F463545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 559 | 304 | 545 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100784894|Ga0068863_1007848942 |
| Length | 141 |
| Sequence | MSDDRIAGPSRPSMASEALGLLPGEFTAFRQRMNERILAEDNQVVRRFFALDTQTYKDGALDVKTKEMLGLVASLVLRCDDCISYHVAQCKDAGVKRDEFFEVFSVGLVVGGSIVIPHLRRAVDFLDKVEGGGETASEAKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 3 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 4 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 5 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 6 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 7 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 8 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 9 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 10 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 11 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 12 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 13 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 14 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 196 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 197 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 198 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 199 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 203 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 204 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 205 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 297 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 298 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 300 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 301 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0.72 |
| Isolates | 2.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.08 |
| Nodule | 0 |
| Rhizoplane | 2.15 |
| Rhizosphere | 82.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10174049 | 3300001979 | Bacteria | 534 |
| 2 | JGI24738J21930_10059907 | 3300002075 | Bacteria | 781 |
| 3 | JGI24744J21845_10015342 | 3300002077 | Bacteria | 1531 |
| 4 | JGI25156J39149_1011621 | 3300002705 | Bacteria | 1981 |
| 5 | JGI25164J39214_1001086 | 3300002772 | Bacteria | 7901 |
| 6 | JGI25165J46597_1004623 | 3300003214 | Bacteria | 2889 |
| 7 | Ga0006562J51391_1073321 | 3300003578 | Bacteria | 6500 |
| 8 | Ga0006562J51391_1073322 | 3300003578 | Bacteria | 5760 |
| 9 | Ga0055539_1001755 | 3300003752 | Bacteria | 3759 |
| 10 | Ga0055533_1013385 | 3300003756 | Bacteria | 845 |
| 11 | Ga0055527_1000082 | 3300003760 | Bacteria | 75048 |
| 12 | Ga0055535_1000143 | 3300003761 | Bacteria | 75049 |
| 13 | Ga0055542_1000190 | 3300003762 | Bacteria | 75049 |
| 14 | Ga0055529_1000217 | 3300003763 | Bacteria | 75049 |
| 15 | Ga0065165_1000028 | 3300005262 | Bacteria | 224430 |
| 16 | Ga0065707_10916251 | 3300005295 | Bacteria | 562 |
| 17 | Ga0070658_10001446 | 3300005327 | Bacteria | 20260 |
| 18 | Ga0070658_10260004 | 3300005327 | Bacteria | 1474 |
| 19 | Ga0070683_100465561 | 3300005329 | Bacteria | 1207 |
| 20 | Ga0070690_101468300 | 3300005330 | Bacteria | 550 |
| 21 | Ga0070666_10000007 | 3300005335 | Bacteria | 293732 |
| 22 | Ga0070666_10008334 | 3300005335 | Bacteria | 6429 |
| 23 | Ga0070680_100348622 | 3300005336 | Bacteria | 1259 |
| 24 | Ga0070682_100092289 | 3300005337 | Bacteria | 1983 |
| 25 | Ga0070682_100750858 | 3300005337 | Bacteria | 788 |
| 26 | Ga0070660_100104837 | 3300005339 | Bacteria | 2243 |
| 27 | Ga0070660_100297180 | 3300005339 | Bacteria | 1323 |
| 28 | Ga0070661_100046195 | 3300005344 | Bacteria | 3185 |
| 29 | Ga0070661_100232873 | 3300005344 | Bacteria | 1416 |
| 30 | Ga0070661_100394503 | 3300005344 | Bacteria | 1093 |
| 31 | Ga0070668_100431163 | 3300005347 | Bacteria | 1130 |
| 32 | Ga0070675_100595125 | 3300005354 | Bacteria | 1003 |
| 33 | Ga0070671_100817703 | 3300005355 | Bacteria | 812 |
| 34 | Ga0070674_100170543 | 3300005356 | Bacteria | 1659 |
| 35 | Ga0070659_100021966 | 3300005366 | Bacteria | 4868 |
| 36 | Ga0070659_100141151 | 3300005366 | Bacteria | 1961 |
| 37 | Ga0070659_100331704 | 3300005366 | Bacteria | 1273 |
| 38 | Ga0070667_100087948 | 3300005367 | Bacteria | 2667 |
| 39 | Ga0070667_100221091 | 3300005367 | Bacteria | 1686 |
| 40 | Ga0070714_100007668 | 3300005435 | Bacteria | 8404 |
| 41 | Ga0070713_100248395 | 3300005436 | Bacteria | 1622 |
| 42 | Ga0070711_100615740 | 3300005439 | Bacteria | 907 |
| 43 | Ga0070663_100057755 | 3300005455 | Bacteria | 2785 |
| 44 | Ga0070663_100069357 | 3300005455 | Bacteria | 2561 |
| 45 | Ga0070663_100152507 | 3300005455 | Bacteria | 1773 |
| 46 | Ga0070678_101235400 | 3300005456 | Bacteria | 694 |
| 47 | Ga0070662_100074458 | 3300005457 | Bacteria | 2512 |
| 48 | Ga0070662_100707460 | 3300005457 | Bacteria | 852 |
| 49 | Ga0070681_10003594 | 3300005458 | Bacteria | 14536 |
| 50 | Ga0070681_10142129 | 3300005458 | Bacteria | 2329 |
| 51 | Ga0070681_10202353 | 3300005458 | Bacteria | 1904 |
| 52 | Ga0070699_100824449 | 3300005518 | Bacteria | 849 |
| 53 | Ga0070679_100446724 | 3300005530 | Bacteria | 1238 |
| 54 | Ga0070684_100458044 | 3300005535 | Bacteria | 1179 |
| 55 | Ga0068853_100000139 | 3300005539 | Bacteria | 49652 |
| 56 | Ga0068853_100028883 | 3300005539 | Bacteria | 4669 |
| 57 | Ga0068853_100215811 | 3300005539 | Bacteria | 1750 |
| 58 | Ga0068853_100379696 | 3300005539 | Bacteria | 1319 |
| 59 | Ga0068853_100415511 | 3300005539 | Bacteria | 1261 |
| 60 | Ga0068853_102158053 | 3300005539 | Bacteria | 540 |
| 61 | Ga0070686_100841070 | 3300005544 | Bacteria | 743 |
| 62 | Ga0070696_100032116 | 3300005546 | Bacteria | 3601 |
| 63 | Ga0070696_100456702 | 3300005546 | Bacteria | 1009 |
| 64 | Ga0070696_100628279 | 3300005546 | Bacteria | 868 |
| 65 | Ga0070693_100033651 | 3300005547 | Bacteria | 2830 |
| 66 | Ga0070693_100037313 | 3300005547 | Bacteria | 2709 |
| 67 | Ga0070665_100005386 | 3300005548 | Bacteria | 13205 |
| 68 | Ga0070665_100006815 | 3300005548 | Bacteria | 11617 |
| 69 | Ga0070665_100272192 | 3300005548 | Bacteria | 1695 |
| 70 | Ga0068855_100000186 | 3300005563 | Bacteria | 79655 |
| 71 | Ga0068855_100007864 | 3300005563 | Bacteria | 12884 |
| 72 | Ga0068857_100212506 | 3300005577 | Bacteria | 1765 |
| 73 | Ga0068857_100260932 | 3300005577 | Bacteria | 1590 |
| 74 | Ga0068857_100728563 | 3300005577 | Bacteria | 943 |
| 75 | Ga0068854_100026233 | 3300005578 | Bacteria | 4003 |
| 76 | Ga0068856_100011969 | 3300005614 | Bacteria | 8401 |
| 77 | Ga0068856_100038837 | 3300005614 | Bacteria | 4673 |
| 78 | Ga0068856_100182347 | 3300005614 | Bacteria | 2113 |
| 79 | Ga0068856_100215296 | 3300005614 | Bacteria | 1936 |
| 80 | Ga0068852_100087251 | 3300005616 | Bacteria | 2783 |
| 81 | Ga0068852_100113207 | 3300005616 | Bacteria | 2470 |
| 82 | Ga0068852_100179005 | 3300005616 | Bacteria | 1992 |
| 83 | Ga0068852_100241952 | 3300005616 | Bacteria | 1725 |
| 84 | Ga0068859_100056601 | 3300005617 | Bacteria | 3948 |
| 85 | Ga0068864_100074532 | 3300005618 | Bacteria | 2961 |
| 86 | Ga0068864_100098322 | 3300005618 | Bacteria | 2592 |
| 87 | Ga0068863_100044942 | 3300005841 | Bacteria | 4192 |
| 88 | Ga0068863_100054389 | 3300005841 | Bacteria | 3792 |
| 89 | Ga0068863_100090217 | 3300005841 | Bacteria | 2906 |
| 90 | Ga0068863_100784894 | 3300005841 | Bacteria | 949 |
| 91 | Ga0068858_100090101 | 3300005842 | Bacteria | 2854 |
| 92 | Ga0068858_100213548 | 3300005842 | Bacteria | 1826 |
| 93 | Ga0068860_100003573 | 3300005843 | Bacteria | 15984 |
| 94 | Ga0068860_100009355 | 3300005843 | Bacteria | 9737 |
| 95 | Ga0068860_100218111 | 3300005843 | Bacteria | 1852 |
| 96 | Ga0068860_100372058 | 3300005843 | Bacteria | 1409 |
| 97 | Ga0068860_100629450 | 3300005843 | Bacteria | 1080 |
| 98 | Ga0068862_100178674 | 3300005844 | Bacteria | 1904 |
| 99 | Ga0068862_101696206 | 3300005844 | Bacteria | 640 |
| 100 | Ga0070712_100537656 | 3300006175 | Bacteria | 983 |
| 101 | Ga0097621_100155073 | 3300006237 | Bacteria | 1965 |
| 102 | Ga0097621_100254391 | 3300006237 | Bacteria | 1539 |
| 103 | Ga0068871_100023400 | 3300006358 | Bacteria | 4778 |
| 104 | Ga0068871_100882756 | 3300006358 | Bacteria | 828 |
| 105 | Ga0075428_100730358 | 3300006844 | Bacteria | 1054 |
| 106 | Ga0075433_10603840 | 3300006852 | Bacteria | 963 |
| 107 | Ga0075429_100203871 | 3300006880 | Bacteria | 1733 |
| 108 | Ga0068865_100051301 | 3300006881 | Bacteria | 2855 |
| 109 | Ga0068865_100241278 | 3300006881 | Bacteria | 1422 |
| 110 | Ga0097620_100056601 | 3300006931 | Bacteria | 3948 |
| 111 | Ga0105240_10023606 | 3300009093 | Bacteria | 8125 |
| 112 | Ga0105240_10659590 | 3300009093 | Bacteria | 1146 |
| 113 | Ga0111539_10002218 | 3300009094 | Bacteria | 25946 |
| 114 | Ga0105245_10102171 | 3300009098 | Bacteria | 2655 |
| 115 | Ga0105245_12032415 | 3300009098 | Bacteria | 628 |
| 116 | Ga0105245_13158569 | 3300009098 | Bacteria | 511 |
| 117 | Ga0105247_10286136 | 3300009101 | Bacteria | 1139 |
| 118 | Ga0105243_10371187 | 3300009148 | Bacteria | 1320 |
| 119 | Ga0105241_10009561 | 3300009174 | Bacteria | 7126 |
| 120 | Ga0105241_10959841 | 3300009174 | Bacteria | 797 |
| 121 | Ga0105242_10017183 | 3300009176 | Bacteria | 5633 |
| 122 | Ga0105242_10275535 | 3300009176 | Bacteria | 1526 |
| 123 | Ga0105242_10613184 | 3300009176 | Bacteria | 1053 |
| 124 | Ga0105248_10037032 | 3300009177 | Bacteria | 5455 |
| 125 | Ga0105248_10667066 | 3300009177 | Bacteria | 1173 |
| 126 | Ga0105248_11487512 | 3300009177 | Bacteria | 767 |
| 127 | Ga0105248_12863982 | 3300009177 | Bacteria | 550 |
| 128 | Ga0105237_10038334 | 3300009545 | Bacteria | 4839 |
