga0070658_10086763 Ga0070658_100867633 418
284 3300005458 Ga0070681_10257137 Ga0070681_102571372 418
285 3300005530 Ga0070679_100001265 Ga0070679_10000126511 418
286 3300005563 Ga0068855_100052249 Ga0068855_1000522495 418
287 3300005616 Ga0068852_100300290 Ga0068852_1003002901 418
288 3300009093 Ga0105240_10000283 Ga0105240_1000028314 418
289 3300009093 Ga0105240_10141183 Ga0105240_101411833 418
290 3300009174 Ga0105241_10000409 Ga0105241_1000040928 418
291 3300009551 Ga0105238_10008637 Ga0105238_100086373 418
292 3300010375 Ga0105239_10060135 Ga0105239_100601352 418
293 3300013102 Ga0157371_10001497 Ga0157371_1000149723 418
294 3300013104 Ga0157370_10004162 Ga0157370_1000416214 418
295 3300025903 Ga0207680_10042985 Ga0207680_100429852 418
296 3300025911 Ga0207654_10007011 Ga0207654_100070112 418
297 3300025912 Ga0207707_10015774 Ga0207707_100157746 418
298 3300025912 Ga0207707_10118863 Ga0207707_101188631 418
299 3300025913 Ga0207695_10003728 Ga0207695_1000372810 418
300 3300025913 Ga0207695_10068921 Ga0207695_100689213 418
301 3300025914 Ga0207671_10001126 Ga0207671_1000112616 418
302 3300025921 Ga0207652_10000011 Ga0207652_10000011162 418
303 3300025949 Ga0207667_10218890 Ga0207667_102188902 418
304 3300026041 Ga0207639_10089995 Ga0207639_100899952 418
305 3300031507 Ga0307509_10019004 Ga0307509_100190043 418
306 3300031507 Ga0307509_10085076 Ga0307509_100850762 418
307 3300037312 Ga0395899_0010903 Ga0395899_0010903_3252_4583 418
308 3300037418 Ga0395900_0001729 Ga0395900_0001729_2106_3437 418
309 3300037466 Ga0395898_0001712 Ga0395898_0001712_23842_25173 418
310 3300038443 Ga0395901_0009041 Ga0395901_0009041_6154_7485 418
311 3300042876 Ga0451577_0000202 Ga0451577_0000202_122688_124040 418
312 3300044658 Ga0466972_0016561 Ga0466972_0016561_832_2142 418
313 3300044712 Ga0453684_0000004 Ga0453684_0000004_311561_312913 418
314 3300044735 Ga0466968_0008949 Ga0466968_0008949_635_1945 418
315 3300049743 Ga0501081_0015376 Ga0501081_0015376_2785_4152 418
316 3300053089 Ga0500581_076207 Ga0500581_076207_204_1556 418
317 3300053151 Ga0500604_0002867 Ga0500604_0002867_2898_4226 418
318 3300053156 Ga0500622_0000015 Ga0500622_0000015_172496_173824 418
319 3300053156 Ga0500622_0000022 Ga0500622_0000022_77058_78386 418
320 iso_pu_bacteria 2929239360 2929242218 418
321 3300003323 rootH1_10041902 rootH1_100419025 419
322 3300005262 Ga0065165_1001983 Ga0065165_10019832 419
323 3300005435 Ga0070714_100000093 Ga0070714_10000009345 419
324 3300005441 Ga0070700_100125917 Ga0070700_1001259171 419
325 3300005471 Ga0070698_100011518 Ga0070698_1000115183 419
326 3300005471 Ga0070698_100029257 Ga0070698_1000292572 419
327 3300005471 Ga0070698_100084618 Ga0070698_1000846182 419
328 3300006237 Ga0097621_100001040 Ga0097621_10000104012 419
329 3300006358 Ga0068871_100007865 Ga0068871_1000078652 419
330 3300006880 Ga0075429_100058294 Ga0075429_1000582942 419
331 3300009093 Ga0105240_10099952 Ga0105240_100999522 419
332 3300009174 Ga0105241_10130201 Ga0105241_101302012 419