| 129 | Ga0105237_10653241 | 3300009545 | Bacteria | 1058 |
| 130 | Ga0105237_11045689 | 3300009545 | Bacteria | 823 |
| 131 | Ga0105238_10000972 | 3300009551 | Bacteria | 29340 |
| 132 | Ga0105238_10004618 | 3300009551 | Bacteria | 13631 |
| 133 | Ga0105238_10209973 | 3300009551 | Bacteria | 1923 |
| 134 | Ga0105249_10084753 | 3300009553 | Bacteria | 2951 |
| 135 | Ga0105249_10182736 | 3300009553 | Bacteria | 2041 |
| 136 | Ga0105249_10546295 | 3300009553 | Bacteria | 1209 |
| 137 | Ga0105239_10013394 | 3300010375 | Bacteria | 9111 |
| 138 | Ga0105239_10022375 | 3300010375 | Bacteria | 6969 |
| 139 | Ga0105239_10047052 | 3300010375 | Bacteria | 4726 |
| 140 | Ga0105239_10146472 | 3300010375 | Bacteria | 2634 |
| 141 | Ga0105239_10224424 | 3300010375 | Bacteria | 2107 |
| 142 | Ga0105239_10406279 | 3300010375 | Bacteria | 1541 |
| 143 | Ga0105239_10902616 | 3300010375 | Bacteria | 1014 |
| 144 | Ga0105239_12832956 | 3300010375 | Bacteria | 566 |
| 145 | Ga0105246_10070636 | 3300011119 | Bacteria | 2456 |
| 146 | Ga0157371_10181349 | 3300013102 | Bacteria | 1506 |
| 147 | Ga0157370_10107504 | 3300013104 | Bacteria | 2609 |
| 148 | Ga0157370_10251550 | 3300013104 | Bacteria | 1634 |
| 149 | Ga0157370_10369029 | 3300013104 | Bacteria | 1323 |
| 150 | Ga0157369_10006929 | 3300013105 | Bacteria | 13076 |
| 151 | Ga0157369_10019475 | 3300013105 | Bacteria | 7592 |
| 152 | Ga0157369_10233503 | 3300013105 | Bacteria | 1922 |
| 153 | Ga0157374_11170401 | 3300013296 | Bacteria | 790 |
| 154 | Ga0157378_10029176 | 3300013297 | Bacteria | 4870 |
| 155 | Ga0157378_10288542 | 3300013297 | Bacteria | 1584 |
| 156 | Ga0163162_10010474 | 3300013306 | Bacteria | 9014 |
| 157 | Ga0163162_10010824 | 3300013306 | Bacteria | 8875 |
| 158 | Ga0163162_10379841 | 3300013306 | Bacteria | 1546 |
| 159 | Ga0163162_11084009 | 3300013306 | Bacteria | 907 |
| 160 | Ga0157372_10003531 | 3300013307 | Bacteria | 16847 |
| 161 | Ga0157372_10062647 | 3300013307 | Bacteria | 4168 |
| 162 | Ga0157372_11967464 | 3300013307 | Bacteria | 672 |
| 163 | Ga0157375_10001312 | 3300013308 | Bacteria | 21447 |
| 164 | Ga0157375_10124721 | 3300013308 | Bacteria | 2689 |
| 165 | Ga0157375_10169352 | 3300013308 | Bacteria | 2331 |
| 166 | Ga0163163_10000168 | 3300014325 | Bacteria | 68808 |
| 167 | Ga0163163_10001009 | 3300014325 | Bacteria | 23814 |
| 168 | Ga0163163_10028802 | 3300014325 | Bacteria | 5338 |
| 169 | Ga0163163_10135895 | 3300014325 | Bacteria | 2500 |
| 170 | Ga0182008_10001813 | 3300014497 | Bacteria | 13925 |
| 171 | Ga0182008_10098115 | 3300014497 | Bacteria | 1446 |
| 172 | Ga0182008_10290651 | 3300014497 | Bacteria | 853 |
| 173 | Ga0157379_10011655 | 3300014968 | Bacteria | 7676 |
| 174 | Ga0157379_10599198 | 3300014968 | Bacteria | 1028 |
| 175 | Ga0157376_10067528 | 3300014969 | Bacteria | 3025 |
| 176 | Ga0182006_1000072 | 3300015261 | Bacteria | 133681 |
| 177 | Ga0182006_1014700 | 3300015261 | Bacteria | 3370 |
| 178 | Ga0182007_10003436 | 3300015262 | Bacteria | 7464 |
| 179 | Ga0182007_10048943 | 3300015262 | Bacteria | 1397 |
| 180 | Ga0182007_10090847 | 3300015262 | Bacteria | 1006 |
| 181 | Ga0182007_10139647 | 3300015262 | Bacteria | 819 |
| 182 | Ga0182005_1000080 | 3300015265 | Bacteria | 76011 |
| 183 | Ga0182005_1004229 | 3300015265 | Bacteria | 4686 |
| 184 | Ga0182005_1008595 | 3300015265 | Bacteria | 3003 |
| 185 | Ga0163161_10002457 | 3300017792 | Bacteria | 13228 |
| 186 | Ga0163161_10023223 | 3300017792 | Bacteria | 4373 |
| 187 | Ga0197907_11481889 | 3300020069 | Bacteria | 1119 |
| 188 | Ga0206355_1403764 | 3300020076 | Bacteria | 883 |
| 189 | Ga0209674_100119 | 3300025226 | Bacteria | 135468 |
| 190 | Ga0209674_100426 | 3300025226 | Bacteria | 20351 |
| 191 | Ga0209674_102261 | 3300025226 | Bacteria | 4260 |
| 192 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 193 | Ga0207427_100334 | 3300025231 | Bacteria | 31251 |
| 194 | Ga0209437_100139 | 3300025233 | Bacteria | 172506 |
| 195 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 196 | Ga0209677_116022 | 3300025253 | Bacteria | 969 |
| 197 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 198 | Ga0209759_1005589 | 3300025256 | Bacteria | 4364 |
| 199 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 200 | Ga0209233_1000191 | 3300025261 | Bacteria | 127938 |
| 201 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 202 | Ga0209455_1000338 | 3300025272 | Bacteria | 44594 |
| 203 | Ga0209673_1117922 | 3300025273 | Bacteria | 545 |
| 204 | Ga0209256_1004462 | 3300025299 | Bacteria | 8764 |
| 205 | Ga0209051_1037076 | 3300025303 | Bacteria | 1793 |
| 206 | Ga0207710_10024201 | 3300025900 | Bacteria | 2614 |
| 207 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 208 | Ga0207680_10008319 | 3300025903 | Bacteria | 5083 |
| 209 | Ga0207647_10000029 | 3300025904 | Bacteria | 109732 |
| 210 | Ga0207647_10001205 | 3300025904 | Bacteria | 19905 |
| 211 | Ga0207647_10067789 | 3300025904 | Bacteria | 2161 |
| 212 | Ga0207705_10008424 | 3300025909 | Bacteria | 7529 |
| 213 | Ga0207705_10040657 | 3300025909 | Bacteria | 3336 |
| 214 | Ga0207705_10204906 | 3300025909 | Bacteria | 1495 |
| 215 | Ga0207654_10000072 | 3300025911 | Bacteria | 66188 |
| 216 | Ga0207654_10054698 | 3300025911 | Bacteria | 2308 |
| 217 | Ga0207707_10164066 | 3300025912 | Bacteria | 1942 |
| 218 | Ga0207707_10389183 | 3300025912 | Bacteria | 1198 |
| 219 | Ga0207695_10000256 | 3300025913 | Bacteria | 135850 |
| 220 | Ga0207695_10003762 | 3300025913 | Bacteria | 21057 |
| 221 | Ga0207671_10004173 | 3300025914 | Bacteria | 13960 |
| 222 | Ga0207671_10600912 | 3300025914 | Bacteria | 877 |
| 223 | Ga0207671_11108444 | 3300025914 | Bacteria | 621 |
| 224 | Ga0207693_10474804 | 3300025915 | Bacteria | 977 |
| 225 | Ga0207663_10482091 | 3300025916 | Bacteria | 961 |
| 226 | Ga0207660_10030205 | 3300025917 | Bacteria | 3724 |
| 227 | Ga0207662_10474321 | 3300025918 | Bacteria | 859 |
| 228 | Ga0207657_10204814 | 3300025919 | Bacteria | 1585 |
| 229 | Ga0207657_10279886 | 3300025919 | Bacteria | 1324 |
| 230 | Ga0207649_10001367 | 3300025920 | Bacteria | 14474 |
| 231 | Ga0207649_10088430 | 3300025920 | Bacteria | 2023 |
| 232 | Ga0207649_10122482 | 3300025920 | Bacteria | 1755 |
| 233 | Ga0207649_10678523 | 3300025920 | Bacteria | 798 |
| 234 | Ga0207652_10266346 | 3300025921 | Bacteria | 1546 |
| 235 | Ga0207694_10000470 | 3300025924 | Bacteria | 36877 |
| 236 | Ga0207694_10225229 | 3300025924 | Bacteria | 1530 |
| 237 | Ga0207687_10050737 | 3300025927 | Bacteria | 2889 |
| 238 | Ga0207687_10089002 | 3300025927 | Bacteria | 2247 |
| 239 | Ga0207687_11049395 | 3300025927 | Bacteria | 699 |
| 240 | Ga0207700_10977203 | 3300025928 | Bacteria | 758 |
| 241 | Ga0207664_10000239 | 3300025929 | Bacteria | 41739 |
| 242 | Ga0207664_10006000 | 3300025929 | Bacteria | 8319 |
| 243 | Ga0207664_10025617 | 3300025929 | Bacteria | 4447 |
| 244 | Ga0207644_10570153 | 3300025931 | Bacteria | 938 |
| 245 | Ga0207644_11452705 | 3300025931 | Bacteria | 576 |
| 246 | Ga0207690_10000448 | 3300025932 | Bacteria | 26681 |
| 247 | Ga0207690_10000586 | 3300025932 | Bacteria | 23543 |
| 248 | Ga0207690_10044195 | 3300025932 | Bacteria | 2935 |
| 249 | Ga0207690_10110331 | 3300025932 | Bacteria | 1980 |
| 250 | Ga0207706_10246472 | 3300025933 | Bacteria | 1561 |
| 251 | Ga0207686_10342964 | 3300025934 | Bacteria | 1122 |
| 252 | Ga0207709_11576128 | 3300025935 | Bacteria | 545 |
| 253 | Ga0207669_10384927 | 3300025937 | Bacteria | 1094 |
| 254 | Ga0207704_10345391 | 3300025938 | Bacteria | 1157 |
| 255 | Ga0207704_10442880 | 3300025938 | Bacteria | 1035 |
| 256 | Ga0207711_10299119 | 3300025941 | Bacteria | 1484 |
| 257 | Ga0207667_10015167 | 3300025949 | Bacteria | 8762 |
| 258 | Ga0207667_10017940 | 3300025949 | Bacteria | 7953 |
| 259 | Ga0207667_10080089 | 3300025949 | Bacteria | 3384 |
| 260 | Ga0207667_10125646 | 3300025949 | Bacteria | 2642 |
| 261 | Ga0207712_10326375 | 3300025961 | Bacteria | 1268 |
| 262 | Ga0207712_10339919 | 3300025961 | Bacteria | 1244 |
| 263 | Ga0207668_10766201 | 3300025972 | Bacteria | 852 |
| 264 | Ga0207640_10364707 | 3300025981 | Bacteria | 1165 |
| 265 | Ga0207658_10182141 | 3300025986 | Bacteria | 1739 |
| 266 | Ga0207658_10197722 | 3300025986 | Bacteria | 1676 |
| 267 | Ga0207658_10324780 | 3300025986 | Bacteria | 1333 |
| 268 | Ga0207703_10250730 | 3300026035 | Bacteria | 1595 |
| 269 | Ga0207703_11122377 | 3300026035 | Bacteria | 755 |
| 270 | Ga0207703_11869879 | 3300026035 | Bacteria | 576 |
| 271 | Ga0207639_10000931 | 3300026041 | Bacteria | 19788 |
| 272 | Ga0207639_10015505 | 3300026041 | Bacteria | 5379 |
| 273 | Ga0207639_10038167 | 3300026041 | Bacteria | 3571 |
| 274 | Ga0207639_10039740 | 3300026041 | Bacteria | 3507 |
| 275 | Ga0207639_10095285 | 3300026041 | Bacteria | 2392 |
| 276 | Ga0207639_10399634 | 3300026041 | Bacteria | 1238 |
| 277 | Ga0207639_12211288 | 3300026041 | Bacteria | 511 |
| 278 | Ga0207678_10009391 | 3300026067 | Bacteria | 8606 |
| 279 | Ga0207678_10074977 | 3300026067 | Bacteria | 2898 |
| 280 | Ga0207678_10162477 | 3300026067 | Bacteria | 1907 |
| 281 | Ga0207678_10289904 | 3300026067 | Bacteria | 1406 |
| 282 | Ga0207702_10001547 | 3300026078 | Bacteria | 22753 |
| 283 | Ga0207702_10006329 | 3300026078 | Bacteria | 10226 |
| 284 | Ga0207702_10012695 | 3300026078 | Bacteria | 7010 |
| 285 | Ga0207702_10154401 | 3300026078 | Bacteria | 2091 |
| 286 | Ga0207702_10248275 | 3300026078 | Bacteria | 1670 |
| 287 | Ga0207641_10011588 | 3300026088 | Bacteria | 7237 |
| 288 | Ga0207641_10017887 | 3300026088 | Bacteria | 5806 |
| 289 | Ga0207641_10034940 | 3300026088 | Bacteria | 4184 |
| 290 | Ga0207641_10453211 | 3300026088 | Bacteria | 1240 |
| 291 | Ga0207676_10019164 | 3300026095 | Bacteria | 4986 |
| 292 | Ga0207676_10346839 | 3300026095 | Bacteria | 1372 |
| 293 | Ga0207674_10115469 | 3300026116 | Bacteria | 2656 |
| 294 | Ga0207674_10472425 | 3300026116 | Bacteria | 1212 |
| 295 | Ga0207674_10570972 | 3300026116 | Bacteria | 1093 |
| 296 | Ga0207674_10851693 | 3300026116 | Bacteria | 879 |
| 297 | Ga0207675_102625450 | 3300026118 | Bacteria | 513 |
| 298 | Ga0207683_10138081 | 3300026121 | Bacteria | 2195 |
| 299 | Ga0207683_10227822 | 3300026121 | Bacteria | 1699 |
| 300 | Ga0207698_10017149 | 3300026142 | Bacteria | 4906 |
| 301 | Ga0207698_10060220 | 3300026142 | Bacteria | 2952 |
| 302 | Ga0207698_10265152 | 3300026142 | Bacteria | 1580 |
| 303 | Ga0209969_1030384 | 3300027360 | Bacteria | 825 |
| 304 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 305 | Ga0268266_10046248 | 3300028379 | Bacteria | 3726 |
| 306 | Ga0268266_10398226 | 3300028379 | Bacteria | 1301 |
| 307 | Ga0268265_10804010 | 3300028380 | Bacteria | 917 |
| 308 | Ga0268264_10005680 | 3300028381 | Bacteria | 10575 |
| 309 | Ga0268264_10013949 | 3300028381 | Bacteria | 6606 |
| 310 | Ga0268264_10057271 | 3300028381 | Bacteria | 3260 |
| 311 | Ga0268264_10410559 | 3300028381 | Bacteria | 1303 |
| 312 | Ga0268264_12046471 | 3300028381 | Bacteria | 581 |
| 313 | Ga0307408_101952232 | 3300031548 | Bacteria | 564 |
| 314 | Ga0316575_10005122 | 3300031665 | Bacteria | 4653 |
| 315 | Ga0307516_10104907 | 3300031730 | Bacteria | 2638 |
| 316 | Ga0307405_10110686 | 3300031731 | Bacteria | 1860 |
| 317 | Ga0307413_10579183 | 3300031824 | Bacteria | 915 |
| 318 | Ga0307410_11564944 | 3300031852 | Bacteria | 582 |
| 319 | Ga0307412_10008807 | 3300031911 | Bacteria | 5778 |
| 320 | Ga0307409_100052564 | 3300031995 | Bacteria | 3125 |
| 321 | Ga0307409_100152459 | 3300031995 | Bacteria | 2009 |
| 322 | Ga0307416_100061464 | 3300032002 | Bacteria | 3066 |
| 323 | Ga0307415_101439690 | 3300032126 | Unclassified | 657 |
| 324 | Ga0307510_10000770 | 3300033180 | Bacteria | 33082 |
| 325 | Ga0373944_0113939 | 3300035089 | Bacteria | 926 |
| 326 | Ga0373923_0123727 | 3300035111 | Bacteria | 1158 |
| 327 | Ga0373957_0154264 | 3300035120 | Bacteria | 944 |
| 328 | Ga0373947_0251575 | 3300035725 | Bacteria | 1169 |
| 329 | Ga0395899_0047597 | 3300037312 | Bacteria | 3192 |
| 330 | Ga0395900_0206167 | 3300037418 | Bacteria | 1987 |
| 331 | Ga0395898_0001311 | 3300037466 | Bacteria | 36213 |
| 332 | Ga0395901_0000816 | 3300038443 | Bacteria | 34537 |
| 333 | Ga0395901_0843432 | 3300038443 | Bacteria | 902 |
| 334 | Ga0395901_1677047 | 3300038443 | Bacteria | 587 |
| 335 | Ga0436363_0890279 | 3300039450 | Bacteria | 595 |
| 336 | Ga0439436_0000099 | 3300041404 | Bacteria | 20537 |
| 337 | Ga0439465_0003612 | 3300041413 | Bacteria | 5047 |
| 338 | Ga0451787_003194 | 3300041441 | Bacteria | 1313 |
| 339 | Ga0451787_108926 | 3300041441 | Bacteria | 1768 |
| 340 | Ga0451791_0262041 | 3300041451 | Bacteria | 787 |
| 341 | Ga0451793_1434546 | 3300041452 | Bacteria | 1654 |
| 342 | Ga0451797_1213514 | 3300041453 | Bacteria | 857 |
| 343 | Ga0451802_0511048 | 3300041460 | Bacteria | 5068 |
| 344 | Ga0451833_0775520 | 3300041491 | Bacteria | 2287 |
| 345 | Ga0451833_0823068 | 3300041491 | Bacteria | 697 |
| 346 | Ga0451833_1492982 | 3300041491 | Bacteria | 605 |
| 347 | Ga0451837_0859325 | 3300041494 | Bacteria | 1072 |
| 348 | Ga0451837_1101813 | 3300041494 | Bacteria | 2018 |
| 349 | Ga0451841_1038888 | 3300041498 | Bacteria | 1081 |
| 350 | Ga0451843_0311453 | 3300041509 | Bacteria | 948 |
| 351 | Ga0451853_0913553 | 3300041512 | Bacteria | 1865 |
| 352 | Ga0439445_0012742 | 3300042004 | Bacteria | 2025 |
| 353 | Ga0439432_030621 | 3300042006 | Bacteria | 1744 |
| 354 | Ga0439451_040265 | 3300042009 | Unclassified | 938 |
| 355 | Ga0450897_040655 | 3300042128 | Bacteria | 546 |
| 356 | Ga0450894_037729 | 3300042131 | Bacteria | 688 |
| 357 | Ga0450908_002471 | 3300042184 | Bacteria | 3615 |
| 358 | Ga0466969_0001632 | 3300044656 | Bacteria | 12024 |
| 359 | Ga0466989_0020593 | 3300044663 | Bacteria | 3802 |
| 360 | Ga0466966_0039686 | 3300044684 | Bacteria | 3031 |
| 361 | Ga0466961_0025286 | 3300044693 | Bacteria | 3818 |
| 362 | Ga0466961_0487929 | 3300044693 | Bacteria | 744 |
| 363 | Ga0466963_0255153 | 3300044694 | Bacteria | 1231 |
| 364 | Ga0466971_0088792 | 3300044719 | Bacteria | 1414 |
| 365 | Ga0466968_0001115 | 3300044735 | Bacteria | 9513 |
| 366 | Ga0466970_0024169 | 3300044765 | Bacteria | 3176 |
| 367 | Ga0466959_0252405 | 3300045049 | Bacteria | 1216 |
| 368 | Ga0466958_0087539 | 3300045836 | Bacteria | 1923 |
| 369 | Ga0466958_0183193 | 3300045836 | Bacteria | 1329 |
| 370 | Ga0495617_000117 | 3300046452 | Bacteria | 54105 |
| 371 | Ga0495617_009842 | 3300046452 | Bacteria | 3278 |
| 372 | Ga0495638_0000153 | 3300046460 | Bacteria | 109155 |
| 373 | Ga0495638_0063908 | 3300046460 | Bacteria | 2268 |
| 374 | Ga0495651_0471692 | 3300046462 | Bacteria | 808 |
| 375 | Ga0495650_0000271 | 3300046471 | Bacteria | 98894 |
| 376 | Ga0495650_0003006 | 3300046471 | Bacteria | 12745 |
| 377 | Ga0495650_0165229 | 3300046471 | Bacteria | 786 |
| 378 | Ga0495639_0060953 | 3300046475 | Bacteria | 1729 |
| 379 | Ga0495585_0001084 | 3300046492 | Bacteria | 22416 |
| 380 | Ga0495607_0000120 | 3300046501 | Bacteria | 82667 |
| 381 | Ga0495583_0385049 | 3300046506 | Bacteria | 551 |
| 382 | Ga0495606_0001210 | 3300046507 | Bacteria | 36218 |
| 383 | Ga0495606_0002719 | 3300046507 | Bacteria | 19946 |
| 384 | Ga0495606_0025920 | 3300046507 | Bacteria | 4187 |
| 385 | Ga0495610_0002124 | 3300046512 | Bacteria | 16863 |
| 386 | Ga0495610_0030866 | 3300046512 | Bacteria | 2801 |
| 387 | Ga0495616_0080241 | 3300046513 | Bacteria | 1562 |
| 388 | Ga0495620_0005183 | 3300046515 | Bacteria | 7292 |
| 389 | Ga0495631_0000029 | 3300046518 | Bacteria | 86555 |
| 390 | Ga0495631_0001826 | 3300046518 | Bacteria | 12579 |
| 391 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 392 | Ga0495632_0088872 | 3300046519 | Bacteria | 1467 |
| 393 | Ga0495643_0094780 | 3300046522 | Bacteria | 1536 |
| 394 | Ga0495648_0001512 | 3300046524 | Bacteria | 22781 |
| 395 | Ga0495648_0013046 | 3300046524 | Bacteria | 6165 |
| 396 | Ga0495609_0005899 | 3300046538 | Bacteria | 6332 |
| 397 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 398 | Ga0495611_0000060 | 3300046648 | Bacteria | 77971 |
| 399 | Ga0495625_0000022 | 3300046660 | Bacteria | 278823 |
| 400 | Ga0495625_0029807 | 3300046660 | Bacteria | 4077 |
| 401 | Ga0495625_0154886 | 3300046660 | Bacteria | 1538 |
| 402 | Ga0495625_0161202 | 3300046660 | Bacteria | 1502 |
| 403 | Ga0495661_0000438 | 3300046665 | Bacteria | 44026 |
| 404 | Ga0495647_0056370 | 3300046681 | Bacteria | 1540 |
| 405 | Ga0495670_0005573 | 3300046691 | Bacteria | 6178 |
| 406 | Ga0495670_0038632 | 3300046691 | Bacteria | 2380 |
| 407 | Ga0495671_0024804 | 3300046692 | Bacteria | 3119 |
| 408 | Ga0495649_0008445 | 3300046694 | Bacteria | 6197 |
| 409 | Ga0495589_0000237 | 3300046794 | Bacteria | 46023 |
| 410 | Ga0495660_0000092 | 3300046810 | Bacteria | 96197 |
| 411 | Ga0495660_0004103 | 3300046810 | Bacteria | 8885 |
| 412 | Ga0495674_0222044 | 3300047319 | Bacteria | 1562 |
| 413 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 414 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 415 | Ga0495673_0001152 | 3300047469 | Bacteria | 22486 |
| 416 | Ga0495673_0001469 | 3300047469 | Bacteria | 18680 |
| 417 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 418 | Ga0495686_0011096 | 3300047472 | Bacteria | 6365 |
| 419 | Ga0495686_0105700 | 3300047472 | Bacteria | 1693 |
| 420 | Ga0496100_0028387 | 3300048903 | Bacteria | 3451 |
| 421 | Ga0496101_0001374 | 3300048904 | Bacteria | 14578 |
| 422 | Ga0496102_0387398 | 3300048905 | Bacteria | 1315 |
| 423 | Ga0496106_0000309 | 3300048909 | Bacteria | 34373 |
| 424 | Ga0496106_0921086 | 3300048909 | Bacteria | 690 |
| 425 | Ga0496108_0670168 | 3300048911 | Bacteria | 901 |
| 426 | Ga0496116_0116936 | 3300048919 | Bacteria | 1553 |
| 427 | Ga0496117_0027842 | 3300048920 | Bacteria | 4390 |
| 428 | Ga0496117_0083891 | 3300048920 | Bacteria | 2081 |
| 429 | Ga0496117_0129266 | 3300048920 | Bacteria | 1534 |
| 430 | Ga0496118_0000429 | 3300048921 | Bacteria | 69699 |
| 431 | Ga0496118_0002637 | 3300048921 | Bacteria | 23784 |
| 432 | Ga0496118_0092608 | 3300048921 | Bacteria | 2073 |
| 433 | Ga0496118_0503770 | 3300048921 | Bacteria | 601 |
| 434 | Ga0496118_0528659 | 3300048921 | Bacteria | 580 |
| 435 | Ga0496119_0071853 | 3300048922 | Bacteria | 2024 |
| 436 | Ga0496120_0073946 | 3300048923 | Bacteria | 1863 |
| 437 | Ga0496121_0000045 | 3300048924 | Bacteria | 336130 |
| 438 | Ga0496121_0006695 | 3300048924 | Bacteria | 14165 |
| 439 | Ga0496121_0062715 | 3300048924 | Bacteria | 3042 |
| 440 | Ga0496121_0181665 | 3300048924 | Bacteria | 1517 |
| 441 | Ga0496121_0422672 | 3300048924 | Bacteria | 867 |
| 442 | Ga0496121_0869874 | 3300048924 | Bacteria | 522 |
| 443 | Ga0496122_0181748 | 3300048925 | Bacteria | 1253 |
| 444 | Ga0496123_0017670 | 3300048926 | Bacteria | 5722 |
| 445 | Ga0496124_0373776 | 3300048927 | Bacteria | 999 |
| 446 | Ga0496125_0010765 | 3300048928 | Bacteria | 9213 |
| 447 | Ga0496126_0058598 | 3300048929 | Bacteria | 3471 |
| 448 | Ga0496126_0183782 | 3300048929 | Bacteria | 1774 |
| 449 | Ga0496126_0404230 | 3300048929 | Bacteria | 1107 |
| 450 | Ga0496126_0409263 | 3300048929 | Bacteria | 1099 |