333 3300009553 Ga0105249_10007479 Ga0105249_100074793 419
334 3300013102 Ga0157371_10012637 Ga0157371_100126376 419
335 3300013104 Ga0157370_10119709 Ga0157370_101197093 419
336 3300013297 Ga0157378_10073004 Ga0157378_100730043 419
337 3300014969 Ga0157376_10132271 Ga0157376_101322712 419
338 3300025929 Ga0207664_10000048 Ga0207664_1000004899 419
339 3300025961 Ga0207712_10001188 Ga0207712_100011887 419
340 3300031251 Ga0265327_10000508 Ga0265327_1000050821 419
341 3300031251 Ga0265327_10000531 Ga0265327_1000053121 419
342 3300031251 Ga0265327_10002921 Ga0265327_1000292119 419
343 3300037471 Ga0395905_0021319 Ga0395905_0021319_1920_3287 419
344 3300044672 Ga0466982_0091555 Ga0466982_0091555_310_1671 419
345 3300045976 Ga0466967_0361760 Ga0466967_0361760_34_1365 419
346 3300046616 Ga0495668_0000367 Ga0495668_0000367_13827_15203 419
347 3300046691 Ga0495670_0086465 Ga0495670_0086465_158_1507 419
348 3300047318 Ga0495636_0000037 Ga0495636_0000037_40024_41373 419
349 3300047320 Ga0495672_0067722 Ga0495672_0067722_590_1993 419
350 3300049571 Ga0501034_0000002 Ga0501034_0000002_509313_510659 419
351 3300050508 nmdc:mga09592_16021_c1 nmdc:mga09592_16021_c1_3654_5012 419
352 3300053139 Ga0500568_0003381 Ga0500568_0003381_7528_8835 419
353 3300003203 JGI25406J46586_10001059 JGI25406J46586_1000105910 420
354 3300003320 rootH2_10015699 rootH2_100156992 420
355 3300003761 Ga0055535_1000572 Ga0055535_100057228 420
356 3300003794 Ga0055531_10000041 Ga0055531_1000004158 420
357 3300005327 Ga0070658_10009494 Ga0070658_100094946 420
358 3300005329 Ga0070683_100014920 Ga0070683_1000149207 420
359 3300005329 Ga0070683_100102110 Ga0070683_1001021101 420
360 3300005334 Ga0068869_100110952 Ga0068869_1001109522 420
361 3300005336 Ga0070680_100137441 Ga0070680_1001374412 420
362 3300005338 Ga0068868_100042742 Ga0068868_1000427423 420
363 3300005466 Ga0070685_10016179 Ga0070685_100161793 420
364 3300005530 Ga0070679_100023347 Ga0070679_1000233476 420
365 3300005530 Ga0070679_100121412 Ga0070679_1001214122 420
366 3300005539 Ga0068853_100040540 Ga0068853_1000405402 420
367 3300005614 Ga0068856_100077102 Ga0068856_1000771022 420
368 3300005614 Ga0068856_100083052 Ga0068856_1000830522 420
369 3300005616 Ga0068852_100005740 Ga0068852_10000574010 420
370 3300005844 Ga0068862_100109651 Ga0068862_1001096512 420
371 3300005985 Ga0081539_10002864 Ga0081539_100028642 420
372 3300006237 Ga0097621_100006660 Ga0097621_1000066601 420
373 3300006358 Ga0068871_100008736 Ga0068871_1000087364 420
374 3300006358 Ga0068871_100018190 Ga0068871_1000181901 420
375 3300009545 Ga0105237_10095659 Ga0105237_100956592 420
376 3300009545 Ga0105237_10307377 Ga0105237_103073771 420
377 3300013104 Ga0157370_10000839 Ga0157370_1000083918 420
378 3300013105 Ga0157369_10007843 Ga0157369_100078437 420
379 3300013105 Ga0157369_10033474 Ga0157369_100334744 420
380 3300013296 Ga0157374_10134602 Ga0157374_101346021 420
381 3300013296 Ga0157374_10152079 Ga0157374_101520792 420
382 3300013306 Ga0163162_10185254 Ga0163162_101852542 420