| 451 | Ga0495678_001379 | 3300049459 | Bacteria | 19361 |
| 452 | Ga0495682_0006075 | 3300049460 | Bacteria | 4924 |
| 453 | Ga0495682_0064224 | 3300049460 | Bacteria | 1323 |
| 454 | Ga0501032_0078774 | 3300049569 | Bacteria | 2193 |
| 455 | Ga0501033_0090845 | 3300049570 | Bacteria | 2234 |
| 456 | Ga0501033_0145115 | 3300049570 | Bacteria | 1714 |
| 457 | Ga0501034_0000793 | 3300049571 | Bacteria | 47013 |
| 458 | Ga0501034_0109115 | 3300049571 | Bacteria | 2758 |
| 459 | Ga0501034_0130865 | 3300049571 | Bacteria | 2492 |
| 460 | Ga0501036_0069503 | 3300049572 | Bacteria | 2979 |
| 461 | Ga0501036_0128624 | 3300049572 | Bacteria | 2138 |
| 462 | Ga0501037_0049477 | 3300049573 | Bacteria | 3077 |
| 463 | Ga0501037_0080609 | 3300049573 | Bacteria | 2361 |
| 464 | Ga0501037_0099898 | 3300049573 | Bacteria | 2095 |
| 465 | Ga0501038_0019255 | 3300049574 | Bacteria | 6157 |
| 466 | Ga0501038_0092547 | 3300049574 | Bacteria | 2531 |
| 467 | Ga0501038_0188325 | 3300049574 | Bacteria | 1661 |
| 468 | Ga0501039_0442581 | 3300049575 | Bacteria | 1020 |
| 469 | Ga0501039_1142464 | 3300049575 | Bacteria | 603 |
| 470 | Ga0501039_1314004 | 3300049575 | Bacteria | 558 |
| 471 | Ga0501040_0082914 | 3300049576 | Bacteria | 2223 |
| 472 | Ga0501042_0103574 | 3300049578 | Bacteria | 2048 |
| 473 | Ga0501042_0201136 | 3300049578 | Bacteria | 1436 |
| 474 | Ga0501043_0083946 | 3300049579 | Bacteria | 2504 |
| 475 | Ga0501043_0142203 | 3300049579 | Bacteria | 1878 |
| 476 | Ga0501043_0158133 | 3300049579 | Bacteria | 1771 |
| 477 | Ga0501043_0532668 | 3300049579 | Bacteria | 874 |
| 478 | Ga0501046_0045202 | 3300049580 | Bacteria | 3499 |
| 479 | Ga0501046_0274745 | 3300049580 | Bacteria | 1235 |
| 480 | Ga0501046_0652919 | 3300049580 | Bacteria | 743 |
| 481 | Ga0501047_0004130 | 3300049581 | Bacteria | 13665 |
| 482 | Ga0501047_0015205 | 3300049581 | Bacteria | 7328 |
| 483 | Ga0501048_0531137 | 3300049582 | Bacteria | 844 |
| 484 | Ga0501067_0002557 | 3300049583 | Bacteria | 10044 |
| 485 | Ga0501067_0026091 | 3300049583 | Bacteria | 3238 |
| 486 | Ga0501067_0071925 | 3300049583 | Bacteria | 1915 |
| 487 | Ga0501068_0001290 | 3300049584 | Bacteria | 13290 |
| 488 | Ga0501068_0027723 | 3300049584 | Bacteria | 3346 |
| 489 | Ga0501068_0036301 | 3300049584 | Bacteria | 2945 |
| 490 | Ga0501069_0002046 | 3300049585 | Bacteria | 10122 |
| 491 | Ga0501069_0003785 | 3300049585 | Bacteria | 7782 |
| 492 | Ga0501070_0009793 | 3300049586 | Bacteria | 8107 |
| 493 | Ga0501070_0338365 | 3300049586 | Bacteria | 1222 |
| 494 | Ga0501070_0350274 | 3300049586 | Bacteria | 1198 |
| 495 | Ga0501070_0602574 | 3300049586 | Bacteria | 875 |
| 496 | Ga0501071_0001781 | 3300049587 | Bacteria | 12700 |
| 497 | Ga0501072_0002275 | 3300049588 | Bacteria | 14353 |
| 498 | Ga0501072_0002562 | 3300049588 | Bacteria | 13621 |
| 499 | Ga0501072_0085757 | 3300049588 | Bacteria | 2498 |
| 500 | Ga0501073_0009229 | 3300049589 | Bacteria | 7272 |
| 501 | Ga0501073_0134798 | 3300049589 | Bacteria | 1711 |
| 502 | Ga0501073_0435375 | 3300049589 | Bacteria | 906 |
| 503 | Ga0501073_0855445 | 3300049589 | Bacteria | 626 |
| 504 | Ga0501074_0001030 | 3300049590 | Bacteria | 18099 |
| 505 | Ga0501074_0017328 | 3300049590 | Bacteria | 5225 |
| 506 | Ga0501074_0182821 | 3300049590 | Bacteria | 1495 |
| 507 | Ga0501079_0099275 | 3300049741 | Bacteria | 2256 |
| 508 | Ga0501079_0233063 | 3300049741 | Bacteria | 1438 |
| 509 | Ga0501079_0751556 | 3300049741 | Bacteria | 767 |
| 510 | Ga0501080_0038840 | 3300049742 | Bacteria | 4442 |
| 511 | Ga0501080_0061917 | 3300049742 | Bacteria | 3482 |
| 512 | Ga0501080_0063050 | 3300049742 | Bacteria | 3449 |
| 513 | Ga0501080_0257466 | 3300049742 | Bacteria | 1590 |
| 514 | Ga0501080_0437437 | 3300049742 | Bacteria | 1174 |
| 515 | Ga0501083_0009264 | 3300049744 | Bacteria | 6950 |
| 516 | Ga0501083_0031037 | 3300049744 | Bacteria | 3667 |
| 517 | Ga0501083_0052844 | 3300049744 | Bacteria | 2728 |
| 518 | Ga0501035_0162785 | 3300049822 | Bacteria | 1930 |
| 519 | Ga0501035_0174850 | 3300049822 | Bacteria | 1853 |
| 520 | Ga0501035_0274329 | 3300049822 | Bacteria | 1426 |
| 521 | Ga0501035_0368490 | 3300049822 | Bacteria | 1199 |
| 522 | Ga0501044_0005623 | 3300049823 | Bacteria | 13924 |
| 523 | Ga0501044_0014313 | 3300049823 | Bacteria | 8563 |
| 524 | Ga0501044_0150088 | 3300049823 | Bacteria | 2313 |
| 525 | Ga0501044_0550473 | 3300049823 | Bacteria | 1051 |
| 526 | nmdc:mga05p37_580783_c1 | 3300050507 | Bacteria | 1269 |
| 527 | nmdc:mga09592_276946_c1 | 3300050508 | Bacteria | 1455 |
| 528 | nmdc:mga06r32_1657111_c1 | 3300050510 | Bacteria | 577 |
| 529 | nmdc:mga06r32_379284_c1 | 3300050510 | Bacteria | 1397 |
| 530 | nmdc:mga08y16_2398_c1 | 3300050511 | Bacteria | 19250 |
| 531 | Ga0500610_0017213 | 3300053079 | Bacteria | 3466 |
| 532 | Ga0500643_000108 | 3300053087 | Bacteria | 86547 |
| 533 | Ga0500646_0027234 | 3300053090 | Bacteria | 1554 |
| 534 | Ga0500651_0060273 | 3300053093 | Bacteria | 2372 |
| 535 | Ga0500555_000942 | 3300053103 | Bacteria | 10118 |
| 536 | Ga0500588_0317910 | 3300053146 | Bacteria | 590 |
| 537 | Ga0500637_0549292 | 3300053178 | Unclassified | 560 |
| 538 | Ga0500645_002222 | 3300053730 | Bacteria | 8853 |
| 539 | Ga0501084_0012052 | 3300054114 | Bacteria | 7160 |
| 540 | Ga0501084_0107983 | 3300054114 | Bacteria | 2338 |
| 541 | Ga0501084_0474579 | 3300054114 | Bacteria | 1057 |
| 542 | Ga0500661_009297 | 3300055283 | Bacteria | 1802 |
| 543 | Ga0501082_0017987 | 3300060353 | Bacteria | 6087 |
| 544 | Ga0501082_0043888 | 3300060353 | Bacteria | 3857 |
| 545 | Ga0501082_0088743 | 3300060353 | Bacteria | 2668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002705 | JGI25156J39149_1011621 | JGI25156J39149_10116213 | 113 |
| 2 | 3300006844 | Ga0075428_100730358 | Ga0075428_1007303582 | 113 |
| 3 | 3300006880 | Ga0075429_100203871 | Ga0075429_1002038712 | 113 |
| 4 | 3300020069 | Ga0197907_11481889 | Ga0197907_114818891 | 113 |
| 5 | 3300020076 | Ga0206355_1403764 | Ga0206355_14037642 | 113 |
| 6 | 3300025256 | Ga0209759_1005589 | Ga0209759_10055895 | 113 |
| 7 | 3300025272 | Ga0209455_1000338 | Ga0209455_100033837 | 113 |
| 8 | 3300025913 | Ga0207695_10003762 | Ga0207695_1000376212 | 113 |
| 9 | 3300025949 | Ga0207667_10125646 | Ga0207667_101256461 | 113 |
| 10 | 3300049573 | Ga0501037_0049477 | Ga0501037_0049477_1012_1416 | 113 |
| 11 | 3300049574 | Ga0501038_0092547 | Ga0501038_0092547_1858_2262 | 113 |
| 12 | 3300049578 | Ga0501042_0103574 | Ga0501042_0103574_204_608 | 113 |
| 13 | 3300049579 | Ga0501043_0532668 | Ga0501043_0532668_87_491 | 113 |
| 14 | 3300049580 | Ga0501046_0652919 | Ga0501046_0652919_18_422 | 113 |
| 15 | 3300049742 | Ga0501080_0437437 | Ga0501080_0437437_310_714 | 113 |
| 16 | 3300049822 | Ga0501035_0274329 | Ga0501035_0274329_87_491 | 113 |
| 17 | 3300049823 | Ga0501044_0150088 | Ga0501044_0150088_475_879 | 113 |
| 18 | 3300005366 | Ga0070659_100141151 | Ga0070659_1001411512 | 114 |
| 19 | 3300005458 | Ga0070681_10142129 | Ga0070681_101421291 | 114 |
| 20 | 3300005546 | Ga0070696_100456702 | Ga0070696_1004567022 | 114 |
| 21 | 3300013105 | Ga0157369_10019475 | Ga0157369_100194755 | 114 |
| 22 | 3300014325 | Ga0163163_10135895 | Ga0163163_101358953 | 114 |
| 23 | 3300025904 | Ga0207647_10001205 | Ga0207647_1000120517 | 114 |
| 24 | 3300025912 | Ga0207707_10389183 | Ga0207707_103891833 | 114 |
| 25 | 3300041452 | Ga0451793_1434546 | Ga0451793_1434546_179_523 | 114 |
| 26 | 3300041491 | Ga0451833_1492982 | Ga0451833_1492982_147_491 | 114 |
| 27 | 3300049569 | Ga0501032_0078774 | Ga0501032_0078774_1459_1803 | 114 |
| 28 | 3300049570 | Ga0501033_0145115 | Ga0501033_0145115_980_1324 | 114 |
| 29 | 3300049572 | Ga0501036_0128624 | Ga0501036_0128624_805_1149 | 114 |
| 30 | 3300049573 | Ga0501037_0099898 | Ga0501037_0099898_1567_1911 | 114 |
| 31 | 3300049574 | Ga0501038_0188325 | Ga0501038_0188325_130_474 | 114 |
| 32 | 3300049575 | Ga0501039_0442581 | Ga0501039_0442581_492_836 | 114 |
| 33 | 3300049576 | Ga0501040_0082914 | Ga0501040_0082914_770_1114 | 114 |
| 34 | 3300049578 | Ga0501042_0201136 | Ga0501042_0201136_412_756 | 114 |
| 35 | 3300049579 | Ga0501043_0158133 | Ga0501043_0158133_990_1334 | 114 |
| 36 | 3300049580 | Ga0501046_0045202 | Ga0501046_0045202_2715_3059 | 114 |
| 37 | 3300049583 | Ga0501067_0026091 | Ga0501067_0026091_1498_1842 | 114 |
| 38 | 3300049584 | Ga0501068_0036301 | Ga0501068_0036301_2284_2628 | 114 |
| 39 | 3300049586 | Ga0501070_0350274 | Ga0501070_0350274_208_552 | 114 |
| 40 | 3300049588 | Ga0501072_0085757 | Ga0501072_0085757_1244_1588 | 114 |
| 41 | 3300049589 | Ga0501073_0855445 | Ga0501073_0855445_98_442 | 114 |
| 42 | 3300049590 | Ga0501074_0017328 | Ga0501074_0017328_1252_1596 | 114 |
| 43 | 3300049741 | Ga0501079_0751556 | Ga0501079_0751556_364_708 | 114 |
| 44 | 3300049742 | Ga0501080_0038840 | Ga0501080_0038840_3914_4258 | 114 |
| 45 | 3300049744 | Ga0501083_0052844 | Ga0501083_0052844_1398_1742 | 114 |
| 46 | 3300049822 | Ga0501035_0162785 | Ga0501035_0162785_1223_1567 | 114 |
| 47 | 3300049823 | Ga0501044_0005623 | Ga0501044_0005623_8573_8917 | 114 |
| 48 | 3300050508 | nmdc:mga09592_276946_c1 | nmdc:mga09592_276946_c1_560_922 | 114 |
| 49 | 3300054114 | Ga0501084_0107983 | Ga0501084_0107983_1570_1914 | 114 |
| 50 | 3300060353 | Ga0501082_0043888 | Ga0501082_0043888_2263_2607 | 114 |
| 51 | 3300002077 | JGI24744J21845_10015342 | JGI24744J21845_100153421 | 115 |
| 52 | 3300005295 | Ga0065707_10916251 | Ga0065707_109162512 | 115 |
| 53 | 3300005330 | Ga0070690_101468300 | Ga0070690_1014683001 | 115 |