383 3300013308 Ga0157375_10262465 Ga0157375_102624651 420
384 3300014745 Ga0157377_10053067 Ga0157377_100530671 420
385 3300014969 Ga0157376_10082958 Ga0157376_100829582 420
386 3300015265 Ga0182005_1000109 Ga0182005_100010913 420
387 3300021384 Ga0213876_10014288 Ga0213876_100142884 420
388 3300021384 Ga0213876_10015759 Ga0213876_100157592 420
389 3300025208 Ga0209436_100626 Ga0209436_10062616 420
390 3300025242 Ga0209258_100378 Ga0209258_10037843 420
391 3300025254 Ga0209148_1000391 Ga0209148_10003918 420
392 3300025302 Ga0207426_1007502 Ga0207426_10075023 420
393 3300025304 Ga0209257_1000001 Ga0209257_1000001812 420
394 3300025893 Ga0207682_10029421 Ga0207682_100294212 420
395 3300025908 Ga0207643_10038872 Ga0207643_100388721 420
396 3300025909 Ga0207705_10082967 Ga0207705_100829672 420
397 3300025909 Ga0207705_10091242 Ga0207705_100912422 420
398 3300025913 Ga0207695_10023032 Ga0207695_100230327 420
399 3300025917 Ga0207660_10095889 Ga0207660_100958892 420
400 3300025919 Ga0207657_10011713 Ga0207657_100117137 420
401 3300025920 Ga0207649_10073520 Ga0207649_100735201 420
402 3300025933 Ga0207706_10001784 Ga0207706_1000178414 420
403 3300025936 Ga0207670_10006016 Ga0207670_100060162 420
404 3300025945 Ga0207679_10164514 Ga0207679_101645142 420
405 3300025949 Ga0207667_10053470 Ga0207667_100534704 420
406 3300025949 Ga0207667_10133916 Ga0207667_101339162 420
407 3300026041 Ga0207639_10239888 Ga0207639_102398882 420
408 3300026078 Ga0207702_10073034 Ga0207702_100730343 420
409 3300026095 Ga0207676_10092097 Ga0207676_100920971 420
410 3300026116 Ga0207674_10043911 Ga0207674_100439113 420
411 3300026116 Ga0207674_10284343 Ga0207674_102843431 420
412 3300026142 Ga0207698_10035341 Ga0207698_100353413 420
413 3300028380 Ga0268265_10156368 Ga0268265_101563682 420
414 3300028794 Ga0307515_10000002 Ga0307515_10000002477 420
415 3300031548 Ga0307408_100001708 Ga0307408_1000017086 420
416 3300031901 Ga0307406_10038797 Ga0307406_100387972 420
417 3300039437 Ga0436365_0577581 Ga0436365_0577581_19148_20491 420
418 3300039437 Ga0436365_1553484 Ga0436365_1553484_5511_6884 420
419 3300044658 Ga0466972_0000003 Ga0466972_0000003_21755_23194 420
420 3300044765 Ga0466970_0005150 Ga0466970_0005150_4125_5564 420
421 3300048924 Ga0496121_0000054 Ga0496121_0000054_123086_124411 420
422 3300048929 Ga0496126_0005325 Ga0496126_0005325_549_1874 420
423 3300049586 Ga0501070_0113866 Ga0501070_0113866_336_1682 420
424 3300049823 Ga0501044_0015980 Ga0501044_0015980_536_1882 420
425 3300053088 Ga0500644_0000048 Ga0500644_0000048_47101_48426 420
426 3300053108 Ga0500562_000029 Ga0500562_000029_55824_57173 420
427 3300053109 Ga0500569_002995 Ga0500569_002995_1015_2340 420
428 3300053134 Ga0500658_0010954 Ga0500658_0010954_1393_2718 420
429 3300053156 Ga0500622_0001004 Ga0500622_0001004_7771_9093 420
430 3300053730 Ga0500645_036197 Ga0500645_036197_21_1370 420
431 iso_pu_bacteria 2739367866 2740031859 420
432 3300005290 Ga0065712_10086646 Ga0065712_100866463 421
433 3300005327 Ga0070658_10167895 Ga0070658_101678951 421
434 3300005329 Ga0070683_100024493 Ga0070683_1000244935 421
435 3300005334 Ga0068869_100009198 Ga0068869_1000091982 421
436 3300005335 Ga0070666_10003367 Ga0070666_100033672 421
437 3300005338 Ga0068868_100000524 Ga0068868_10000052411 421
438 3300005340 Ga0070689_100002023 Ga0070689_1000020235 421
439 3300005344 Ga0070661_100020138 Ga0070661_1000201384 421
440 3300005354 Ga0070675_100006657 Ga0070675_1000066576 421
441 3300005365 Ga0070688_100015633 Ga0070688_1000156334 421
442 3300005367 Ga0070667_100072478 Ga0070667_1000724782 421
443 3300005457 Ga0070662_100003891 Ga0070662_1000038912 421
444 3300005535 Ga0070684_100010691 Ga0070684_1000106916 421
445 3300005578 Ga0068854_100084271 Ga0068854_1000842712 421
446 3300005617 Ga0068859_100000023 Ga0068859_100000023120 421
447 3300005618 Ga0068864_100004780 Ga0068864_1000047805 421
448 3300005618 Ga0068864_100007894 Ga0068864_1000078946 421
449 3300005719 Ga0068861_100160611 Ga0068861_1001606112 421
450 3300005842 Ga0068858_100013810 Ga0068858_1000138105 421
451 3300006931 Ga0097620_100000023 Ga0097620_100000023120 421
452 3300009101 Ga0105247_10001787 Ga0105247_100017878 421
453 3300009174 Ga0105241_10001396 Ga0105241_100013964 421
454 3300009553 Ga0105249_10012755 Ga0105249_100127553 421
455 3300010375 Ga0105239_10182435 Ga0105239_101824352 421
456 3300013306 Ga0163162_10009987 Ga0163162_100099877 421
457 3300013307 Ga0157372_10191202 Ga0157372_101912022 421
458 3300014325 Ga0163163_10026596 Ga0163163_100265962 421
459 3300014968 Ga0157379_10080203 Ga0157379_100802032 421
460 3300017792 Ga0163161_10026859 Ga0163161_100268593 421
461 3300025900 Ga0207710_10009235 Ga0207710_100092353 421
462 3300025903 Ga0207680_10000834 Ga0207680_100008345 421
463 3300025904 Ga0207647_10016593 Ga0207647_100165933 421
464 3300025907 Ga0207645_10011044 Ga0207645_100110446 421
465 3300025911 Ga0207654_10000685 Ga0207654_100006859 421
466 3300025914 Ga0207671_10007029 Ga0207671_100070295 421
467 3300025923 Ga0207681_10094932 Ga0207681_100949322 421
468 3300025926 Ga0207659_10011219 Ga0207659_100112193 421
469 3300025933 Ga0207706_10007739 Ga0207706_1000773910 421
470 3300025933 Ga0207706_10077167 Ga0207706_100771672 421
471 3300025942 Ga0207689_10001497 Ga0207689_100014974 421
472 3300025944 Ga0207661_10003258 Ga0207661_100032587 421
473 3300025945 Ga0207679_10007237 Ga0207679_100072376 421
474 3300025960 Ga0207651_10067053 Ga0207651_100670531 421
475 3300025981 Ga0207640_10070234 Ga0207640_100702342 421
476 3300026023 Ga0207677_10040572 Ga0207677_100405722 421
477 3300026035 Ga0207703_10017694 Ga0207703_100176942 421
478 3300026088 Ga0207641_10002072 Ga0207641_1000207215 421
479 3300026095 Ga0207676_10006342 Ga0207676_100063425 421
480 3300028379 Ga0268266_10050321 Ga0268266_100503211 421
481 3300028381 Ga0268264_10004982 Ga0268264_100049824 421
482 3300005290 Ga0065712_10129417 Ga0065712_101294171 422
483 3300005329 Ga0070683_100025718 Ga0070683_1000257186 422
484 3300005331 Ga0070670_100060120 Ga0070670_1000601205 422
485 3300005331 Ga0070670_100166206 Ga0070670_1001662061 422