| 54 | 3300005335 | Ga0070666_10008334 | Ga0070666_100083343 | 115 |
| 55 | 3300005435 | Ga0070714_100007668 | Ga0070714_10000766810 | 115 |
| 56 | 3300006358 | Ga0068871_100882756 | Ga0068871_1008827561 | 115 |
| 57 | 3300009176 | Ga0105242_10275535 | Ga0105242_102755352 | 115 |
| 58 | 3300013297 | Ga0157378_10029176 | Ga0157378_100291765 | 115 |
| 59 | 3300013306 | Ga0163162_11084009 | Ga0163162_110840092 | 115 |
| 60 | 3300025903 | Ga0207680_10008319 | Ga0207680_100083195 | 115 |
| 61 | 3300025929 | Ga0207664_10025617 | Ga0207664_100256175 | 115 |
| 62 | 3300027360 | Ga0209969_1030384 | Ga0209969_10303841 | 115 |
| 63 | 3300042009 | Ga0439451_040265 | Ga0439451_040265_25_372 | 115 |
| 64 | 3300050510 | nmdc:mga06r32_1657111_c1 | nmdc:mga06r32_1657111_c1_198_545 | 115 |
| 65 | 3300005344 | Ga0070661_100394503 | Ga0070661_1003945033 | 116 |
| 66 | 3300005436 | Ga0070713_100248395 | Ga0070713_1002483951 | 116 |
| 67 | 3300009093 | Ga0105240_10659590 | Ga0105240_106595902 | 116 |
| 68 | 3300009094 | Ga0111539_10002218 | Ga0111539_1000221821 | 116 |
| 69 | 3300009098 | Ga0105245_10102171 | Ga0105245_101021713 | 116 |
| 70 | 3300009098 | Ga0105245_13158569 | Ga0105245_131585691 | 116 |
| 71 | 3300010375 | Ga0105239_10022375 | Ga0105239_100223753 | 116 |
| 72 | 3300014325 | Ga0163163_10000168 | Ga0163163_1000016856 | 116 |
| 73 | 3300025927 | Ga0207687_10050737 | Ga0207687_100507372 | 116 |
| 74 | 3300031665 | Ga0316575_10005122 | Ga0316575_100051223 | 116 |
| 75 | 3300041441 | Ga0451787_003194 | Ga0451787_003194_757_1107 | 116 |
| 76 | 3300048929 | Ga0496126_0409263 | Ga0496126_0409263_67_417 | 116 |
| 77 | 3300049571 | Ga0501034_0000793 | Ga0501034_0000793_19578_19928 | 116 |
| 78 | 3300049583 | Ga0501067_0071925 | Ga0501067_0071925_1134_1484 | 116 |
| 79 | 3300049584 | Ga0501068_0001290 | Ga0501068_0001290_1016_1366 | 116 |
| 80 | 3300049585 | Ga0501069_0002046 | Ga0501069_0002046_7717_8067 | 116 |
| 81 | 3300049586 | Ga0501070_0602574 | Ga0501070_0602574_94_444 | 116 |
| 82 | 3300049587 | Ga0501071_0001781 | Ga0501071_0001781_11919_12269 | 116 |
| 83 | 3300049588 | Ga0501072_0002275 | Ga0501072_0002275_2061_2411 | 116 |
| 84 | 3300049589 | Ga0501073_0134798 | Ga0501073_0134798_214_564 | 116 |
| 85 | 3300049590 | Ga0501074_0001030 | Ga0501074_0001030_16372_16722 | 116 |
| 86 | 3300049741 | Ga0501079_0233063 | Ga0501079_0233063_1075_1425 | 116 |
| 87 | 3300049742 | Ga0501080_0257466 | Ga0501080_0257466_107_457 | 116 |
| 88 | 3300049744 | Ga0501083_0031037 | Ga0501083_0031037_246_596 | 116 |
| 89 | 3300050511 | nmdc:mga08y16_2398_c1 | nmdc:mga08y16_2398_c1_9300_9650 | 116 |
| 90 | 3300054114 | Ga0501084_0012052 | Ga0501084_0012052_2012_2362 | 116 |
| 91 | 3300060353 | Ga0501082_0088743 | Ga0501082_0088743_1185_1535 | 116 |
| 92 | 3300005535 | Ga0070684_100458044 | Ga0070684_1004580441 | 117 |
| 93 | 3300005539 | Ga0068853_100415511 | Ga0068853_1004155112 | 117 |
| 94 | 3300005544 | Ga0070686_100841070 | Ga0070686_1008410702 | 117 |
| 95 | 3300005577 | Ga0068857_100728563 | Ga0068857_1007285632 | 117 |
| 96 | 3300005616 | Ga0068852_100241952 | Ga0068852_1002419522 | 117 |
| 97 | 3300005618 | Ga0068864_100098322 | Ga0068864_1000983222 | 117 |
| 98 | 3300005841 | Ga0068863_100090217 | Ga0068863_1000902172 | 117 |
| 99 | 3300005842 | Ga0068858_100090101 | Ga0068858_1000901013 | 117 |
| 100 | 3300005843 | Ga0068860_100003573 | Ga0068860_1000035738 | 117 |
| 101 | 3300006237 | Ga0097621_100254391 | Ga0097621_1002543912 | 117 |
| 102 | 3300006852 | Ga0075433_10603840 | Ga0075433_106038402 | 117 |
| 103 | 3300009545 | Ga0105237_10653241 | Ga0105237_106532412 | 117 |
| 104 | 3300009553 | Ga0105249_10084753 | Ga0105249_100847534 | 117 |
| 105 | 3300009553 | Ga0105249_10182736 | Ga0105249_101827363 | 117 |
| 106 | 3300010375 | Ga0105239_10902616 | Ga0105239_109026162 | 117 |
| 107 | 3300010375 | Ga0105239_12832956 | Ga0105239_128329561 | 117 |
| 108 | 3300011119 | Ga0105246_10070636 | Ga0105246_100706363 | 117 |
| 109 | 3300014325 | Ga0163163_10001009 | Ga0163163_100010097 | 117 |
| 110 | 3300014968 | Ga0157379_10011655 | Ga0157379_100116556 | 117 |
| 111 | 3300025927 | Ga0207687_11049395 | Ga0207687_110493952 | 117 |
| 112 | 3300025931 | Ga0207644_10570153 | Ga0207644_105701532 | 117 |
| 113 | 3300026035 | Ga0207703_10250730 | Ga0207703_102507302 | 117 |
| 114 | 3300026041 | Ga0207639_10399634 | Ga0207639_103996342 | 117 |
| 115 | 3300026088 | Ga0207641_10017887 | Ga0207641_100178872 | 117 |
| 116 | 3300026095 | Ga0207676_10019164 | Ga0207676_100191645 | 117 |
| 117 | 3300026095 | Ga0207676_10346839 | Ga0207676_103468392 | 117 |
| 118 | 3300026116 | Ga0207674_10851693 | Ga0207674_108516932 | 117 |
| 119 | 3300026118 | Ga0207675_102625450 | Ga0207675_1026254502 | 117 |
| 120 | 3300028381 | Ga0268264_10005680 | Ga0268264_100056803 | 117 |
| 121 | 3300028381 | Ga0268264_12046471 | Ga0268264_120464711 | 117 |
| 122 | 3300031824 | Ga0307413_10579183 | Ga0307413_105791832 | 117 |
| 123 | 3300031852 | Ga0307410_11564944 | Ga0307410_115649442 | 117 |
| 124 | 3300031995 | Ga0307409_100052564 | Ga0307409_1000525642 | 117 |
| 125 | 3300032002 | Ga0307416_100061464 | Ga0307416_1000614642 | 117 |
| 126 | 3300032126 | Ga0307415_101439690 | Ga0307415_1014396902 | 117 |
| 127 | 3300039450 | Ga0436363_0890279 | Ga0436363_0890279_41_394 | 117 |
| 128 | 3300053178 | Ga0500637_0549292 | Ga0500637_0549292_84_437 | 117 |
| 129 | 3300005563 | Ga0068855_100007864 | Ga0068855_1000078647 | 118 |
| 130 | 3300005578 | Ga0068854_100026233 | Ga0068854_1000262332 | 118 |
| 131 | 3300005614 | Ga0068856_100038837 | Ga0068856_1000388373 | 118 |
| 132 | 3300005616 | Ga0068852_100113207 | Ga0068852_1001132072 | 118 |
| 133 | 3300005616 | Ga0068852_100179005 | Ga0068852_1001790052 | 118 |
| 134 | 3300005844 | Ga0068862_100178674 | Ga0068862_1001786743 | 118 |
| 135 | 3300009093 | Ga0105240_10023606 | Ga0105240_100236062 | 118 |
| 136 | 3300009174 | Ga0105241_10009561 | Ga0105241_100095616 | 118 |
| 137 | 3300009174 | Ga0105241_10959841 | Ga0105241_109598411 | 118 |
| 138 | 3300009177 | Ga0105248_11487512 | Ga0105248_114875121 | 118 |
| 139 | 3300009551 | Ga0105238_10004618 | Ga0105238_100046182 | 118 |
| 140 | 3300010375 | Ga0105239_10224424 | Ga0105239_102244243 | 118 |
| 141 | 3300013104 | Ga0157370_10107504 | Ga0157370_101075042 | 118 |
| 142 | 3300013105 | Ga0157369_10006929 | Ga0157369_100069292 | 118 |
| 143 | 3300013307 | Ga0157372_10003531 | Ga0157372_100035312 | 118 |
| 144 | 3300025911 | Ga0207654_10000072 | Ga0207654_1000007235 | 118 |
| 145 | 3300025911 | Ga0207654_10054698 | Ga0207654_100546983 | 118 |
| 146 | 3300025913 | Ga0207695_10000256 | Ga0207695_1000025645 | 118 |
| 147 | 3300025914 | Ga0207671_10004173 | Ga0207671_100041736 | 118 |
| 148 | 3300025920 | Ga0207649_10001367 | Ga0207649_100013672 | 118 |
| 149 | 3300025949 | Ga0207667_10017940 | Ga0207667_100179402 | 118 |
| 150 | 3300025981 | Ga0207640_10364707 | Ga0207640_103647071 | 118 |
| 151 | 3300026041 | Ga0207639_10015505 | Ga0207639_100155052 | 118 |
| 152 | 3300026078 | Ga0207702_10006329 | Ga0207702_100063299 | 118 |
| 153 | 3300026078 | Ga0207702_10012695 | Ga0207702_100126956 | 118 |
| 154 | 3300026142 | Ga0207698_10017149 | Ga0207698_100171495 | 118 |
| 155 | 3300031548 | Ga0307408_101952232 | Ga0307408_1019522321 | 118 |
| 156 | 3300041498 | Ga0451841_1038888 | Ga0451841_1038888_222_635 | 118 |
| 157 | 3300049570 | Ga0501033_0090845 | Ga0501033_0090845_1207_1563 | 118 |
| 158 | 3300049571 | Ga0501034_0109115 | Ga0501034_0109115_608_964 | 118 |
| 159 | 3300049571 | Ga0501034_0130865 | Ga0501034_0130865_188_544 | 118 |
| 160 | 3300049572 | Ga0501036_0069503 | Ga0501036_0069503_1572_1928 | 118 |
| 161 | 3300049573 | Ga0501037_0080609 | Ga0501037_0080609_1556_1912 | 118 |
| 162 | 3300049574 | Ga0501038_0019255 | Ga0501038_0019255_4020_4376 | 118 |
| 163 | 3300049575 | Ga0501039_1142464 | Ga0501039_1142464_176_532 | 118 |
| 164 | 3300049575 | Ga0501039_1314004 | Ga0501039_1314004_174_530 | 118 |
| 165 | 3300049579 | Ga0501043_0083946 | Ga0501043_0083946_1114_1470 | 118 |
| 166 | 3300049579 | Ga0501043_0142203 | Ga0501043_0142203_817_1173 | 118 |
| 167 | 3300049580 | Ga0501046_0274745 | Ga0501046_0274745_69_425 | 118 |
| 168 | 3300049581 | Ga0501047_0004130 | Ga0501047_0004130_8025_8381 | 118 |
| 169 | 3300049581 | Ga0501047_0015205 | Ga0501047_0015205_4048_4404 | 118 |
| 170 | 3300049582 | Ga0501048_0531137 | Ga0501048_0531137_379_735 | 118 |
| 171 | 3300049583 | Ga0501067_0002557 | Ga0501067_0002557_374_730 | 118 |
| 172 | 3300049584 | Ga0501068_0027723 | Ga0501068_0027723_758_1114 | 118 |
| 173 | 3300049585 | Ga0501069_0003785 | Ga0501069_0003785_1505_1861 | 118 |
| 174 | 3300049586 | Ga0501070_0009793 | Ga0501070_0009793_5261_5617 | 118 |
| 175 | 3300049586 | Ga0501070_0338365 | Ga0501070_0338365_579_935 | 118 |
| 176 | 3300049588 | Ga0501072_0002562 | Ga0501072_0002562_6176_6532 | 118 |
| 177 | 3300049589 | Ga0501073_0009229 | Ga0501073_0009229_1878_2234 | 118 |
| 178 | 3300049589 | Ga0501073_0435375 | Ga0501073_0435375_239_595 | 118 |
| 179 | 3300049590 | Ga0501074_0182821 | Ga0501074_0182821_111_467 | 118 |
| 180 | 3300049741 | Ga0501079_0099275 | Ga0501079_0099275_217_573 | 118 |
| 181 | 3300049742 | Ga0501080_0061917 | Ga0501080_0061917_2518_2874 | 118 |
| 182 | 3300049742 | Ga0501080_0063050 | Ga0501080_0063050_1145_1501 | 118 |
| 183 | 3300049744 | Ga0501083_0009264 | Ga0501083_0009264_1740_2096 | 118 |
| 184 | 3300049822 | Ga0501035_0174850 | Ga0501035_0174850_102_458 | 118 |
| 185 | 3300049822 | Ga0501035_0368490 | Ga0501035_0368490_298_654 | 118 |