486 3300005331 Ga0070670_100200868 Ga0070670_1002008682 422
487 3300005338 Ga0068868_100095244 Ga0068868_1000952442 422
488 3300005366 Ga0070659_100022425 Ga0070659_1000224252 422
489 3300005366 Ga0070659_100116503 Ga0070659_1001165032 422
490 3300005535 Ga0070684_100004933 Ga0070684_10000493310 422
491 3300005564 Ga0070664_100025629 Ga0070664_1000256292 422
492 3300005564 Ga0070664_100073927 Ga0070664_1000739272 422
493 3300005616 Ga0068852_100001894 Ga0068852_10000189410 422
494 3300005983 Ga0081540_1016967 Ga0081540_10169673 422
495 3300013100 Ga0157373_10002372 Ga0157373_1000237213 422
496 3300013102 Ga0157371_10008419 Ga0157371_100084192 422
497 3300013102 Ga0157371_10057765 Ga0157371_100577652 422
498 3300013307 Ga0157372_10346872 Ga0157372_103468722 422
499 3300014325 Ga0163163_10000557 Ga0163163_1000055715 422
500 3300025904 Ga0207647_10001371 Ga0207647_100013714 422
501 3300025925 Ga0207650_10003727 Ga0207650_100037272 422
502 3300025944 Ga0207661_10018303 Ga0207661_100183036 422
503 3300025945 Ga0207679_10097647 Ga0207679_100976473 422
504 3300026142 Ga0207698_10034075 Ga0207698_100340754 422
505 3300026142 Ga0207698_10117317 Ga0207698_101173173 422
506 3300027876 Ga0209974_10017345 Ga0209974_100173452 422
507 3300037471 Ga0395905_0053813 Ga0395905_0053813_1959_3275 422
508 3300044712 Ga0453684_0146283 Ga0453684_0146283_1019_2338 422
509 3300005290 Ga0065712_10107515 Ga0065712_101075151 423
510 3300005338 Ga0068868_100165131 Ga0068868_1001651312 423
511 3300005367 Ga0070667_100023184 Ga0070667_1000231844 423
512 3300005466 Ga0070685_10011485 Ga0070685_100114854 423
513 3300005617 Ga0068859_100015184 Ga0068859_1000151842 423
514 3300005719 Ga0068861_100108203 Ga0068861_1001082031 423
515 3300006195 Ga0075366_10014817 Ga0075366_100148173 423
516 3300006844 Ga0075428_100015198 Ga0075428_1000151982 423
517 3300006846 Ga0075430_100036205 Ga0075430_1000362052 423
518 3300006880 Ga0075429_100005844 Ga0075429_1000058447 423
519 3300006931 Ga0097620_100015184 Ga0097620_1000151849 423
520 3300009148 Ga0105243_10063645 Ga0105243_100636452 423
521 3300009176 Ga0105242_10019529 Ga0105242_100195292 423
522 3300009553 Ga0105249_10009806 Ga0105249_100098065 423
523 3300014968 Ga0157379_10076667 Ga0157379_100766673 423
524 3300014968 Ga0157379_10174549 Ga0157379_101745491 423
525 3300025914 Ga0207671_10093699 Ga0207671_100936992 423
526 3300025918 Ga0207662_10091740 Ga0207662_100917402 423
527 3300025942 Ga0207689_10058662 Ga0207689_100586622 423
528 3300025960 Ga0207651_10107050 Ga0207651_101070502 423
529 3300025961 Ga0207712_10003348 Ga0207712_100033483 423
530 3300025986 Ga0207658_10035215 Ga0207658_100352152 423
531 3300026118 Ga0207675_100015939 Ga0207675_1000159392 423
532 3300026118 Ga0207675_100069249 Ga0207675_1000692493 423
533 3300028794 Ga0307515_10000057 Ga0307515_1000005786 423
534 3300037471 Ga0395905_0007067 Ga0395905_0007067_2407_3771 423
535 3300045049 Ga0466959_0058878 Ga0466959_0058878_173_1510 423
536 3300045976 Ga0466967_0079540 Ga0466967_0079540_50_1378 423