| 186 | 3300049823 | Ga0501044_0014313 | Ga0501044_0014313_3306_3662 | 118 |
| 187 | 3300049823 | Ga0501044_0550473 | Ga0501044_0550473_298_654 | 118 |
| 188 | 3300054114 | Ga0501084_0474579 | Ga0501084_0474579_423_779 | 118 |
| 189 | 3300060353 | Ga0501082_0017987 | Ga0501082_0017987_3865_4221 | 118 |
| 190 | 3300005367 | Ga0070667_100221091 | Ga0070667_1002210912 | 119 |
| 191 | 3300005455 | Ga0070663_100069357 | Ga0070663_1000693573 | 119 |
| 192 | 3300005455 | Ga0070663_100152507 | Ga0070663_1001525072 | 119 |
| 193 | 3300005539 | Ga0068853_100000139 | Ga0068853_10000013940 | 119 |
| 194 | 3300005539 | Ga0068853_100379696 | Ga0068853_1003796961 | 119 |
| 195 | 3300005539 | Ga0068853_102158053 | Ga0068853_1021580531 | 119 |
| 196 | 3300005548 | Ga0070665_100006815 | Ga0070665_1000068155 | 119 |
| 197 | 3300005548 | Ga0070665_100272192 | Ga0070665_1002721923 | 119 |
| 198 | 3300005563 | Ga0068855_100000186 | Ga0068855_10000018637 | 119 |
| 199 | 3300005577 | Ga0068857_100260932 | Ga0068857_1002609322 | 119 |
| 200 | 3300005617 | Ga0068859_100056601 | Ga0068859_1000566014 | 119 |
| 201 | 3300005841 | Ga0068863_100044942 | Ga0068863_1000449423 | 119 |
| 202 | 3300005841 | Ga0068863_100054389 | Ga0068863_1000543894 | 119 |
| 203 | 3300005841 | Ga0068863_100784894 | Ga0068863_1007848942 | 119 |
| 204 | 3300006237 | Ga0097621_100155073 | Ga0097621_1001550732 | 119 |
| 205 | 3300006358 | Ga0068871_100023400 | Ga0068871_1000234003 | 119 |
| 206 | 3300006881 | Ga0068865_100241278 | Ga0068865_1002412781 | 119 |
| 207 | 3300006931 | Ga0097620_100056601 | Ga0097620_1000566014 | 119 |
| 208 | 3300009101 | Ga0105247_10286136 | Ga0105247_102861361 | 119 |
| 209 | 3300009148 | Ga0105243_10371187 | Ga0105243_103711873 | 119 |
| 210 | 3300009177 | Ga0105248_12863982 | Ga0105248_128639821 | 119 |
| 211 | 3300009545 | Ga0105237_11045689 | Ga0105237_110456892 | 119 |
| 212 | 3300009553 | Ga0105249_10546295 | Ga0105249_105462952 | 119 |
| 213 | 3300010375 | Ga0105239_10013394 | Ga0105239_100133943 | 119 |
| 214 | 3300013297 | Ga0157378_10288542 | Ga0157378_102885422 | 119 |
| 215 | 3300013308 | Ga0157375_10124721 | Ga0157375_101247213 | 119 |
| 216 | 3300017792 | Ga0163161_10023223 | Ga0163161_100232235 | 119 |
| 217 | 3300025273 | Ga0209673_1117922 | Ga0209673_11179222 | 119 |
| 218 | 3300025914 | Ga0207671_11108444 | Ga0207671_111084442 | 119 |
| 219 | 3300025918 | Ga0207662_10474321 | Ga0207662_104743212 | 119 |
| 220 | 3300025935 | Ga0207709_11576128 | Ga0207709_115761282 | 119 |
| 221 | 3300025937 | Ga0207669_10384927 | Ga0207669_103849272 | 119 |
| 222 | 3300025938 | Ga0207704_10345391 | Ga0207704_103453912 | 119 |
| 223 | 3300025941 | Ga0207711_10299119 | Ga0207711_102991192 | 119 |
| 224 | 3300025949 | Ga0207667_10015167 | Ga0207667_100151672 | 119 |
| 225 | 3300025961 | Ga0207712_10339919 | Ga0207712_103399193 | 119 |
| 226 | 3300025986 | Ga0207658_10324780 | Ga0207658_103247802 | 119 |
| 227 | 3300026041 | Ga0207639_10000931 | Ga0207639_1000093115 | 119 |
| 228 | 3300026041 | Ga0207639_10095285 | Ga0207639_100952853 | 119 |
| 229 | 3300026067 | Ga0207678_10009391 | Ga0207678_100093915 | 119 |
| 230 | 3300026067 | Ga0207678_10162477 | Ga0207678_101624773 | 119 |
| 231 | 3300026088 | Ga0207641_10011588 | Ga0207641_100115884 | 119 |
| 232 | 3300026088 | Ga0207641_10034940 | Ga0207641_100349404 | 119 |
| 233 | 3300026088 | Ga0207641_10453211 | Ga0207641_104532113 | 119 |
| 234 | 3300026116 | Ga0207674_10472425 | Ga0207674_104724252 | 119 |
| 235 | 3300026116 | Ga0207674_10570972 | Ga0207674_105709722 | 119 |
| 236 | 3300028379 | Ga0268266_10046248 | Ga0268266_100462482 | 119 |
| 237 | 3300028379 | Ga0268266_10398226 | Ga0268266_103982262 | 119 |
| 238 | 3300041441 | Ga0451787_108926 | Ga0451787_108926_182_544 | 119 |
| 239 | 3300041451 | Ga0451791_0262041 | Ga0451791_0262041_224_586 | 119 |
| 240 | 3300041460 | Ga0451802_0511048 | Ga0451802_0511048_2764_3126 | 119 |
| 241 | 3300041491 | Ga0451833_0775520 | Ga0451833_0775520_1778_2140 | 119 |
| 242 | 3300041494 | Ga0451837_0859325 | Ga0451837_0859325_373_741 | 119 |
| 243 | 3300048911 | Ga0496108_0670168 | Ga0496108_0670168_301_663 | 119 |
| 244 | 3300048924 | Ga0496121_0869874 | Ga0496121_0869874_140_502 | 119 |
| 245 | 3300053079 | Ga0500610_0017213 | Ga0500610_0017213_2422_2787 | 119 |
| 246 | 3300053146 | Ga0500588_0317910 | Ga0500588_0317910_133_498 | 119 |
| 247 | 3300055283 | Ga0500661_009297 | Ga0500661_009297_1333_1701 | 119 |
| 248 | 3300005354 | Ga0070675_100595125 | Ga0070675_1005951251 | 120 |
| 249 | 3300005439 | Ga0070711_100615740 | Ga0070711_1006157402 | 120 |
| 250 | 3300005616 | Ga0068852_100087251 | Ga0068852_1000872511 | 120 |
| 251 | 3300005842 | Ga0068858_100213548 | Ga0068858_1002135482 | 120 |
| 252 | 3300005843 | Ga0068860_100372058 | Ga0068860_1003720582 | 120 |
| 253 | 3300009098 | Ga0105245_12032415 | Ga0105245_120324151 | 120 |
| 254 | 3300009177 | Ga0105248_10667066 | Ga0105248_106670662 | 120 |
| 255 | 3300010375 | Ga0105239_10047052 | Ga0105239_100470522 | 120 |
| 256 | 3300013296 | Ga0157374_11170401 | Ga0157374_111704012 | 120 |
| 257 | 3300014325 | Ga0163163_10028802 | Ga0163163_100288022 | 120 |
| 258 | 3300014969 | Ga0157376_10067528 | Ga0157376_100675283 | 120 |
| 259 | 3300025916 | Ga0207663_10482091 | Ga0207663_104820912 | 120 |
| 260 | 3300025927 | Ga0207687_10089002 | Ga0207687_100890023 | 120 |
| 261 | 3300025986 | Ga0207658_10197722 | Ga0207658_101977222 | 120 |
| 262 | 3300026035 | Ga0207703_11122377 | Ga0207703_111223772 | 120 |
| 263 | 3300026041 | Ga0207639_10038167 | Ga0207639_100381673 | 120 |
| 264 | 3300026041 | Ga0207639_12211288 | Ga0207639_122112881 | 120 |
| 265 | 3300026142 | Ga0207698_10060220 | Ga0207698_100602201 | 120 |
| 266 | 3300028381 | Ga0268264_10410559 | Ga0268264_104105592 | 120 |
| 267 | 3300031730 | Ga0307516_10104907 | Ga0307516_101049072 | 120 |
| 268 | 3300031995 | Ga0307409_100152459 | Ga0307409_1001524593 | 120 |
| 269 | 3300041453 | Ga0451797_1213514 | Ga0451797_1213514_442_813 | 120 |
| 270 | 3300041494 | Ga0451837_1101813 | Ga0451837_1101813_1019_1390 | 120 |
| 271 | 3300041509 | Ga0451843_0311453 | Ga0451843_0311453_446_817 | 120 |
| 272 | 3300048920 | Ga0496117_0083891 | Ga0496117_0083891_416_787 | 120 |
| 273 | 3300048921 | Ga0496118_0000429 | Ga0496118_0000429_23209_23580 | 120 |
| 274 | 3300048923 | Ga0496120_0073946 | Ga0496120_0073946_1478_1852 | 120 |
| 275 | 3300048924 | Ga0496121_0422672 | Ga0496121_0422672_457_828 | 120 |
| 276 | 3300048929 | Ga0496126_0404230 | Ga0496126_0404230_329_700 | 120 |
| 277 | 3300053093 | Ga0500651_0060273 | Ga0500651_0060273_1251_1619 | 120 |
| 278 | iso_pu_bacteria | 2895395659 | 2895396936 | 120 |
| 279 | iso_pu_bacteria | 2939611941 | 2939614260 | 120 |
| 280 | 3300005456 | Ga0070678_101235400 | Ga0070678_1012354002 | 121 |
| 281 | 3300013104 | Ga0157370_10369029 | Ga0157370_103690293 | 121 |
| 282 | 3300014497 | Ga0182008_10290651 | Ga0182008_102906511 | 121 |
| 283 | 3300014968 | Ga0157379_10599198 | Ga0157379_105991983 | 121 |
| 284 | 3300015262 | Ga0182007_10048943 | Ga0182007_100489431 | 121 |
| 285 | 3300025931 | Ga0207644_11452705 | Ga0207644_114527052 | 121 |
| 286 | 3300025961 | Ga0207712_10326375 | Ga0207712_103263752 | 121 |
| 287 | 3300026121 | Ga0207683_10138081 | Ga0207683_101380813 | 121 |
| 288 | 3300050507 | nmdc:mga05p37_580783_c1 | nmdc:mga05p37_580783_c1_460_837 | 121 |
| 289 | 3300050510 | nmdc:mga06r32_379284_c1 | nmdc:mga06r32_379284_c1_361_738 | 121 |
| 290 | iso_pu_bacteria | 2593339239 | 2595451761 | 121 |
| 291 | iso_pu_bacteria | 2718218334 | 2721026615 | 121 |
| 292 | iso_pu_bacteria | 2734482264 | 2735833389 | 121 |
| 293 | iso_pu_bacteria | 2738543009 | 2739229386 | 121 |
| 294 | iso_pu_bacteria | 2842918807 | 2842919774 | 121 |
| 295 | iso_pu_bacteria | 2919404418 | 2919404841 | 121 |
| 296 | iso_pu_bacteria | 2953994433 | 2953995073 | 121 |
| 297 | 3300005337 | Ga0070682_100750858 | Ga0070682_1007508581 | 122 |
| 298 | 3300005355 | Ga0070671_100817703 | Ga0070671_1008177031 | 122 |
| 299 | 3300005539 | Ga0068853_100028883 | Ga0068853_1000288832 | 122 |
| 300 | 3300005547 | Ga0070693_100033651 | Ga0070693_1000336512 | 122 |
| 301 | 3300005614 | Ga0068856_100182347 | Ga0068856_1001823473 | 122 |
| 302 | 3300009177 | Ga0105248_10037032 | Ga0105248_100370326 | 122 |
| 303 | 3300013307 | Ga0157372_10062647 | Ga0157372_100626474 | 122 |
| 304 | 3300013308 | Ga0157375_10169352 | Ga0157375_101693521 | 122 |
| 305 | 3300026078 | Ga0207702_10154401 | Ga0207702_101544013 | 122 |
| 306 | 3300035089 | Ga0373944_0113939 | Ga0373944_0113939_387_800 | 122 |
| 307 | 3300035111 | Ga0373923_0123727 | Ga0373923_0123727_101_514 | 122 |
| 308 | 3300035120 | Ga0373957_0154264 | Ga0373957_0154264_158_571 | 122 |
| 309 | 3300035725 | Ga0373947_0251575 | Ga0373947_0251575_718_1131 | 122 |
| 310 | 3300046462 | Ga0495651_0471692 | Ga0495651_0471692_317_730 | 122 |
| 311 | 3300046475 | Ga0495639_0060953 | Ga0495639_0060953_1077_1490 | 122 |
| 312 | 3300046681 | Ga0495647_0056370 | Ga0495647_0056370_210_623 | 122 |
| 313 | 3300047319 | Ga0495674_0222044 | Ga0495674_0222044_230_643 | 122 |
| 314 | iso_pu_bacteria | 2643221577 | 2643894148 | 122 |
| 315 | iso_pu_bacteria | 2643221685 | 2644476351 | 122 |
| 316 | 3300005356 | Ga0070674_100170543 | Ga0070674_1001705431 | 123 |
| 317 | 3300005457 | Ga0070662_100074458 | Ga0070662_1000744583 | 123 |
| 318 | 3300005618 | Ga0068864_100074532 | Ga0068864_1000745323 | 123 |
| 319 | 3300005843 | Ga0068860_100629450 | Ga0068860_1006294503 | 123 |
| 320 | 3300005844 | Ga0068862_101696206 | Ga0068862_1016962061 | 123 |
| 321 | 3300006881 | Ga0068865_100051301 | Ga0068865_1000513014 | 123 |
| 322 | 3300025928 | Ga0207700_10977203 | Ga0207700_109772031 | 123 |
| 323 | 3300026121 | Ga0207683_10227822 | Ga0207683_102278222 | 123 |
| 324 | 3300028380 | Ga0268265_10804010 | Ga0268265_108040102 | 123 |
| 325 | 3300041512 | Ga0451853_0913553 | Ga0451853_0913553_239_619 | 123 |
| 326 | iso_pu_bacteria | 2884338543 | 2884341382 | 123 |
| 327 | iso_pu_bacteria | 2941471342 | 2941472840 | 123 |
| 328 | 3300002772 | JGI25164J39214_1001086 | JGI25164J39214_10010862 | 124 |
| 329 | 3300003214 | JGI25165J46597_1004623 | JGI25165J46597_10046233 | 124 |
| 330 | 3300005327 | Ga0070658_10260004 | Ga0070658_102600042 | 124 |
| 331 | 3300005329 | Ga0070683_100465561 | Ga0070683_1004655612 | 124 |
| 332 | 3300005336 | Ga0070680_100348622 | Ga0070680_1003486222 | 124 |
| 333 | 3300005337 | Ga0070682_100092289 | Ga0070682_1000922893 | 124 |
| 334 | 3300005339 | Ga0070660_100104837 | Ga0070660_1001048373 | 124 |
| 335 | 3300005339 | Ga0070660_100297180 | Ga0070660_1002971802 | 124 |
| 336 | 3300005366 | Ga0070659_100021966 | Ga0070659_1000219662 | 124 |
| 337 | 3300005366 | Ga0070659_100331704 | Ga0070659_1003317043 | 124 |
| 338 | 3300005457 | Ga0070662_100707460 | Ga0070662_1007074601 | 124 |
| 339 | 3300005458 | Ga0070681_10003594 | Ga0070681_1000359413 | 124 |
| 340 | 3300005458 | Ga0070681_10202353 | Ga0070681_102023533 | 124 |
| 341 | 3300005518 | Ga0070699_100824449 | Ga0070699_1008244491 | 124 |
| 342 | 3300005530 | Ga0070679_100446724 | Ga0070679_1004467242 | 124 |
| 343 | 3300005539 | Ga0068853_100215811 | Ga0068853_1002158113 | 124 |
| 344 | 3300005546 | Ga0070696_100032116 | Ga0070696_1000321164 | 124 |
| 345 | 3300005546 | Ga0070696_100628279 | Ga0070696_1006282791 | 124 |
| 346 | 3300005547 | Ga0070693_100037313 | Ga0070693_1000373134 | 124 |
| 347 | 3300005577 | Ga0068857_100212506 | Ga0068857_1002125062 | 124 |
| 348 | 3300005614 | Ga0068856_100215296 | Ga0068856_1002152963 | 124 |
| 349 | 3300005843 | Ga0068860_100009355 | Ga0068860_1000093557 | 124 |
| 350 | 3300006175 | Ga0070712_100537656 | Ga0070712_1005376562 | 124 |
| 351 | 3300009176 | Ga0105242_10017183 | Ga0105242_100171836 | 124 |
| 352 | 3300009545 | Ga0105237_10038334 | Ga0105237_100383343 | 124 |
| 353 | 3300009551 | Ga0105238_10209973 | Ga0105238_102099733 | 124 |
| 354 | 3300013102 | Ga0157371_10181349 | Ga0157371_101813492 | 124 |
| 355 | 3300013306 | Ga0163162_10010474 | Ga0163162_100104743 | 124 |
| 356 | 3300013307 | Ga0157372_11967464 | Ga0157372_119674641 | 124 |
| 357 | 3300013308 | Ga0157375_10001312 | Ga0157375_1000131215 | 124 |
| 358 | 3300014497 | Ga0182008_10098115 | Ga0182008_100981151 | 124 |
| 359 | 3300015262 | Ga0182007_10090847 | Ga0182007_100908471 | 124 |
| 360 | 3300015262 | Ga0182007_10139647 | Ga0182007_101396472 | 124 |
| 361 | 3300025226 | Ga0209674_102261 | Ga0209674_1022612 | 124 |
| 362 | 3300025231 | Ga0207427_100334 | Ga0207427_10033433 | 124 |
| 363 | 3300025233 | Ga0209437_100139 | Ga0209437_100139103 | 124 |
| 364 | 3300025261 | Ga0209233_1000083 | Ga0209233_1000083170 | 124 |
| 365 | 3300025261 | Ga0209233_1000191 | Ga0209233_100019142 | 124 |
| 366 | 3300025904 | Ga0207647_10067789 | Ga0207647_100677893 | 124 |
| 367 | 3300025909 | Ga0207705_10008424 | Ga0207705_100084246 | 124 |
| 368 | 3300025909 | Ga0207705_10204906 | Ga0207705_102049061 | 124 |
| 369 | 3300025912 | Ga0207707_10164066 | Ga0207707_101640662 | 124 |
| 370 | 3300025914 | Ga0207671_10600912 | Ga0207671_106009122 | 124 |
| 371 | 3300025915 | Ga0207693_10474804 | Ga0207693_104748042 | 124 |
| 372 | 3300025917 | Ga0207660_10030205 | Ga0207660_100302052 | 124 |
| 373 | 3300025919 | Ga0207657_10204814 | Ga0207657_102048143 | 124 |
| 374 | 3300025919 | Ga0207657_10279886 | Ga0207657_102798863 | 124 |
| 375 | 3300025921 | Ga0207652_10266346 | Ga0207652_102663463 | 124 |
| 376 | 3300025924 | Ga0207694_10225229 | Ga0207694_102252293 | 124 |
| 377 | 3300025929 | Ga0207664_10000239 | Ga0207664_1000023939 | 124 |
| 378 | 3300025929 | Ga0207664_10006000 | Ga0207664_100060002 | 124 |
| 379 | 3300025932 | Ga0207690_10000586 | Ga0207690_1000058620 | 124 |
| 380 | 3300025932 | Ga0207690_10044195 | Ga0207690_100441953 | 124 |
| 381 | 3300025932 | Ga0207690_10110331 | Ga0207690_101103312 | 124 |
| 382 | 3300025933 | Ga0207706_10246472 | Ga0207706_102464722 | 124 |
| 383 | 3300025934 | Ga0207686_10342964 | Ga0207686_103429642 | 124 |
| 384 | 3300025938 | Ga0207704_10442880 | Ga0207704_104428801 | 124 |
| 385 | 3300026041 | Ga0207639_10039740 | Ga0207639_100397402 | 124 |
| 386 | 3300026067 | Ga0207678_10289904 | Ga0207678_102899043 | 124 |
| 387 | 3300026116 | Ga0207674_10115469 | Ga0207674_101154692 | 124 |
| 388 | 3300028381 | Ga0268264_10013949 | Ga0268264_100139493 | 124 |
| 389 | 3300037418 | Ga0395900_0206167 | Ga0395900_0206167_1393_1773 | 124 |
| 390 | 3300038443 | Ga0395901_0000816 | Ga0395901_0000816_1081_1461 | 124 |
| 391 | 3300038443 | Ga0395901_1677047 | Ga0395901_1677047_113_493 | 124 |
| 392 | 3300041491 | Ga0451833_0823068 | Ga0451833_0823068_140_544 | 124 |
| 393 | 3300042006 | Ga0439432_030621 | Ga0439432_030621_680_1060 | 124 |
| 394 | 3300044719 | Ga0466971_0088792 | Ga0466971_0088792_406_795 | 124 |
| 395 | 3300045836 | Ga0466958_0087539 | Ga0466958_0087539_654_1043 | 124 |
| 396 | 3300002075 | JGI24738J21930_10059907 | JGI24738J21930_100599072 | 125 |
| 397 | 3300003578 | Ga0006562J51391_1073321 | Ga0006562J51391_10733211 | 125 |
| 398 | 3300003578 | Ga0006562J51391_1073322 | Ga0006562J51391_10733226 | 125 |
| 399 | 3300003752 | Ga0055539_1001755 | Ga0055539_10017555 | 125 |
| 400 | 3300003756 | Ga0055533_1013385 | Ga0055533_10133852 | 125 |
| 401 | 3300003760 | Ga0055527_1000082 | Ga0055527_100008236 | 125 |
| 402 | 3300003761 | Ga0055535_1000143 | Ga0055535_100014336 | 125 |
| 403 | 3300003762 | Ga0055542_1000190 | Ga0055542_100019040 | 125 |
| 404 | 3300003763 | Ga0055529_1000217 | Ga0055529_100021740 | 125 |
| 405 | 3300005262 | Ga0065165_1000028 | Ga0065165_1000028123 | 125 |
| 406 | 3300005344 | Ga0070661_100046195 | Ga0070661_1000461951 | 125 |
| 407 | 3300005455 | Ga0070663_100057755 | Ga0070663_1000577553 | 125 |
| 408 | 3300005614 | Ga0068856_100011969 | Ga0068856_1000119692 | 125 |
| 409 | 3300010375 | Ga0105239_10146472 | Ga0105239_101464723 | 125 |
| 410 | 3300010375 | Ga0105239_10406279 | Ga0105239_104062792 | 125 |
| 411 | 3300013104 | Ga0157370_10251550 | Ga0157370_102515502 | 125 |
| 412 | 3300013105 | Ga0157369_10233503 | Ga0157369_102335033 | 125 |
| 413 | 3300013306 | Ga0163162_10379841 | Ga0163162_103798412 | 125 |
| 414 | 3300014497 | Ga0182008_10001813 | Ga0182008_100018132 | 125 |
| 415 | 3300015261 | Ga0182006_1000072 | Ga0182006_100007226 | 125 |
| 416 | 3300015261 | Ga0182006_1014700 | Ga0182006_10147002 | 125 |
| 417 | 3300015262 | Ga0182007_10003436 | Ga0182007_100034366 | 125 |
| 418 | 3300015265 | Ga0182005_1000080 | Ga0182005_100008048 | 125 |
| 419 | 3300015265 | Ga0182005_1004229 | Ga0182005_10042294 | 125 |
| 420 | 3300015265 | Ga0182005_1008595 | Ga0182005_10085953 | 125 |
| 421 | 3300017792 | Ga0163161_10002457 | Ga0163161_100024576 | 125 |
| 422 | 3300025226 | Ga0209674_100119 | Ga0209674_10011964 | 125 |
| 423 | 3300025226 | Ga0209674_100426 | Ga0209674_10042617 | 125 |
| 424 | 3300025228 | Ga0209672_100016 | Ga0209672_100016366 | 125 |
| 425 | 3300025242 | Ga0209258_100012 | Ga0209258_100012507 | 125 |
| 426 | 3300025253 | Ga0209677_116022 | Ga0209677_1160221 | 125 |
| 427 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014149 | 125 |
| 428 | 3300025272 | Ga0209455_1000014 | Ga0209455_100001437 | 125 |
| 429 | 3300025299 | Ga0209256_1004462 | Ga0209256_10044629 | 125 |
| 430 | 3300025303 | Ga0209051_1037076 | Ga0209051_10370761 | 125 |
| 431 | 3300025900 | Ga0207710_10024201 | Ga0207710_100242013 | 125 |
| 432 | 3300025904 | Ga0207647_10000029 | Ga0207647_1000002912 | 125 |
| 433 | 3300025920 | Ga0207649_10122482 | Ga0207649_101224822 | 125 |
| 434 | 3300025920 | Ga0207649_10678523 | Ga0207649_106785232 | 125 |
| 435 | 3300025932 | Ga0207690_10000448 | Ga0207690_1000044822 | 125 |
| 436 | 3300025949 | Ga0207667_10080089 | Ga0207667_100800893 | 125 |
| 437 | 3300026067 | Ga0207678_10074977 | Ga0207678_100749771 | 125 |
| 438 | 3300026078 | Ga0207702_10001547 | Ga0207702_100015479 | 125 |
| 439 | 3300026078 | Ga0207702_10248275 | Ga0207702_102482751 | 125 |
| 440 | 3300031731 | Ga0307405_10110686 | Ga0307405_101106863 | 125 |
| 441 | 3300031911 | Ga0307412_10008807 | Ga0307412_100088072 | 125 |
| 442 | 3300037312 | Ga0395899_0047597 | Ga0395899_0047597_691_1083 | 125 |
| 443 | 3300037466 | Ga0395898_0001311 | Ga0395898_0001311_14124_14516 | 125 |
| 444 | 3300038443 | Ga0395901_0843432 | Ga0395901_0843432_205_597 | 125 |
| 445 | 3300041404 | Ga0439436_0000099 | Ga0439436_0000099_18872_19261 | 125 |
| 446 | 3300041413 | Ga0439465_0003612 | Ga0439465_0003612_4138_4527 | 125 |
| 447 | 3300042004 | Ga0439445_0012742 | Ga0439445_0012742_782_1171 | 125 |
| 448 | 3300042128 | Ga0450897_040655 | Ga0450897_040655_36_425 | 125 |
| 449 | 3300042131 | Ga0450894_037729 | Ga0450894_037729_223_612 | 125 |
| 450 | 3300042184 | Ga0450908_002471 | Ga0450908_002471_1437_1826 | 125 |
| 451 | 3300044656 | Ga0466969_0001632 | Ga0466969_0001632_6215_6607 | 125 |
| 452 | 3300044663 | Ga0466989_0020593 | Ga0466989_0020593_2800_3192 | 125 |
| 453 | 3300044684 | Ga0466966_0039686 | Ga0466966_0039686_1862_2254 | 125 |
| 454 | 3300044693 | Ga0466961_0025286 | Ga0466961_0025286_66_458 | 125 |