537 3300047472 Ga0495686_0014544 Ga0495686_0014544_1166_2476 423
538 3300050508 nmdc:mga09592_4462_c1 nmdc:mga09592_4462_c1_9557_10876 423
539 3300050509 nmdc:mga0qj67_39163_c1 nmdc:mga0qj67_39163_c1_1017_2336 423
540 3300002459 JGI24751J29686_10012803 JGI24751J29686_100128031 424
541 3300003322 rootL2_10160375 rootL2_101603753 424
542 3300005364 Ga0070673_100093991 Ga0070673_1000939912 424
543 3300005364 Ga0070673_100178932 Ga0070673_1001789321 424
544 3300005459 Ga0068867_100003552 Ga0068867_1000035523 424
545 3300005617 Ga0068859_100019080 Ga0068859_1000190806 424
546 3300005618 Ga0068864_100014772 Ga0068864_1000147723 424
547 3300005843 Ga0068860_100056458 Ga0068860_1000564583 424
548 3300006931 Ga0097620_100019082 Ga0097620_1000190826 424
549 3300013104 Ga0157370_10062692 Ga0157370_100626922 424
550 3300025942 Ga0207689_10053580 Ga0207689_100535802 424
551 3300025960 Ga0207651_10065340 Ga0207651_100653403 424
552 3300025961 Ga0207712_10012872 Ga0207712_100128721 424
553 3300025961 Ga0207712_10077614 Ga0207712_100776141 424
554 3300026041 Ga0207639_10197452 Ga0207639_101974521 424
555 3300026089 Ga0207648_10002070 Ga0207648_100020709 424
556 3300026095 Ga0207676_10031454 Ga0207676_100314543 424
557 3300028381 Ga0268264_10047532 Ga0268264_100475323 424
558 3300031456 Ga0307513_10165914 Ga0307513_101659142 424
559 3300053727 Ga0500611_000069 Ga0500611_000069_1877_3199 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

64

487

0.82

PF13520

AA_permease_2

Amino acid permease

60

474

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6li9-assembly1.cif.gz_B heteromeric amino acid transporter b0,+at-rbat complex bound with arginine 0.8532 11 391
7dsk-assembly1.cif.gz_B overall structure of the lat1-4f2hc bound with jx-075 0.8515 7 394
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8343 7 418
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8268 7 418
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8195 12 418
ID Description Score Start End Superfamily
af_B5DFJ0_32_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9006 7 379 1.20.1740.10
af_Q50E62_26_473_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8971 7 392 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8922 7 395 1.20.1740.10
af_K7TR83_40_488_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8874 7 378 1.20.1740.10
af_P24207_19_458_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8865 7 396 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3A4WG40-F1-model_v4 Amino acid permease 0.9166 8 381 GO:0016020
GO:0055085
AF-A0A2V9LP62-F1-model_v4 Amino acid permease 0.9154 8 403 GO:0005886
GO:0015179
AF-A0A651DNE3-F1-model_v4 Universal stress protein 0.9101 7 396 GO:0005886
GO:0022857
AF-A0A3B3YDD7-F1-model_v4 Solute carrier family 7 member 9 0.908 6 393 GO:0015179
GO:0016020
AF-A0A497IE33-F1-model_v4 Amino acid transporter 0.905 7 390 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.06 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map