| 455 | 3300044693 | Ga0466961_0487929 | Ga0466961_0487929_78_470 | 125 |
| 456 | 3300044694 | Ga0466963_0255153 | Ga0466963_0255153_588_980 | 125 |
| 457 | 3300044735 | Ga0466968_0001115 | Ga0466968_0001115_8426_8818 | 125 |
| 458 | 3300044765 | Ga0466970_0024169 | Ga0466970_0024169_2719_3111 | 125 |
| 459 | 3300045049 | Ga0466959_0252405 | Ga0466959_0252405_64_456 | 125 |
| 460 | 3300045836 | Ga0466958_0183193 | Ga0466958_0183193_496_888 | 125 |
| 461 | 3300046452 | Ga0495617_000117 | Ga0495617_000117_32103_32492 | 125 |
| 462 | 3300046452 | Ga0495617_009842 | Ga0495617_009842_1036_1425 | 125 |
| 463 | 3300046460 | Ga0495638_0000153 | Ga0495638_0000153_213_602 | 125 |
| 464 | 3300046460 | Ga0495638_0063908 | Ga0495638_0063908_248_637 | 125 |
| 465 | 3300046471 | Ga0495650_0003006 | Ga0495650_0003006_1435_1824 | 125 |
| 466 | 3300046492 | Ga0495585_0001084 | Ga0495585_0001084_8452_8841 | 125 |
| 467 | 3300046501 | Ga0495607_0000120 | Ga0495607_0000120_76495_76884 | 125 |
| 468 | 3300046506 | Ga0495583_0385049 | Ga0495583_0385049_85_474 | 125 |
| 469 | 3300046507 | Ga0495606_0001210 | Ga0495606_0001210_19075_19464 | 125 |
| 470 | 3300046507 | Ga0495606_0002719 | Ga0495606_0002719_3109_3498 | 125 |
| 471 | 3300046507 | Ga0495606_0025920 | Ga0495606_0025920_690_1079 | 125 |
| 472 | 3300046512 | Ga0495610_0002124 | Ga0495610_0002124_704_1093 | 125 |
| 473 | 3300046512 | Ga0495610_0030866 | Ga0495610_0030866_119_508 | 125 |
| 474 | 3300046513 | Ga0495616_0080241 | Ga0495616_0080241_1045_1434 | 125 |
| 475 | 3300046515 | Ga0495620_0005183 | Ga0495620_0005183_2319_2708 | 125 |
| 476 | 3300046518 | Ga0495631_0000029 | Ga0495631_0000029_85582_85971 | 125 |
| 477 | 3300046518 | Ga0495631_0001826 | Ga0495631_0001826_10744_11133 | 125 |
| 478 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_256351_256740 | 125 |
| 479 | 3300046519 | Ga0495632_0088872 | Ga0495632_0088872_766_1155 | 125 |
| 480 | 3300046522 | Ga0495643_0094780 | Ga0495643_0094780_856_1245 | 125 |
| 481 | 3300046524 | Ga0495648_0001512 | Ga0495648_0001512_13584_13973 | 125 |
| 482 | 3300046524 | Ga0495648_0013046 | Ga0495648_0013046_1536_1925 | 125 |
| 483 | 3300046538 | Ga0495609_0005899 | Ga0495609_0005899_4473_4862 | 125 |
| 484 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2071432_2071821 | 125 |
| 485 | 3300046648 | Ga0495611_0000060 | Ga0495611_0000060_57212_57601 | 125 |
| 486 | 3300046660 | Ga0495625_0000022 | Ga0495625_0000022_184975_185364 | 125 |
| 487 | 3300046660 | Ga0495625_0029807 | Ga0495625_0029807_3620_4009 | 125 |
| 488 | 3300046660 | Ga0495625_0161202 | Ga0495625_0161202_247_636 | 125 |
| 489 | 3300046665 | Ga0495661_0000438 | Ga0495661_0000438_7239_7628 | 125 |
| 490 | 3300046691 | Ga0495670_0005573 | Ga0495670_0005573_343_732 | 125 |
| 491 | 3300046691 | Ga0495670_0038632 | Ga0495670_0038632_481_870 | 125 |
| 492 | 3300046692 | Ga0495671_0024804 | Ga0495671_0024804_1361_1750 | 125 |
| 493 | 3300046694 | Ga0495649_0008445 | Ga0495649_0008445_1094_1483 | 125 |
| 494 | 3300046794 | Ga0495589_0000237 | Ga0495589_0000237_41589_41978 | 125 |
| 495 | 3300046810 | Ga0495660_0000092 | Ga0495660_0000092_8162_8551 | 125 |
| 496 | 3300046810 | Ga0495660_0004103 | Ga0495660_0004103_8105_8494 | 125 |
| 497 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_182191_182580 | 125 |
| 498 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_10379_10768 | 125 |
| 499 | 3300047469 | Ga0495673_0001152 | Ga0495673_0001152_21885_22274 | 125 |
| 500 | 3300047469 | Ga0495673_0001469 | Ga0495673_0001469_16593_16982 | 125 |
| 501 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_93944_94339 | 125 |
| 502 | 3300047472 | Ga0495686_0011096 | Ga0495686_0011096_5043_5432 | 125 |
| 503 | 3300047472 | Ga0495686_0105700 | Ga0495686_0105700_830_1219 | 125 |
| 504 | 3300048903 | Ga0496100_0028387 | Ga0496100_0028387_1389_1778 | 125 |
| 505 | 3300048904 | Ga0496101_0001374 | Ga0496101_0001374_1966_2355 | 125 |
| 506 | 3300048905 | Ga0496102_0387398 | Ga0496102_0387398_614_1009 | 125 |
| 507 | 3300048909 | Ga0496106_0000309 | Ga0496106_0000309_32704_33093 | 125 |
| 508 | 3300048909 | Ga0496106_0921086 | Ga0496106_0921086_156_551 | 125 |
| 509 | 3300048919 | Ga0496116_0116936 | Ga0496116_0116936_919_1314 | 125 |
| 510 | 3300048920 | Ga0496117_0027842 | Ga0496117_0027842_69_464 | 125 |
| 511 | 3300048920 | Ga0496117_0129266 | Ga0496117_0129266_265_660 | 125 |
| 512 | 3300048921 | Ga0496118_0002637 | Ga0496118_0002637_4647_5042 | 125 |
| 513 | 3300048921 | Ga0496118_0092608 | Ga0496118_0092608_276_671 | 125 |
| 514 | 3300048921 | Ga0496118_0503770 | Ga0496118_0503770_15_404 | 125 |
| 515 | 3300048922 | Ga0496119_0071853 | Ga0496119_0071853_965_1354 | 125 |
| 516 | 3300048924 | Ga0496121_0000045 | Ga0496121_0000045_251578_251973 | 125 |
| 517 | 3300048924 | Ga0496121_0006695 | Ga0496121_0006695_13497_13886 | 125 |
| 518 | 3300048924 | Ga0496121_0181665 | Ga0496121_0181665_904_1293 | 125 |
| 519 | 3300048925 | Ga0496122_0181748 | Ga0496122_0181748_45_440 | 125 |
| 520 | 3300048926 | Ga0496123_0017670 | Ga0496123_0017670_2744_3139 | 125 |
| 521 | 3300048927 | Ga0496124_0373776 | Ga0496124_0373776_451_840 | 125 |
| 522 | 3300048928 | Ga0496125_0010765 | Ga0496125_0010765_7427_7822 | 125 |
| 523 | 3300048929 | Ga0496126_0183782 | Ga0496126_0183782_310_705 | 125 |
| 524 | 3300049459 | Ga0495678_001379 | Ga0495678_001379_3892_4281 | 125 |
| 525 | 3300049460 | Ga0495682_0006075 | Ga0495682_0006075_254_643 | 125 |
| 526 | 3300049460 | Ga0495682_0064224 | Ga0495682_0064224_616_1005 | 125 |
| 527 | 3300053087 | Ga0500643_000108 | Ga0500643_000108_11383_11772 | 125 |
| 528 | 3300053103 | Ga0500555_000942 | Ga0500555_000942_8440_8829 | 125 |
| 529 | 3300053730 | Ga0500645_002222 | Ga0500645_002222_7101_7490 | 125 |
| 530 | iso_pu_bacteria | 2919085039 | 2919087588 | 125 |
| 531 | 3300026142 | Ga0207698_10265152 | Ga0207698_102651522 | 126 |
| 532 | 3300001979 | JGI24740J21852_10174049 | JGI24740J21852_101740491 | 127 |
| 533 | 3300005327 | Ga0070658_10001446 | Ga0070658_100014467 | 127 |
| 534 | 3300005335 | Ga0070666_10000007 | Ga0070666_1000000797 | 127 |
| 535 | 3300005344 | Ga0070661_100232873 | Ga0070661_1002328732 | 127 |
| 536 | 3300005347 | Ga0070668_100431163 | Ga0070668_1004311632 | 127 |
| 537 | 3300005367 | Ga0070667_100087948 | Ga0070667_1000879482 | 127 |
| 538 | 3300005548 | Ga0070665_100005386 | Ga0070665_10000538612 | 127 |
| 539 | 3300005843 | Ga0068860_100218111 | Ga0068860_1002181112 | 127 |
| 540 | 3300009176 | Ga0105242_10613184 | Ga0105242_106131841 | 127 |
| 541 | 3300009551 | Ga0105238_10000972 | Ga0105238_1000097228 | 127 |
| 542 | 3300013306 | Ga0163162_10010824 | Ga0163162_100108247 | 127 |
| 543 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002731 | 127 |
| 544 | 3300025909 | Ga0207705_10040657 | Ga0207705_100406573 | 127 |
| 545 | 3300025920 | Ga0207649_10088430 | Ga0207649_100884302 | 127 |
| 546 | 3300025924 | Ga0207694_10000470 | Ga0207694_1000047028 | 127 |
| 547 | 3300025972 | Ga0207668_10766201 | Ga0207668_107662012 | 127 |
| 548 | 3300025986 | Ga0207658_10182141 | Ga0207658_101821413 | 127 |
| 549 | 3300026035 | Ga0207703_11869879 | Ga0207703_118698791 | 127 |
| 550 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004727 | 127 |
| 551 | 3300028381 | Ga0268264_10057271 | Ga0268264_100572714 | 127 |
| 552 | 3300033180 | Ga0307510_10000770 | Ga0307510_100007705 | 127 |
| 553 | 3300046471 | Ga0495650_0000271 | Ga0495650_0000271_49687_50070 | 127 |
| 554 | 3300046471 | Ga0495650_0165229 | Ga0495650_0165229_167_550 | 127 |
| 555 | 3300046660 | Ga0495625_0154886 | Ga0495625_0154886_367_750 | 127 |
| 556 | 3300048921 | Ga0496118_0528659 | Ga0496118_0528659_161_544 | 127 |
| 557 | 3300048924 | Ga0496121_0062715 | Ga0496121_0062715_691_1074 | 127 |
| 558 | 3300048929 | Ga0496126_0058598 | Ga0496126_0058598_1226_1609 | 127 |
| 559 | 3300053090 | Ga0500646_0027234 | Ga0500646_0027234_367_750 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vke-assembly1.cif.gz_F | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.9568 | 24 | 119 |
| 1p8c-assembly1.cif.gz_A | crystal structure of tm1620 (apc4843) from thermotoga maritima | 0.9534 | 15 | 119 |
| 1p8c-assembly1.cif.gz_B | crystal structure of tm1620 (apc4843) from thermotoga maritima | 0.9496 | 8 | 119 |
| 1vke-assembly1.cif.gz_A | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.9457 | 9 | 120 |
| 1vke-assembly1.cif.gz_F | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.9379 | 24 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vkeC00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9705 | 26 | 120 | 1.20.1290.10 |
| 1vkeB00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9618 | 26 | 120 | 1.20.1290.10 |
| 1vkeF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9568 | 24 | 119 | 1.20.1290.10 |
| 1p8cB00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9496 | 8 | 119 | 1.20.1290.10 |
| 1vkeF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9379 | 24 | 119 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1PWW5-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9998 | 46 | 115 |
GO:0051920
|
| AF-A0A2R7P0P1-F1-model_v4 | deleted | 0.9985 | 38 | 116 |
|
| AF-A0A7Z1R3G8-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9965 | 48 | 115 |
GO:0051920
|
| AF-A0A4Y7U3X9-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9961 | 49 | 117 |
GO:0051920
|
| AF-A0A520IVB4-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9957 | 40 | 114 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar