F463545

General Info

Members Datasets Scaffolds Average Seq Length
559 304 545 124

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100784894|Ga0068863_1007848942
Length 141
Sequence MSDDRIAGPSRPSMASEALGLLPGEFTAFRQRMNERILAEDNQVVRRFFALDTQTYKDGALDVKTKEMLGLVASLVLRCDDCISYHVAQCKDAGVKRDEFFEVFSVGLVVGGSIVIPHLRRAVDFLDKVEGGGETASEAKL

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2738543009 Luteibacter sp. OK325 Isolate Unclassified
7 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
8 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
9 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
10 2919085039 Luteibacter sp. 1214 Isolate Unclassified
11 2919404418 Luteibacter sp. 3190 Isolate Unclassified
12 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
13 2941471342 Luteibacter sp. 621 Isolate Unclassified
14 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
196 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
203 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
204 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
244 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
297 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
300 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.72
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 0
Rhizoplane 2.15
Rhizosphere 82.65
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10174049 3300001979 Bacteria 534
2 JGI24738J21930_10059907 3300002075 Bacteria 781
3 JGI24744J21845_10015342 3300002077 Bacteria 1531
4 JGI25156J39149_1011621 3300002705 Bacteria 1981
5 JGI25164J39214_1001086 3300002772 Bacteria 7901
6 JGI25165J46597_1004623 3300003214 Bacteria 2889
7 Ga0006562J51391_1073321 3300003578 Bacteria 6500
8 Ga0006562J51391_1073322 3300003578 Bacteria 5760
9 Ga0055539_1001755 3300003752 Bacteria 3759
10 Ga0055533_1013385 3300003756 Bacteria 845
11 Ga0055527_1000082 3300003760 Bacteria 75048
12 Ga0055535_1000143 3300003761 Bacteria 75049
13 Ga0055542_1000190 3300003762 Bacteria 75049
14 Ga0055529_1000217 3300003763 Bacteria 75049
15 Ga0065165_1000028 3300005262 Bacteria 224430
16 Ga0065707_10916251 3300005295 Bacteria 562
17 Ga0070658_10001446 3300005327 Bacteria 20260
18 Ga0070658_10260004 3300005327 Bacteria 1474
19 Ga0070683_100465561 3300005329 Bacteria 1207
20 Ga0070690_101468300 3300005330 Bacteria 550
21 Ga0070666_10000007 3300005335 Bacteria 293732
22 Ga0070666_10008334 3300005335 Bacteria 6429
23 Ga0070680_100348622 3300005336 Bacteria 1259
24 Ga0070682_100092289 3300005337 Bacteria 1983
25 Ga0070682_100750858 3300005337 Bacteria 788
26 Ga0070660_100104837 3300005339 Bacteria 2243
27 Ga0070660_100297180 3300005339 Bacteria 1323
28 Ga0070661_100046195 3300005344 Bacteria 3185
29 Ga0070661_100232873 3300005344 Bacteria 1416
30 Ga0070661_100394503 3300005344 Bacteria 1093
31 Ga0070668_100431163 3300005347 Bacteria 1130
32 Ga0070675_100595125 3300005354 Bacteria 1003
33 Ga0070671_100817703 3300005355 Bacteria 812
34 Ga0070674_100170543 3300005356 Bacteria 1659
35 Ga0070659_100021966 3300005366 Bacteria 4868
36 Ga0070659_100141151 3300005366 Bacteria 1961
37 Ga0070659_100331704 3300005366 Bacteria 1273
38 Ga0070667_100087948 3300005367 Bacteria 2667
39 Ga0070667_100221091 3300005367 Bacteria 1686
40 Ga0070714_100007668 3300005435 Bacteria 8404
41 Ga0070713_100248395 3300005436 Bacteria 1622
42 Ga0070711_100615740 3300005439 Bacteria 907
43 Ga0070663_100057755 3300005455 Bacteria 2785
44 Ga0070663_100069357 3300005455 Bacteria 2561
45 Ga0070663_100152507 3300005455 Bacteria 1773
46 Ga0070678_101235400 3300005456 Bacteria 694
47 Ga0070662_100074458 3300005457 Bacteria 2512
48 Ga0070662_100707460 3300005457 Bacteria 852
49 Ga0070681_10003594 3300005458 Bacteria 14536
50 Ga0070681_10142129 3300005458 Bacteria 2329
51 Ga0070681_10202353 3300005458 Bacteria 1904
52 Ga0070699_100824449 3300005518 Bacteria 849
53 Ga0070679_100446724 3300005530 Bacteria 1238
54 Ga0070684_100458044 3300005535 Bacteria 1179
55 Ga0068853_100000139 3300005539 Bacteria 49652
56 Ga0068853_100028883 3300005539 Bacteria 4669
57 Ga0068853_100215811 3300005539 Bacteria 1750
58 Ga0068853_100379696 3300005539 Bacteria 1319
59 Ga0068853_100415511 3300005539 Bacteria 1261
60 Ga0068853_102158053 3300005539 Bacteria 540
61 Ga0070686_100841070 3300005544 Bacteria 743
62 Ga0070696_100032116 3300005546 Bacteria 3601
63 Ga0070696_100456702 3300005546 Bacteria 1009
64 Ga0070696_100628279 3300005546 Bacteria 868
65 Ga0070693_100033651 3300005547 Bacteria 2830
66 Ga0070693_100037313 3300005547 Bacteria 2709
67 Ga0070665_100005386 3300005548 Bacteria 13205
68 Ga0070665_100006815 3300005548 Bacteria 11617
69 Ga0070665_100272192 3300005548 Bacteria 1695
70 Ga0068855_100000186 3300005563 Bacteria 79655
71 Ga0068855_100007864 3300005563 Bacteria 12884
72 Ga0068857_100212506 3300005577 Bacteria 1765
73 Ga0068857_100260932 3300005577 Bacteria 1590
74 Ga0068857_100728563 3300005577 Bacteria 943
75 Ga0068854_100026233 3300005578 Bacteria 4003
76 Ga0068856_100011969 3300005614 Bacteria 8401
77 Ga0068856_100038837 3300005614 Bacteria 4673
78 Ga0068856_100182347 3300005614 Bacteria 2113
79 Ga0068856_100215296 3300005614 Bacteria 1936
80 Ga0068852_100087251 3300005616 Bacteria 2783
81 Ga0068852_100113207 3300005616 Bacteria 2470
82 Ga0068852_100179005 3300005616 Bacteria 1992
83 Ga0068852_100241952 3300005616 Bacteria 1725
84 Ga0068859_100056601 3300005617 Bacteria 3948
85 Ga0068864_100074532 3300005618 Bacteria 2961
86 Ga0068864_100098322 3300005618 Bacteria 2592
87 Ga0068863_100044942 3300005841 Bacteria 4192
88 Ga0068863_100054389 3300005841 Bacteria 3792
89 Ga0068863_100090217 3300005841 Bacteria 2906
90 Ga0068863_100784894 3300005841 Bacteria 949
91 Ga0068858_100090101 3300005842 Bacteria 2854
92 Ga0068858_100213548 3300005842 Bacteria 1826
93 Ga0068860_100003573 3300005843 Bacteria 15984
94 Ga0068860_100009355 3300005843 Bacteria 9737
95 Ga0068860_100218111 3300005843 Bacteria 1852
96 Ga0068860_100372058 3300005843 Bacteria 1409
97 Ga0068860_100629450 3300005843 Bacteria 1080
98 Ga0068862_100178674 3300005844 Bacteria 1904
99 Ga0068862_101696206 3300005844 Bacteria 640
100 Ga0070712_100537656 3300006175 Bacteria 983
101 Ga0097621_100155073 3300006237 Bacteria 1965
102 Ga0097621_100254391 3300006237 Bacteria 1539
103 Ga0068871_100023400 3300006358 Bacteria 4778
104 Ga0068871_100882756 3300006358 Bacteria 828
105 Ga0075428_100730358 3300006844 Bacteria 1054
106 Ga0075433_10603840 3300006852 Bacteria 963
107 Ga0075429_100203871 3300006880 Bacteria 1733
108 Ga0068865_100051301 3300006881 Bacteria 2855
109 Ga0068865_100241278 3300006881 Bacteria 1422
110 Ga0097620_100056601 3300006931 Bacteria 3948
111 Ga0105240_10023606 3300009093 Bacteria 8125
112 Ga0105240_10659590 3300009093 Bacteria 1146
113 Ga0111539_10002218 3300009094 Bacteria 25946
114 Ga0105245_10102171 3300009098 Bacteria 2655
115 Ga0105245_12032415 3300009098 Bacteria 628
116 Ga0105245_13158569 3300009098 Bacteria 511
117 Ga0105247_10286136 3300009101 Bacteria 1139
118 Ga0105243_10371187 3300009148 Bacteria 1320
119 Ga0105241_10009561 3300009174 Bacteria 7126
120 Ga0105241_10959841 3300009174 Bacteria 797
121 Ga0105242_10017183 3300009176 Bacteria 5633
122 Ga0105242_10275535 3300009176 Bacteria 1526
123 Ga0105242_10613184 3300009176 Bacteria 1053
124 Ga0105248_10037032 3300009177 Bacteria 5455
125 Ga0105248_10667066 3300009177 Bacteria 1173
126 Ga0105248_11487512 3300009177 Bacteria 767
127 Ga0105248_12863982 3300009177 Bacteria 550
128 Ga0105237_10038334 3300009545 Bacteria 4839
129 Ga0105237_10653241 3300009545 Bacteria 1058
130 Ga0105237_11045689 3300009545 Bacteria 823
131 Ga0105238_10000972 3300009551 Bacteria 29340
132 Ga0105238_10004618 3300009551 Bacteria 13631
133 Ga0105238_10209973 3300009551 Bacteria 1923
134 Ga0105249_10084753 3300009553 Bacteria 2951
135 Ga0105249_10182736 3300009553 Bacteria 2041
136 Ga0105249_10546295 3300009553 Bacteria 1209
137 Ga0105239_10013394 3300010375 Bacteria 9111
138 Ga0105239_10022375 3300010375 Bacteria 6969
139 Ga0105239_10047052 3300010375 Bacteria 4726
140 Ga0105239_10146472 3300010375 Bacteria 2634
141 Ga0105239_10224424 3300010375 Bacteria 2107
142 Ga0105239_10406279 3300010375 Bacteria 1541
143 Ga0105239_10902616 3300010375 Bacteria 1014
144 Ga0105239_12832956 3300010375 Bacteria 566
145 Ga0105246_10070636 3300011119 Bacteria 2456
146 Ga0157371_10181349 3300013102 Bacteria 1506
147 Ga0157370_10107504 3300013104 Bacteria 2609
148 Ga0157370_10251550 3300013104 Bacteria 1634
149 Ga0157370_10369029 3300013104 Bacteria 1323
150 Ga0157369_10006929 3300013105 Bacteria 13076
151 Ga0157369_10019475 3300013105 Bacteria 7592
152 Ga0157369_10233503 3300013105 Bacteria 1922
153 Ga0157374_11170401 3300013296 Bacteria 790
154 Ga0157378_10029176 3300013297 Bacteria 4870
155 Ga0157378_10288542 3300013297 Bacteria 1584
156 Ga0163162_10010474 3300013306 Bacteria 9014
157 Ga0163162_10010824 3300013306 Bacteria 8875
158 Ga0163162_10379841 3300013306 Bacteria 1546
159 Ga0163162_11084009 3300013306 Bacteria 907
160 Ga0157372_10003531 3300013307 Bacteria 16847
161 Ga0157372_10062647 3300013307 Bacteria 4168
162 Ga0157372_11967464 3300013307 Bacteria 672
163 Ga0157375_10001312 3300013308 Bacteria 21447
164 Ga0157375_10124721 3300013308 Bacteria 2689
165 Ga0157375_10169352 3300013308 Bacteria 2331
166 Ga0163163_10000168 3300014325 Bacteria 68808
167 Ga0163163_10001009 3300014325 Bacteria 23814
168 Ga0163163_10028802 3300014325 Bacteria 5338
169 Ga0163163_10135895 3300014325 Bacteria 2500
170 Ga0182008_10001813 3300014497 Bacteria 13925
171 Ga0182008_10098115 3300014497 Bacteria 1446
172 Ga0182008_10290651 3300014497 Bacteria 853
173 Ga0157379_10011655 3300014968 Bacteria 7676
174 Ga0157379_10599198 3300014968 Bacteria 1028
175 Ga0157376_10067528 3300014969 Bacteria 3025
176 Ga0182006_1000072 3300015261 Bacteria 133681
177 Ga0182006_1014700 3300015261 Bacteria 3370
178 Ga0182007_10003436 3300015262 Bacteria 7464
179 Ga0182007_10048943 3300015262 Bacteria 1397
180 Ga0182007_10090847 3300015262 Bacteria 1006
181 Ga0182007_10139647 3300015262 Bacteria 819
182 Ga0182005_1000080 3300015265 Bacteria 76011
183 Ga0182005_1004229 3300015265 Bacteria 4686
184 Ga0182005_1008595 3300015265 Bacteria 3003
185 Ga0163161_10002457 3300017792 Bacteria 13228
186 Ga0163161_10023223 3300017792 Bacteria 4373
187 Ga0197907_11481889 3300020069 Bacteria 1119
188 Ga0206355_1403764 3300020076 Bacteria 883
189 Ga0209674_100119 3300025226 Bacteria 135468
190 Ga0209674_100426 3300025226 Bacteria 20351
191 Ga0209674_102261 3300025226 Bacteria 4260
192 Ga0209672_100016 3300025228 Bacteria 522604
193 Ga0207427_100334 3300025231 Bacteria 31251
194 Ga0209437_100139 3300025233 Bacteria 172506
195 Ga0209258_100012 3300025242 Bacteria 825544
196 Ga0209677_116022 3300025253 Bacteria 969
197 Ga0209148_1000014 3300025254 Bacteria 925277
198 Ga0209759_1005589 3300025256 Bacteria 4364
199 Ga0209233_1000083 3300025261 Bacteria 336016
200 Ga0209233_1000191 3300025261 Bacteria 127938
201 Ga0209455_1000014 3300025272 Bacteria 806601
202 Ga0209455_1000338 3300025272 Bacteria 44594
203 Ga0209673_1117922 3300025273 Bacteria 545
204 Ga0209256_1004462 3300025299 Bacteria 8764
205 Ga0209051_1037076 3300025303 Bacteria 1793
206 Ga0207710_10024201 3300025900 Bacteria 2614
207 Ga0207680_10000002 3300025903 Bacteria 1018646
208 Ga0207680_10008319 3300025903 Bacteria 5083
209 Ga0207647_10000029 3300025904 Bacteria 109732
210 Ga0207647_10001205 3300025904 Bacteria 19905
211 Ga0207647_10067789 3300025904 Bacteria 2161
212 Ga0207705_10008424 3300025909 Bacteria 7529
213 Ga0207705_10040657 3300025909 Bacteria 3336
214 Ga0207705_10204906 3300025909 Bacteria 1495
215 Ga0207654_10000072 3300025911 Bacteria 66188
216 Ga0207654_10054698 3300025911 Bacteria 2308
217 Ga0207707_10164066 3300025912 Bacteria 1942
218 Ga0207707_10389183 3300025912 Bacteria 1198
219 Ga0207695_10000256 3300025913 Bacteria 135850
220 Ga0207695_10003762 3300025913 Bacteria 21057
221 Ga0207671_10004173 3300025914 Bacteria 13960
222 Ga0207671_10600912 3300025914 Bacteria 877
223 Ga0207671_11108444 3300025914 Bacteria 621
224 Ga0207693_10474804 3300025915 Bacteria 977
225 Ga0207663_10482091 3300025916 Bacteria 961
226 Ga0207660_10030205 3300025917 Bacteria 3724
227 Ga0207662_10474321 3300025918 Bacteria 859
228 Ga0207657_10204814 3300025919 Bacteria 1585
229 Ga0207657_10279886 3300025919 Bacteria 1324
230 Ga0207649_10001367 3300025920 Bacteria 14474
231 Ga0207649_10088430 3300025920 Bacteria 2023
232 Ga0207649_10122482 3300025920 Bacteria 1755
233 Ga0207649_10678523 3300025920 Bacteria 798
234 Ga0207652_10266346 3300025921 Bacteria 1546
235 Ga0207694_10000470 3300025924 Bacteria 36877
236 Ga0207694_10225229 3300025924 Bacteria 1530
237 Ga0207687_10050737 3300025927 Bacteria 2889
238 Ga0207687_10089002 3300025927 Bacteria 2247
239 Ga0207687_11049395 3300025927 Bacteria 699
240 Ga0207700_10977203 3300025928 Bacteria 758
241 Ga0207664_10000239 3300025929 Bacteria 41739
242 Ga0207664_10006000 3300025929 Bacteria 8319
243 Ga0207664_10025617 3300025929 Bacteria 4447
244 Ga0207644_10570153 3300025931 Bacteria 938
245 Ga0207644_11452705 3300025931 Bacteria 576
246 Ga0207690_10000448 3300025932 Bacteria 26681
247 Ga0207690_10000586 3300025932 Bacteria 23543
248 Ga0207690_10044195 3300025932 Bacteria 2935
249 Ga0207690_10110331 3300025932 Bacteria 1980
250 Ga0207706_10246472 3300025933 Bacteria 1561
251 Ga0207686_10342964 3300025934 Bacteria 1122
252 Ga0207709_11576128 3300025935 Bacteria 545
253 Ga0207669_10384927 3300025937 Bacteria 1094
254 Ga0207704_10345391 3300025938 Bacteria 1157
255 Ga0207704_10442880 3300025938 Bacteria 1035
256 Ga0207711_10299119 3300025941 Bacteria 1484
257 Ga0207667_10015167 3300025949 Bacteria 8762
258 Ga0207667_10017940 3300025949 Bacteria 7953
259 Ga0207667_10080089 3300025949 Bacteria 3384
260 Ga0207667_10125646 3300025949 Bacteria 2642
261 Ga0207712_10326375 3300025961 Bacteria 1268
262 Ga0207712_10339919 3300025961 Bacteria 1244
263 Ga0207668_10766201 3300025972 Bacteria 852
264 Ga0207640_10364707 3300025981 Bacteria 1165
265 Ga0207658_10182141 3300025986 Bacteria 1739
266 Ga0207658_10197722 3300025986 Bacteria 1676
267 Ga0207658_10324780 3300025986 Bacteria 1333
268 Ga0207703_10250730 3300026035 Bacteria 1595
269 Ga0207703_11122377 3300026035 Bacteria 755
270 Ga0207703_11869879 3300026035 Bacteria 576
271 Ga0207639_10000931 3300026041 Bacteria 19788
272 Ga0207639_10015505 3300026041 Bacteria 5379
273 Ga0207639_10038167 3300026041 Bacteria 3571
274 Ga0207639_10039740 3300026041 Bacteria 3507
275 Ga0207639_10095285 3300026041 Bacteria 2392
276 Ga0207639_10399634 3300026041 Bacteria 1238
277 Ga0207639_12211288 3300026041 Bacteria 511
278 Ga0207678_10009391 3300026067 Bacteria 8606
279 Ga0207678_10074977 3300026067 Bacteria 2898
280 Ga0207678_10162477 3300026067 Bacteria 1907
281 Ga0207678_10289904 3300026067 Bacteria 1406
282 Ga0207702_10001547 3300026078 Bacteria 22753
283 Ga0207702_10006329 3300026078 Bacteria 10226
284 Ga0207702_10012695 3300026078 Bacteria 7010
285 Ga0207702_10154401 3300026078 Bacteria 2091
286 Ga0207702_10248275 3300026078 Bacteria 1670
287 Ga0207641_10011588 3300026088 Bacteria 7237
288 Ga0207641_10017887 3300026088 Bacteria 5806
289 Ga0207641_10034940 3300026088 Bacteria 4184
290 Ga0207641_10453211 3300026088 Bacteria 1240
291 Ga0207676_10019164 3300026095 Bacteria 4986
292 Ga0207676_10346839 3300026095 Bacteria 1372
293 Ga0207674_10115469 3300026116 Bacteria 2656
294 Ga0207674_10472425 3300026116 Bacteria 1212
295 Ga0207674_10570972 3300026116 Bacteria 1093
296 Ga0207674_10851693 3300026116 Bacteria 879
297 Ga0207675_102625450 3300026118 Bacteria 513
298 Ga0207683_10138081 3300026121 Bacteria 2195
299 Ga0207683_10227822 3300026121 Bacteria 1699
300 Ga0207698_10017149 3300026142 Bacteria 4906
301 Ga0207698_10060220 3300026142 Bacteria 2952
302 Ga0207698_10265152 3300026142 Bacteria 1580
303 Ga0209969_1030384 3300027360 Bacteria 825
304 Ga0268266_10000004 3300028379 Bacteria 1495817
305 Ga0268266_10046248 3300028379 Bacteria 3726
306 Ga0268266_10398226 3300028379 Bacteria 1301
307 Ga0268265_10804010 3300028380 Bacteria 917
308 Ga0268264_10005680 3300028381 Bacteria 10575
309 Ga0268264_10013949 3300028381 Bacteria 6606
310 Ga0268264_10057271 3300028381 Bacteria 3260
311 Ga0268264_10410559 3300028381 Bacteria 1303
312 Ga0268264_12046471 3300028381 Bacteria 581
313 Ga0307408_101952232 3300031548 Bacteria 564
314 Ga0316575_10005122 3300031665 Bacteria 4653
315 Ga0307516_10104907 3300031730 Bacteria 2638
316 Ga0307405_10110686 3300031731 Bacteria 1860
317 Ga0307413_10579183 3300031824 Bacteria 915
318 Ga0307410_11564944 3300031852 Bacteria 582
319 Ga0307412_10008807 3300031911 Bacteria 5778
320 Ga0307409_100052564 3300031995 Bacteria 3125
321 Ga0307409_100152459 3300031995 Bacteria 2009
322 Ga0307416_100061464 3300032002 Bacteria 3066
323 Ga0307415_101439690 3300032126 Unclassified 657
324 Ga0307510_10000770 3300033180 Bacteria 33082
325 Ga0373944_0113939 3300035089 Bacteria 926
326 Ga0373923_0123727 3300035111 Bacteria 1158
327 Ga0373957_0154264 3300035120 Bacteria 944
328 Ga0373947_0251575 3300035725 Bacteria 1169
329 Ga0395899_0047597 3300037312 Bacteria 3192
330 Ga0395900_0206167 3300037418 Bacteria 1987
331 Ga0395898_0001311 3300037466 Bacteria 36213
332 Ga0395901_0000816 3300038443 Bacteria 34537
333 Ga0395901_0843432 3300038443 Bacteria 902
334 Ga0395901_1677047 3300038443 Bacteria 587
335 Ga0436363_0890279 3300039450 Bacteria 595
336 Ga0439436_0000099 3300041404 Bacteria 20537
337 Ga0439465_0003612 3300041413 Bacteria 5047
338 Ga0451787_003194 3300041441 Bacteria 1313
339 Ga0451787_108926 3300041441 Bacteria 1768
340 Ga0451791_0262041 3300041451 Bacteria 787
341 Ga0451793_1434546 3300041452 Bacteria 1654
342 Ga0451797_1213514 3300041453 Bacteria 857
343 Ga0451802_0511048 3300041460 Bacteria 5068
344 Ga0451833_0775520 3300041491 Bacteria 2287
345 Ga0451833_0823068 3300041491 Bacteria 697
346 Ga0451833_1492982 3300041491 Bacteria 605
347 Ga0451837_0859325 3300041494 Bacteria 1072
348 Ga0451837_1101813 3300041494 Bacteria 2018
349 Ga0451841_1038888 3300041498 Bacteria 1081
350 Ga0451843_0311453 3300041509 Bacteria 948
351 Ga0451853_0913553 3300041512 Bacteria 1865
352 Ga0439445_0012742 3300042004 Bacteria 2025
353 Ga0439432_030621 3300042006 Bacteria 1744
354 Ga0439451_040265 3300042009 Unclassified 938
355 Ga0450897_040655 3300042128 Bacteria 546
356 Ga0450894_037729 3300042131 Bacteria 688
357 Ga0450908_002471 3300042184 Bacteria 3615
358 Ga0466969_0001632 3300044656 Bacteria 12024
359 Ga0466989_0020593 3300044663 Bacteria 3802
360 Ga0466966_0039686 3300044684 Bacteria 3031
361 Ga0466961_0025286 3300044693 Bacteria 3818
362 Ga0466961_0487929 3300044693 Bacteria 744
363 Ga0466963_0255153 3300044694 Bacteria 1231
364 Ga0466971_0088792 3300044719 Bacteria 1414
365 Ga0466968_0001115 3300044735 Bacteria 9513
366 Ga0466970_0024169 3300044765 Bacteria 3176
367 Ga0466959_0252405 3300045049 Bacteria 1216
368 Ga0466958_0087539 3300045836 Bacteria 1923
369 Ga0466958_0183193 3300045836 Bacteria 1329
370 Ga0495617_000117 3300046452 Bacteria 54105
371 Ga0495617_009842 3300046452 Bacteria 3278
372 Ga0495638_0000153 3300046460 Bacteria 109155
373 Ga0495638_0063908 3300046460 Bacteria 2268
374 Ga0495651_0471692 3300046462 Bacteria 808
375 Ga0495650_0000271 3300046471 Bacteria 98894
376 Ga0495650_0003006 3300046471 Bacteria 12745
377 Ga0495650_0165229 3300046471 Bacteria 786
378 Ga0495639_0060953 3300046475 Bacteria 1729
379 Ga0495585_0001084 3300046492 Bacteria 22416
380 Ga0495607_0000120 3300046501 Bacteria 82667
381 Ga0495583_0385049 3300046506 Bacteria 551
382 Ga0495606_0001210 3300046507 Bacteria 36218
383 Ga0495606_0002719 3300046507 Bacteria 19946
384 Ga0495606_0025920 3300046507 Bacteria 4187
385 Ga0495610_0002124 3300046512 Bacteria 16863
386 Ga0495610_0030866 3300046512 Bacteria 2801
387 Ga0495616_0080241 3300046513 Bacteria 1562
388 Ga0495620_0005183 3300046515 Bacteria 7292
389 Ga0495631_0000029 3300046518 Bacteria 86555
390 Ga0495631_0001826 3300046518 Bacteria 12579
391 Ga0495632_0000004 3300046519 Bacteria 381372
392 Ga0495632_0088872 3300046519 Bacteria 1467
393 Ga0495643_0094780 3300046522 Bacteria 1536
394 Ga0495648_0001512 3300046524 Bacteria 22781
395 Ga0495648_0013046 3300046524 Bacteria 6165
396 Ga0495609_0005899 3300046538 Bacteria 6332
397 Ga0495611_0000001 3300046648 Bacteria 2628469
398 Ga0495611_0000060 3300046648 Bacteria 77971
399 Ga0495625_0000022 3300046660 Bacteria 278823
400 Ga0495625_0029807 3300046660 Bacteria 4077
401 Ga0495625_0154886 3300046660 Bacteria 1538
402 Ga0495625_0161202 3300046660 Bacteria 1502
403 Ga0495661_0000438 3300046665 Bacteria 44026
404 Ga0495647_0056370 3300046681 Bacteria 1540
405 Ga0495670_0005573 3300046691 Bacteria 6178
406 Ga0495670_0038632 3300046691 Bacteria 2380
407 Ga0495671_0024804 3300046692 Bacteria 3119
408 Ga0495649_0008445 3300046694 Bacteria 6197
409 Ga0495589_0000237 3300046794 Bacteria 46023
410 Ga0495660_0000092 3300046810 Bacteria 96197
411 Ga0495660_0004103 3300046810 Bacteria 8885
412 Ga0495674_0222044 3300047319 Bacteria 1562
413 Ga0495679_000004 3300047446 Bacteria 748056
414 Ga0495673_0000004 3300047469 Bacteria 1354526
415 Ga0495673_0001152 3300047469 Bacteria 22486
416 Ga0495673_0001469 3300047469 Bacteria 18680
417 Ga0495686_0000017 3300047472 Bacteria 435554
418 Ga0495686_0011096 3300047472 Bacteria 6365
419 Ga0495686_0105700 3300047472 Bacteria 1693
420 Ga0496100_0028387 3300048903 Bacteria 3451
421 Ga0496101_0001374 3300048904 Bacteria 14578
422 Ga0496102_0387398 3300048905 Bacteria 1315
423 Ga0496106_0000309 3300048909 Bacteria 34373
424 Ga0496106_0921086 3300048909 Bacteria 690
425 Ga0496108_0670168 3300048911 Bacteria 901
426 Ga0496116_0116936 3300048919 Bacteria 1553
427 Ga0496117_0027842 3300048920 Bacteria 4390
428 Ga0496117_0083891 3300048920 Bacteria 2081
429 Ga0496117_0129266 3300048920 Bacteria 1534
430 Ga0496118_0000429 3300048921 Bacteria 69699
431 Ga0496118_0002637 3300048921 Bacteria 23784
432 Ga0496118_0092608 3300048921 Bacteria 2073
433 Ga0496118_0503770 3300048921 Bacteria 601
434 Ga0496118_0528659 3300048921 Bacteria 580
435 Ga0496119_0071853 3300048922 Bacteria 2024
436 Ga0496120_0073946 3300048923 Bacteria 1863
437 Ga0496121_0000045 3300048924 Bacteria 336130
438 Ga0496121_0006695 3300048924 Bacteria 14165
439 Ga0496121_0062715 3300048924 Bacteria 3042
440 Ga0496121_0181665 3300048924 Bacteria 1517
441 Ga0496121_0422672 3300048924 Bacteria 867
442 Ga0496121_0869874 3300048924 Bacteria 522
443 Ga0496122_0181748 3300048925 Bacteria 1253
444 Ga0496123_0017670 3300048926 Bacteria 5722
445 Ga0496124_0373776 3300048927 Bacteria 999
446 Ga0496125_0010765 3300048928 Bacteria 9213
447 Ga0496126_0058598 3300048929 Bacteria 3471
448 Ga0496126_0183782 3300048929 Bacteria 1774
449 Ga0496126_0404230 3300048929 Bacteria 1107
450 Ga0496126_0409263 3300048929 Bacteria 1099
451 Ga0495678_001379 3300049459 Bacteria 19361
452 Ga0495682_0006075 3300049460 Bacteria 4924
453 Ga0495682_0064224 3300049460 Bacteria 1323
454 Ga0501032_0078774 3300049569 Bacteria 2193
455 Ga0501033_0090845 3300049570 Bacteria 2234
456 Ga0501033_0145115 3300049570 Bacteria 1714
457 Ga0501034_0000793 3300049571 Bacteria 47013
458 Ga0501034_0109115 3300049571 Bacteria 2758
459 Ga0501034_0130865 3300049571 Bacteria 2492
460 Ga0501036_0069503 3300049572 Bacteria 2979
461 Ga0501036_0128624 3300049572 Bacteria 2138
462 Ga0501037_0049477 3300049573 Bacteria 3077
463 Ga0501037_0080609 3300049573 Bacteria 2361
464 Ga0501037_0099898 3300049573 Bacteria 2095
465 Ga0501038_0019255 3300049574 Bacteria 6157
466 Ga0501038_0092547 3300049574 Bacteria 2531
467 Ga0501038_0188325 3300049574 Bacteria 1661
468 Ga0501039_0442581 3300049575 Bacteria 1020
469 Ga0501039_1142464 3300049575 Bacteria 603
470 Ga0501039_1314004 3300049575 Bacteria 558
471 Ga0501040_0082914 3300049576 Bacteria 2223
472 Ga0501042_0103574 3300049578 Bacteria 2048
473 Ga0501042_0201136 3300049578 Bacteria 1436
474 Ga0501043_0083946 3300049579 Bacteria 2504
475 Ga0501043_0142203 3300049579 Bacteria 1878
476 Ga0501043_0158133 3300049579 Bacteria 1771
477 Ga0501043_0532668 3300049579 Bacteria 874
478 Ga0501046_0045202 3300049580 Bacteria 3499
479 Ga0501046_0274745 3300049580 Bacteria 1235
480 Ga0501046_0652919 3300049580 Bacteria 743
481 Ga0501047_0004130 3300049581 Bacteria 13665
482 Ga0501047_0015205 3300049581 Bacteria 7328
483 Ga0501048_0531137 3300049582 Bacteria 844
484 Ga0501067_0002557 3300049583 Bacteria 10044
485 Ga0501067_0026091 3300049583 Bacteria 3238
486 Ga0501067_0071925 3300049583 Bacteria 1915
487 Ga0501068_0001290 3300049584 Bacteria 13290
488 Ga0501068_0027723 3300049584 Bacteria 3346
489 Ga0501068_0036301 3300049584 Bacteria 2945
490 Ga0501069_0002046 3300049585 Bacteria 10122
491 Ga0501069_0003785 3300049585 Bacteria 7782
492 Ga0501070_0009793 3300049586 Bacteria 8107
493 Ga0501070_0338365 3300049586 Bacteria 1222
494 Ga0501070_0350274 3300049586 Bacteria 1198
495 Ga0501070_0602574 3300049586 Bacteria 875
496 Ga0501071_0001781 3300049587 Bacteria 12700
497 Ga0501072_0002275 3300049588 Bacteria 14353
498 Ga0501072_0002562 3300049588 Bacteria 13621
499 Ga0501072_0085757 3300049588 Bacteria 2498
500 Ga0501073_0009229 3300049589 Bacteria 7272
501 Ga0501073_0134798 3300049589 Bacteria 1711
502 Ga0501073_0435375 3300049589 Bacteria 906
503 Ga0501073_0855445 3300049589 Bacteria 626
504 Ga0501074_0001030 3300049590 Bacteria 18099
505 Ga0501074_0017328 3300049590 Bacteria 5225
506 Ga0501074_0182821 3300049590 Bacteria 1495
507 Ga0501079_0099275 3300049741 Bacteria 2256
508 Ga0501079_0233063 3300049741 Bacteria 1438
509 Ga0501079_0751556 3300049741 Bacteria 767
510 Ga0501080_0038840 3300049742 Bacteria 4442
511 Ga0501080_0061917 3300049742 Bacteria 3482
512 Ga0501080_0063050 3300049742 Bacteria 3449
513 Ga0501080_0257466 3300049742 Bacteria 1590
514 Ga0501080_0437437 3300049742 Bacteria 1174
515 Ga0501083_0009264 3300049744 Bacteria 6950
516 Ga0501083_0031037 3300049744 Bacteria 3667
517 Ga0501083_0052844 3300049744 Bacteria 2728
518 Ga0501035_0162785 3300049822 Bacteria 1930
519 Ga0501035_0174850 3300049822 Bacteria 1853
520 Ga0501035_0274329 3300049822 Bacteria 1426
521 Ga0501035_0368490 3300049822 Bacteria 1199
522 Ga0501044_0005623 3300049823 Bacteria 13924
523 Ga0501044_0014313 3300049823 Bacteria 8563
524 Ga0501044_0150088 3300049823 Bacteria 2313
525 Ga0501044_0550473 3300049823 Bacteria 1051
526 nmdc:mga05p37_580783_c1 3300050507 Bacteria 1269
527 nmdc:mga09592_276946_c1 3300050508 Bacteria 1455
528 nmdc:mga06r32_1657111_c1 3300050510 Bacteria 577
529 nmdc:mga06r32_379284_c1 3300050510 Bacteria 1397
530 nmdc:mga08y16_2398_c1 3300050511 Bacteria 19250
531 Ga0500610_0017213 3300053079 Bacteria 3466
532 Ga0500643_000108 3300053087 Bacteria 86547
533 Ga0500646_0027234 3300053090 Bacteria 1554
534 Ga0500651_0060273 3300053093 Bacteria 2372
535 Ga0500555_000942 3300053103 Bacteria 10118
536 Ga0500588_0317910 3300053146 Bacteria 590
537 Ga0500637_0549292 3300053178 Unclassified 560
538 Ga0500645_002222 3300053730 Bacteria 8853
539 Ga0501084_0012052 3300054114 Bacteria 7160
540 Ga0501084_0107983 3300054114 Bacteria 2338
541 Ga0501084_0474579 3300054114 Bacteria 1057
542 Ga0500661_009297 3300055283 Bacteria 1802
543 Ga0501082_0017987 3300060353 Bacteria 6087
544 Ga0501082_0043888 3300060353 Bacteria 3857
545 Ga0501082_0088743 3300060353 Bacteria 2668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002705 JGI25156J39149_1011621 JGI25156J39149_10116213 113
2 3300006844 Ga0075428_100730358 Ga0075428_1007303582 113
3 3300006880 Ga0075429_100203871 Ga0075429_1002038712 113
4 3300020069 Ga0197907_11481889 Ga0197907_114818891 113
5 3300020076 Ga0206355_1403764 Ga0206355_14037642 113
6 3300025256 Ga0209759_1005589 Ga0209759_10055895 113
7 3300025272 Ga0209455_1000338 Ga0209455_100033837 113
8 3300025913 Ga0207695_10003762 Ga0207695_1000376212 113
9 3300025949 Ga0207667_10125646 Ga0207667_101256461 113
10 3300049573 Ga0501037_0049477 Ga0501037_0049477_1012_1416 113
11 3300049574 Ga0501038_0092547 Ga0501038_0092547_1858_2262 113
12 3300049578 Ga0501042_0103574 Ga0501042_0103574_204_608 113
13 3300049579 Ga0501043_0532668 Ga0501043_0532668_87_491 113
14 3300049580 Ga0501046_0652919 Ga0501046_0652919_18_422 113
15 3300049742 Ga0501080_0437437 Ga0501080_0437437_310_714 113
16 3300049822 Ga0501035_0274329 Ga0501035_0274329_87_491 113
17 3300049823 Ga0501044_0150088 Ga0501044_0150088_475_879 113
18 3300005366 Ga0070659_100141151 Ga0070659_1001411512 114
19 3300005458 Ga0070681_10142129 Ga0070681_101421291 114
20 3300005546 Ga0070696_100456702 Ga0070696_1004567022 114
21 3300013105 Ga0157369_10019475 Ga0157369_100194755 114
22 3300014325 Ga0163163_10135895 Ga0163163_101358953 114
23 3300025904 Ga0207647_10001205 Ga0207647_1000120517 114
24 3300025912 Ga0207707_10389183 Ga0207707_103891833 114
25 3300041452 Ga0451793_1434546 Ga0451793_1434546_179_523 114
26 3300041491 Ga0451833_1492982 Ga0451833_1492982_147_491 114
27 3300049569 Ga0501032_0078774 Ga0501032_0078774_1459_1803 114
28 3300049570 Ga0501033_0145115 Ga0501033_0145115_980_1324 114
29 3300049572 Ga0501036_0128624 Ga0501036_0128624_805_1149 114
30 3300049573 Ga0501037_0099898 Ga0501037_0099898_1567_1911 114
31 3300049574 Ga0501038_0188325 Ga0501038_0188325_130_474 114
32 3300049575 Ga0501039_0442581 Ga0501039_0442581_492_836 114
33 3300049576 Ga0501040_0082914 Ga0501040_0082914_770_1114 114
34 3300049578 Ga0501042_0201136 Ga0501042_0201136_412_756 114
35 3300049579 Ga0501043_0158133 Ga0501043_0158133_990_1334 114
36 3300049580 Ga0501046_0045202 Ga0501046_0045202_2715_3059 114
37 3300049583 Ga0501067_0026091 Ga0501067_0026091_1498_1842 114
38 3300049584 Ga0501068_0036301 Ga0501068_0036301_2284_2628 114
39 3300049586 Ga0501070_0350274 Ga0501070_0350274_208_552 114
40 3300049588 Ga0501072_0085757 Ga0501072_0085757_1244_1588 114
41 3300049589 Ga0501073_0855445 Ga0501073_0855445_98_442 114
42 3300049590 Ga0501074_0017328 Ga0501074_0017328_1252_1596 114
43 3300049741 Ga0501079_0751556 Ga0501079_0751556_364_708 114
44 3300049742 Ga0501080_0038840 Ga0501080_0038840_3914_4258 114
45 3300049744 Ga0501083_0052844 Ga0501083_0052844_1398_1742 114
46 3300049822 Ga0501035_0162785 Ga0501035_0162785_1223_1567 114
47 3300049823 Ga0501044_0005623 Ga0501044_0005623_8573_8917 114
48 3300050508 nmdc:mga09592_276946_c1 nmdc:mga09592_276946_c1_560_922 114
49 3300054114 Ga0501084_0107983 Ga0501084_0107983_1570_1914 114
50 3300060353 Ga0501082_0043888 Ga0501082_0043888_2263_2607 114
51 3300002077 JGI24744J21845_10015342 JGI24744J21845_100153421 115
52 3300005295 Ga0065707_10916251 Ga0065707_109162512 115
53 3300005330 Ga0070690_101468300 Ga0070690_1014683001 115
54 3300005335 Ga0070666_10008334 Ga0070666_100083343 115
55 3300005435 Ga0070714_100007668 Ga0070714_10000766810 115
56 3300006358 Ga0068871_100882756 Ga0068871_1008827561 115
57 3300009176 Ga0105242_10275535 Ga0105242_102755352 115
58 3300013297 Ga0157378_10029176 Ga0157378_100291765 115
59 3300013306 Ga0163162_11084009 Ga0163162_110840092 115
60 3300025903 Ga0207680_10008319 Ga0207680_100083195 115
61 3300025929 Ga0207664_10025617 Ga0207664_100256175 115
62 3300027360 Ga0209969_1030384 Ga0209969_10303841 115
63 3300042009 Ga0439451_040265 Ga0439451_040265_25_372 115
64 3300050510 nmdc:mga06r32_1657111_c1 nmdc:mga06r32_1657111_c1_198_545 115
65 3300005344 Ga0070661_100394503 Ga0070661_1003945033 116
66 3300005436 Ga0070713_100248395 Ga0070713_1002483951 116
67 3300009093 Ga0105240_10659590 Ga0105240_106595902 116
68 3300009094 Ga0111539_10002218 Ga0111539_1000221821 116
69 3300009098 Ga0105245_10102171 Ga0105245_101021713 116
70 3300009098 Ga0105245_13158569 Ga0105245_131585691 116
71 3300010375 Ga0105239_10022375 Ga0105239_100223753 116
72 3300014325 Ga0163163_10000168 Ga0163163_1000016856 116
73 3300025927 Ga0207687_10050737 Ga0207687_100507372 116
74 3300031665 Ga0316575_10005122 Ga0316575_100051223 116
75 3300041441 Ga0451787_003194 Ga0451787_003194_757_1107 116
76 3300048929 Ga0496126_0409263 Ga0496126_0409263_67_417 116
77 3300049571 Ga0501034_0000793 Ga0501034_0000793_19578_19928 116
78 3300049583 Ga0501067_0071925 Ga0501067_0071925_1134_1484 116
79 3300049584 Ga0501068_0001290 Ga0501068_0001290_1016_1366 116
80 3300049585 Ga0501069_0002046 Ga0501069_0002046_7717_8067 116
81 3300049586 Ga0501070_0602574 Ga0501070_0602574_94_444 116
82 3300049587 Ga0501071_0001781 Ga0501071_0001781_11919_12269 116
83 3300049588 Ga0501072_0002275 Ga0501072_0002275_2061_2411 116
84 3300049589 Ga0501073_0134798 Ga0501073_0134798_214_564 116
85 3300049590 Ga0501074_0001030 Ga0501074_0001030_16372_16722 116
86 3300049741 Ga0501079_0233063 Ga0501079_0233063_1075_1425 116
87 3300049742 Ga0501080_0257466 Ga0501080_0257466_107_457 116
88 3300049744 Ga0501083_0031037 Ga0501083_0031037_246_596 116
89 3300050511 nmdc:mga08y16_2398_c1 nmdc:mga08y16_2398_c1_9300_9650 116
90 3300054114 Ga0501084_0012052 Ga0501084_0012052_2012_2362 116
91 3300060353 Ga0501082_0088743 Ga0501082_0088743_1185_1535 116
92 3300005535 Ga0070684_100458044 Ga0070684_1004580441 117
93 3300005539 Ga0068853_100415511 Ga0068853_1004155112 117
94 3300005544 Ga0070686_100841070 Ga0070686_1008410702 117
95 3300005577 Ga0068857_100728563 Ga0068857_1007285632 117
96 3300005616 Ga0068852_100241952 Ga0068852_1002419522 117
97 3300005618 Ga0068864_100098322 Ga0068864_1000983222 117
98 3300005841 Ga0068863_100090217 Ga0068863_1000902172 117
99 3300005842 Ga0068858_100090101 Ga0068858_1000901013 117
100 3300005843 Ga0068860_100003573 Ga0068860_1000035738 117
101 3300006237 Ga0097621_100254391 Ga0097621_1002543912 117
102 3300006852 Ga0075433_10603840 Ga0075433_106038402 117
103 3300009545 Ga0105237_10653241 Ga0105237_106532412 117
104 3300009553 Ga0105249_10084753 Ga0105249_100847534 117
105 3300009553 Ga0105249_10182736 Ga0105249_101827363 117
106 3300010375 Ga0105239_10902616 Ga0105239_109026162 117
107 3300010375 Ga0105239_12832956 Ga0105239_128329561 117
108 3300011119 Ga0105246_10070636 Ga0105246_100706363 117
109 3300014325 Ga0163163_10001009 Ga0163163_100010097 117
110 3300014968 Ga0157379_10011655 Ga0157379_100116556 117
111 3300025927 Ga0207687_11049395 Ga0207687_110493952 117
112 3300025931 Ga0207644_10570153 Ga0207644_105701532 117
113 3300026035 Ga0207703_10250730 Ga0207703_102507302 117
114 3300026041 Ga0207639_10399634 Ga0207639_103996342 117
115 3300026088 Ga0207641_10017887 Ga0207641_100178872 117
116 3300026095 Ga0207676_10019164 Ga0207676_100191645 117
117 3300026095 Ga0207676_10346839 Ga0207676_103468392 117
118 3300026116 Ga0207674_10851693 Ga0207674_108516932 117
119 3300026118 Ga0207675_102625450 Ga0207675_1026254502 117
120 3300028381 Ga0268264_10005680 Ga0268264_100056803 117
121 3300028381 Ga0268264_12046471 Ga0268264_120464711 117
122 3300031824 Ga0307413_10579183 Ga0307413_105791832 117
123 3300031852 Ga0307410_11564944 Ga0307410_115649442 117
124 3300031995 Ga0307409_100052564 Ga0307409_1000525642 117
125 3300032002 Ga0307416_100061464 Ga0307416_1000614642 117
126 3300032126 Ga0307415_101439690 Ga0307415_1014396902 117
127 3300039450 Ga0436363_0890279 Ga0436363_0890279_41_394 117
128 3300053178 Ga0500637_0549292 Ga0500637_0549292_84_437 117
129 3300005563 Ga0068855_100007864 Ga0068855_1000078647 118
130 3300005578 Ga0068854_100026233 Ga0068854_1000262332 118
131 3300005614 Ga0068856_100038837 Ga0068856_1000388373 118
132 3300005616 Ga0068852_100113207 Ga0068852_1001132072 118
133 3300005616 Ga0068852_100179005 Ga0068852_1001790052 118
134 3300005844 Ga0068862_100178674 Ga0068862_1001786743 118
135 3300009093 Ga0105240_10023606 Ga0105240_100236062 118
136 3300009174 Ga0105241_10009561 Ga0105241_100095616 118
137 3300009174 Ga0105241_10959841 Ga0105241_109598411 118
138 3300009177 Ga0105248_11487512 Ga0105248_114875121 118
139 3300009551 Ga0105238_10004618 Ga0105238_100046182 118
140 3300010375 Ga0105239_10224424 Ga0105239_102244243 118
141 3300013104 Ga0157370_10107504 Ga0157370_101075042 118
142 3300013105 Ga0157369_10006929 Ga0157369_100069292 118
143 3300013307 Ga0157372_10003531 Ga0157372_100035312 118
144 3300025911 Ga0207654_10000072 Ga0207654_1000007235 118
145 3300025911 Ga0207654_10054698 Ga0207654_100546983 118
146 3300025913 Ga0207695_10000256 Ga0207695_1000025645 118
147 3300025914 Ga0207671_10004173 Ga0207671_100041736 118
148 3300025920 Ga0207649_10001367 Ga0207649_100013672 118
149 3300025949 Ga0207667_10017940 Ga0207667_100179402 118
150 3300025981 Ga0207640_10364707 Ga0207640_103647071 118
151 3300026041 Ga0207639_10015505 Ga0207639_100155052 118
152 3300026078 Ga0207702_10006329 Ga0207702_100063299 118
153 3300026078 Ga0207702_10012695 Ga0207702_100126956 118
154 3300026142 Ga0207698_10017149 Ga0207698_100171495 118
155 3300031548 Ga0307408_101952232 Ga0307408_1019522321 118
156 3300041498 Ga0451841_1038888 Ga0451841_1038888_222_635 118
157 3300049570 Ga0501033_0090845 Ga0501033_0090845_1207_1563 118
158 3300049571 Ga0501034_0109115 Ga0501034_0109115_608_964 118
159 3300049571 Ga0501034_0130865 Ga0501034_0130865_188_544 118
160 3300049572 Ga0501036_0069503 Ga0501036_0069503_1572_1928 118
161 3300049573 Ga0501037_0080609 Ga0501037_0080609_1556_1912 118
162 3300049574 Ga0501038_0019255 Ga0501038_0019255_4020_4376 118
163 3300049575 Ga0501039_1142464 Ga0501039_1142464_176_532 118
164 3300049575 Ga0501039_1314004 Ga0501039_1314004_174_530 118
165 3300049579 Ga0501043_0083946 Ga0501043_0083946_1114_1470 118
166 3300049579 Ga0501043_0142203 Ga0501043_0142203_817_1173 118
167 3300049580 Ga0501046_0274745 Ga0501046_0274745_69_425 118
168 3300049581 Ga0501047_0004130 Ga0501047_0004130_8025_8381 118
169 3300049581 Ga0501047_0015205 Ga0501047_0015205_4048_4404 118
170 3300049582 Ga0501048_0531137 Ga0501048_0531137_379_735 118
171 3300049583 Ga0501067_0002557 Ga0501067_0002557_374_730 118
172 3300049584 Ga0501068_0027723 Ga0501068_0027723_758_1114 118
173 3300049585 Ga0501069_0003785 Ga0501069_0003785_1505_1861 118
174 3300049586 Ga0501070_0009793 Ga0501070_0009793_5261_5617 118
175 3300049586 Ga0501070_0338365 Ga0501070_0338365_579_935 118
176 3300049588 Ga0501072_0002562 Ga0501072_0002562_6176_6532 118
177 3300049589 Ga0501073_0009229 Ga0501073_0009229_1878_2234 118
178 3300049589 Ga0501073_0435375 Ga0501073_0435375_239_595 118
179 3300049590 Ga0501074_0182821 Ga0501074_0182821_111_467 118
180 3300049741 Ga0501079_0099275 Ga0501079_0099275_217_573 118
181 3300049742 Ga0501080_0061917 Ga0501080_0061917_2518_2874 118
182 3300049742 Ga0501080_0063050 Ga0501080_0063050_1145_1501 118
183 3300049744 Ga0501083_0009264 Ga0501083_0009264_1740_2096 118
184 3300049822 Ga0501035_0174850 Ga0501035_0174850_102_458 118
185 3300049822 Ga0501035_0368490 Ga0501035_0368490_298_654 118
186 3300049823 Ga0501044_0014313 Ga0501044_0014313_3306_3662 118
187 3300049823 Ga0501044_0550473 Ga0501044_0550473_298_654 118
188 3300054114 Ga0501084_0474579 Ga0501084_0474579_423_779 118
189 3300060353 Ga0501082_0017987 Ga0501082_0017987_3865_4221 118
190 3300005367 Ga0070667_100221091 Ga0070667_1002210912 119
191 3300005455 Ga0070663_100069357 Ga0070663_1000693573 119
192 3300005455 Ga0070663_100152507 Ga0070663_1001525072 119
193 3300005539 Ga0068853_100000139 Ga0068853_10000013940 119
194 3300005539 Ga0068853_100379696 Ga0068853_1003796961 119
195 3300005539 Ga0068853_102158053 Ga0068853_1021580531 119
196 3300005548 Ga0070665_100006815 Ga0070665_1000068155 119
197 3300005548 Ga0070665_100272192 Ga0070665_1002721923 119
198 3300005563 Ga0068855_100000186 Ga0068855_10000018637 119
199 3300005577 Ga0068857_100260932 Ga0068857_1002609322 119
200 3300005617 Ga0068859_100056601 Ga0068859_1000566014 119
201 3300005841 Ga0068863_100044942 Ga0068863_1000449423 119
202 3300005841 Ga0068863_100054389 Ga0068863_1000543894 119
203 3300005841 Ga0068863_100784894 Ga0068863_1007848942 119
204 3300006237 Ga0097621_100155073 Ga0097621_1001550732 119
205 3300006358 Ga0068871_100023400 Ga0068871_1000234003 119
206 3300006881 Ga0068865_100241278 Ga0068865_1002412781 119
207 3300006931 Ga0097620_100056601 Ga0097620_1000566014 119
208 3300009101 Ga0105247_10286136 Ga0105247_102861361 119
209 3300009148 Ga0105243_10371187 Ga0105243_103711873 119
210 3300009177 Ga0105248_12863982 Ga0105248_128639821 119
211 3300009545 Ga0105237_11045689 Ga0105237_110456892 119
212 3300009553 Ga0105249_10546295 Ga0105249_105462952 119
213 3300010375 Ga0105239_10013394 Ga0105239_100133943 119
214 3300013297 Ga0157378_10288542 Ga0157378_102885422 119
215 3300013308 Ga0157375_10124721 Ga0157375_101247213 119
216 3300017792 Ga0163161_10023223 Ga0163161_100232235 119
217 3300025273 Ga0209673_1117922 Ga0209673_11179222 119
218 3300025914 Ga0207671_11108444 Ga0207671_111084442 119
219 3300025918 Ga0207662_10474321 Ga0207662_104743212 119
220 3300025935 Ga0207709_11576128 Ga0207709_115761282 119
221 3300025937 Ga0207669_10384927 Ga0207669_103849272 119
222 3300025938 Ga0207704_10345391 Ga0207704_103453912 119
223 3300025941 Ga0207711_10299119 Ga0207711_102991192 119
224 3300025949 Ga0207667_10015167 Ga0207667_100151672 119
225 3300025961 Ga0207712_10339919 Ga0207712_103399193 119
226 3300025986 Ga0207658_10324780 Ga0207658_103247802 119
227 3300026041 Ga0207639_10000931 Ga0207639_1000093115 119
228 3300026041 Ga0207639_10095285 Ga0207639_100952853 119
229 3300026067 Ga0207678_10009391 Ga0207678_100093915 119
230 3300026067 Ga0207678_10162477 Ga0207678_101624773 119
231 3300026088 Ga0207641_10011588 Ga0207641_100115884 119
232 3300026088 Ga0207641_10034940 Ga0207641_100349404 119
233 3300026088 Ga0207641_10453211 Ga0207641_104532113 119
234 3300026116 Ga0207674_10472425 Ga0207674_104724252 119
235 3300026116 Ga0207674_10570972 Ga0207674_105709722 119
236 3300028379 Ga0268266_10046248 Ga0268266_100462482 119
237 3300028379 Ga0268266_10398226 Ga0268266_103982262 119
238 3300041441 Ga0451787_108926 Ga0451787_108926_182_544 119
239 3300041451 Ga0451791_0262041 Ga0451791_0262041_224_586 119
240 3300041460 Ga0451802_0511048 Ga0451802_0511048_2764_3126 119
241 3300041491 Ga0451833_0775520 Ga0451833_0775520_1778_2140 119
242 3300041494 Ga0451837_0859325 Ga0451837_0859325_373_741 119
243 3300048911 Ga0496108_0670168 Ga0496108_0670168_301_663 119
244 3300048924 Ga0496121_0869874 Ga0496121_0869874_140_502 119
245 3300053079 Ga0500610_0017213 Ga0500610_0017213_2422_2787 119
246 3300053146 Ga0500588_0317910 Ga0500588_0317910_133_498 119
247 3300055283 Ga0500661_009297 Ga0500661_009297_1333_1701 119
248 3300005354 Ga0070675_100595125 Ga0070675_1005951251 120
249 3300005439 Ga0070711_100615740 Ga0070711_1006157402 120
250 3300005616 Ga0068852_100087251 Ga0068852_1000872511 120
251 3300005842 Ga0068858_100213548 Ga0068858_1002135482 120
252 3300005843 Ga0068860_100372058 Ga0068860_1003720582 120
253 3300009098 Ga0105245_12032415 Ga0105245_120324151 120
254 3300009177 Ga0105248_10667066 Ga0105248_106670662 120
255 3300010375 Ga0105239_10047052 Ga0105239_100470522 120
256 3300013296 Ga0157374_11170401 Ga0157374_111704012 120
257 3300014325 Ga0163163_10028802 Ga0163163_100288022 120
258 3300014969 Ga0157376_10067528 Ga0157376_100675283 120
259 3300025916 Ga0207663_10482091 Ga0207663_104820912 120
260 3300025927 Ga0207687_10089002 Ga0207687_100890023 120
261 3300025986 Ga0207658_10197722 Ga0207658_101977222 120
262 3300026035 Ga0207703_11122377 Ga0207703_111223772 120
263 3300026041 Ga0207639_10038167 Ga0207639_100381673 120
264 3300026041 Ga0207639_12211288 Ga0207639_122112881 120
265 3300026142 Ga0207698_10060220 Ga0207698_100602201 120
266 3300028381 Ga0268264_10410559 Ga0268264_104105592 120
267 3300031730 Ga0307516_10104907 Ga0307516_101049072 120
268 3300031995 Ga0307409_100152459 Ga0307409_1001524593 120
269 3300041453 Ga0451797_1213514 Ga0451797_1213514_442_813 120
270 3300041494 Ga0451837_1101813 Ga0451837_1101813_1019_1390 120
271 3300041509 Ga0451843_0311453 Ga0451843_0311453_446_817 120
272 3300048920 Ga0496117_0083891 Ga0496117_0083891_416_787 120
273 3300048921 Ga0496118_0000429 Ga0496118_0000429_23209_23580 120
274 3300048923 Ga0496120_0073946 Ga0496120_0073946_1478_1852 120
275 3300048924 Ga0496121_0422672 Ga0496121_0422672_457_828 120
276 3300048929 Ga0496126_0404230 Ga0496126_0404230_329_700 120
277 3300053093 Ga0500651_0060273 Ga0500651_0060273_1251_1619 120
278 iso_pu_bacteria 2895395659 2895396936 120
279 iso_pu_bacteria 2939611941 2939614260 120
280 3300005456 Ga0070678_101235400 Ga0070678_1012354002 121
281 3300013104 Ga0157370_10369029 Ga0157370_103690293 121
282 3300014497 Ga0182008_10290651 Ga0182008_102906511 121
283 3300014968 Ga0157379_10599198 Ga0157379_105991983 121
284 3300015262 Ga0182007_10048943 Ga0182007_100489431 121
285 3300025931 Ga0207644_11452705 Ga0207644_114527052 121
286 3300025961 Ga0207712_10326375 Ga0207712_103263752 121
287 3300026121 Ga0207683_10138081 Ga0207683_101380813 121
288 3300050507 nmdc:mga05p37_580783_c1 nmdc:mga05p37_580783_c1_460_837 121
289 3300050510 nmdc:mga06r32_379284_c1 nmdc:mga06r32_379284_c1_361_738 121
290 iso_pu_bacteria 2593339239 2595451761 121
291 iso_pu_bacteria 2718218334 2721026615 121
292 iso_pu_bacteria 2734482264 2735833389 121
293 iso_pu_bacteria 2738543009 2739229386 121
294 iso_pu_bacteria 2842918807 2842919774 121
295 iso_pu_bacteria 2919404418 2919404841 121
296 iso_pu_bacteria 2953994433 2953995073 121
297 3300005337 Ga0070682_100750858 Ga0070682_1007508581 122
298 3300005355 Ga0070671_100817703 Ga0070671_1008177031 122
299 3300005539 Ga0068853_100028883 Ga0068853_1000288832 122
300 3300005547 Ga0070693_100033651 Ga0070693_1000336512 122
301 3300005614 Ga0068856_100182347 Ga0068856_1001823473 122
302 3300009177 Ga0105248_10037032 Ga0105248_100370326 122
303 3300013307 Ga0157372_10062647 Ga0157372_100626474 122
304 3300013308 Ga0157375_10169352 Ga0157375_101693521 122
305 3300026078 Ga0207702_10154401 Ga0207702_101544013 122
306 3300035089 Ga0373944_0113939 Ga0373944_0113939_387_800 122
307 3300035111 Ga0373923_0123727 Ga0373923_0123727_101_514 122
308 3300035120 Ga0373957_0154264 Ga0373957_0154264_158_571 122
309 3300035725 Ga0373947_0251575 Ga0373947_0251575_718_1131 122
310 3300046462 Ga0495651_0471692 Ga0495651_0471692_317_730 122
311 3300046475 Ga0495639_0060953 Ga0495639_0060953_1077_1490 122
312 3300046681 Ga0495647_0056370 Ga0495647_0056370_210_623 122
313 3300047319 Ga0495674_0222044 Ga0495674_0222044_230_643 122
314 iso_pu_bacteria 2643221577 2643894148 122
315 iso_pu_bacteria 2643221685 2644476351 122
316 3300005356 Ga0070674_100170543 Ga0070674_1001705431 123
317 3300005457 Ga0070662_100074458 Ga0070662_1000744583 123
318 3300005618 Ga0068864_100074532 Ga0068864_1000745323 123
319 3300005843 Ga0068860_100629450 Ga0068860_1006294503 123
320 3300005844 Ga0068862_101696206 Ga0068862_1016962061 123
321 3300006881 Ga0068865_100051301 Ga0068865_1000513014 123
322 3300025928 Ga0207700_10977203 Ga0207700_109772031 123
323 3300026121 Ga0207683_10227822 Ga0207683_102278222 123
324 3300028380 Ga0268265_10804010 Ga0268265_108040102 123
325 3300041512 Ga0451853_0913553 Ga0451853_0913553_239_619 123
326 iso_pu_bacteria 2884338543 2884341382 123
327 iso_pu_bacteria 2941471342 2941472840 123
328 3300002772 JGI25164J39214_1001086 JGI25164J39214_10010862 124
329 3300003214 JGI25165J46597_1004623 JGI25165J46597_10046233 124
330 3300005327 Ga0070658_10260004 Ga0070658_102600042 124
331 3300005329 Ga0070683_100465561 Ga0070683_1004655612 124
332 3300005336 Ga0070680_100348622 Ga0070680_1003486222 124
333 3300005337 Ga0070682_100092289 Ga0070682_1000922893 124
334 3300005339 Ga0070660_100104837 Ga0070660_1001048373 124
335 3300005339 Ga0070660_100297180 Ga0070660_1002971802 124
336 3300005366 Ga0070659_100021966 Ga0070659_1000219662 124
337 3300005366 Ga0070659_100331704 Ga0070659_1003317043 124
338 3300005457 Ga0070662_100707460 Ga0070662_1007074601 124
339 3300005458 Ga0070681_10003594 Ga0070681_1000359413 124
340 3300005458 Ga0070681_10202353 Ga0070681_102023533 124
341 3300005518 Ga0070699_100824449 Ga0070699_1008244491 124
342 3300005530 Ga0070679_100446724 Ga0070679_1004467242 124
343 3300005539 Ga0068853_100215811 Ga0068853_1002158113 124
344 3300005546 Ga0070696_100032116 Ga0070696_1000321164 124
345 3300005546 Ga0070696_100628279 Ga0070696_1006282791 124
346 3300005547 Ga0070693_100037313 Ga0070693_1000373134 124
347 3300005577 Ga0068857_100212506 Ga0068857_1002125062 124
348 3300005614 Ga0068856_100215296 Ga0068856_1002152963 124
349 3300005843 Ga0068860_100009355 Ga0068860_1000093557 124
350 3300006175 Ga0070712_100537656 Ga0070712_1005376562 124
351 3300009176 Ga0105242_10017183 Ga0105242_100171836 124
352 3300009545 Ga0105237_10038334 Ga0105237_100383343 124
353 3300009551 Ga0105238_10209973 Ga0105238_102099733 124
354 3300013102 Ga0157371_10181349 Ga0157371_101813492 124
355 3300013306 Ga0163162_10010474 Ga0163162_100104743 124
356 3300013307 Ga0157372_11967464 Ga0157372_119674641 124
357 3300013308 Ga0157375_10001312 Ga0157375_1000131215 124
358 3300014497 Ga0182008_10098115 Ga0182008_100981151 124
359 3300015262 Ga0182007_10090847 Ga0182007_100908471 124
360 3300015262 Ga0182007_10139647 Ga0182007_101396472 124
361 3300025226 Ga0209674_102261 Ga0209674_1022612 124
362 3300025231 Ga0207427_100334 Ga0207427_10033433 124
363 3300025233 Ga0209437_100139 Ga0209437_100139103 124
364 3300025261 Ga0209233_1000083 Ga0209233_1000083170 124
365 3300025261 Ga0209233_1000191 Ga0209233_100019142 124
366 3300025904 Ga0207647_10067789 Ga0207647_100677893 124
367 3300025909 Ga0207705_10008424 Ga0207705_100084246 124
368 3300025909 Ga0207705_10204906 Ga0207705_102049061 124
369 3300025912 Ga0207707_10164066 Ga0207707_101640662 124
370 3300025914 Ga0207671_10600912 Ga0207671_106009122 124
371 3300025915 Ga0207693_10474804 Ga0207693_104748042 124
372 3300025917 Ga0207660_10030205 Ga0207660_100302052 124
373 3300025919 Ga0207657_10204814 Ga0207657_102048143 124
374 3300025919 Ga0207657_10279886 Ga0207657_102798863 124
375 3300025921 Ga0207652_10266346 Ga0207652_102663463 124
376 3300025924 Ga0207694_10225229 Ga0207694_102252293 124
377 3300025929 Ga0207664_10000239 Ga0207664_1000023939 124
378 3300025929 Ga0207664_10006000 Ga0207664_100060002 124
379 3300025932 Ga0207690_10000586 Ga0207690_1000058620 124
380 3300025932 Ga0207690_10044195 Ga0207690_100441953 124
381 3300025932 Ga0207690_10110331 Ga0207690_101103312 124
382 3300025933 Ga0207706_10246472 Ga0207706_102464722 124
383 3300025934 Ga0207686_10342964 Ga0207686_103429642 124
384 3300025938 Ga0207704_10442880 Ga0207704_104428801 124
385 3300026041 Ga0207639_10039740 Ga0207639_100397402 124
386 3300026067 Ga0207678_10289904 Ga0207678_102899043 124
387 3300026116 Ga0207674_10115469 Ga0207674_101154692 124
388 3300028381 Ga0268264_10013949 Ga0268264_100139493 124
389 3300037418 Ga0395900_0206167 Ga0395900_0206167_1393_1773 124
390 3300038443 Ga0395901_0000816 Ga0395901_0000816_1081_1461 124
391 3300038443 Ga0395901_1677047 Ga0395901_1677047_113_493 124
392 3300041491 Ga0451833_0823068 Ga0451833_0823068_140_544 124
393 3300042006 Ga0439432_030621 Ga0439432_030621_680_1060 124
394 3300044719 Ga0466971_0088792 Ga0466971_0088792_406_795 124
395 3300045836 Ga0466958_0087539 Ga0466958_0087539_654_1043 124
396 3300002075 JGI24738J21930_10059907 JGI24738J21930_100599072 125
397 3300003578 Ga0006562J51391_1073321 Ga0006562J51391_10733211 125
398 3300003578 Ga0006562J51391_1073322 Ga0006562J51391_10733226 125
399 3300003752 Ga0055539_1001755 Ga0055539_10017555 125
400 3300003756 Ga0055533_1013385 Ga0055533_10133852 125
401 3300003760 Ga0055527_1000082 Ga0055527_100008236 125
402 3300003761 Ga0055535_1000143 Ga0055535_100014336 125
403 3300003762 Ga0055542_1000190 Ga0055542_100019040 125
404 3300003763 Ga0055529_1000217 Ga0055529_100021740 125
405 3300005262 Ga0065165_1000028 Ga0065165_1000028123 125
406 3300005344 Ga0070661_100046195 Ga0070661_1000461951 125
407 3300005455 Ga0070663_100057755 Ga0070663_1000577553 125
408 3300005614 Ga0068856_100011969 Ga0068856_1000119692 125
409 3300010375 Ga0105239_10146472 Ga0105239_101464723 125
410 3300010375 Ga0105239_10406279 Ga0105239_104062792 125
411 3300013104 Ga0157370_10251550 Ga0157370_102515502 125
412 3300013105 Ga0157369_10233503 Ga0157369_102335033 125
413 3300013306 Ga0163162_10379841 Ga0163162_103798412 125
414 3300014497 Ga0182008_10001813 Ga0182008_100018132 125
415 3300015261 Ga0182006_1000072 Ga0182006_100007226 125
416 3300015261 Ga0182006_1014700 Ga0182006_10147002 125
417 3300015262 Ga0182007_10003436 Ga0182007_100034366 125
418 3300015265 Ga0182005_1000080 Ga0182005_100008048 125
419 3300015265 Ga0182005_1004229 Ga0182005_10042294 125
420 3300015265 Ga0182005_1008595 Ga0182005_10085953 125
421 3300017792 Ga0163161_10002457 Ga0163161_100024576 125
422 3300025226 Ga0209674_100119 Ga0209674_10011964 125
423 3300025226 Ga0209674_100426 Ga0209674_10042617 125
424 3300025228 Ga0209672_100016 Ga0209672_100016366 125
425 3300025242 Ga0209258_100012 Ga0209258_100012507 125
426 3300025253 Ga0209677_116022 Ga0209677_1160221 125
427 3300025254 Ga0209148_1000014 Ga0209148_1000014149 125
428 3300025272 Ga0209455_1000014 Ga0209455_100001437 125
429 3300025299 Ga0209256_1004462 Ga0209256_10044629 125
430 3300025303 Ga0209051_1037076 Ga0209051_10370761 125
431 3300025900 Ga0207710_10024201 Ga0207710_100242013 125
432 3300025904 Ga0207647_10000029 Ga0207647_1000002912 125
433 3300025920 Ga0207649_10122482 Ga0207649_101224822 125
434 3300025920 Ga0207649_10678523 Ga0207649_106785232 125
435 3300025932 Ga0207690_10000448 Ga0207690_1000044822 125
436 3300025949 Ga0207667_10080089 Ga0207667_100800893 125
437 3300026067 Ga0207678_10074977 Ga0207678_100749771 125
438 3300026078 Ga0207702_10001547 Ga0207702_100015479 125
439 3300026078 Ga0207702_10248275 Ga0207702_102482751 125
440 3300031731 Ga0307405_10110686 Ga0307405_101106863 125
441 3300031911 Ga0307412_10008807 Ga0307412_100088072 125
442 3300037312 Ga0395899_0047597 Ga0395899_0047597_691_1083 125
443 3300037466 Ga0395898_0001311 Ga0395898_0001311_14124_14516 125
444 3300038443 Ga0395901_0843432 Ga0395901_0843432_205_597 125
445 3300041404 Ga0439436_0000099 Ga0439436_0000099_18872_19261 125
446 3300041413 Ga0439465_0003612 Ga0439465_0003612_4138_4527 125
447 3300042004 Ga0439445_0012742 Ga0439445_0012742_782_1171 125
448 3300042128 Ga0450897_040655 Ga0450897_040655_36_425 125
449 3300042131 Ga0450894_037729 Ga0450894_037729_223_612 125
450 3300042184 Ga0450908_002471 Ga0450908_002471_1437_1826 125
451 3300044656 Ga0466969_0001632 Ga0466969_0001632_6215_6607 125
452 3300044663 Ga0466989_0020593 Ga0466989_0020593_2800_3192 125
453 3300044684 Ga0466966_0039686 Ga0466966_0039686_1862_2254 125
454 3300044693 Ga0466961_0025286 Ga0466961_0025286_66_458 125
455 3300044693 Ga0466961_0487929 Ga0466961_0487929_78_470 125
456 3300044694 Ga0466963_0255153 Ga0466963_0255153_588_980 125
457 3300044735 Ga0466968_0001115 Ga0466968_0001115_8426_8818 125
458 3300044765 Ga0466970_0024169 Ga0466970_0024169_2719_3111 125
459 3300045049 Ga0466959_0252405 Ga0466959_0252405_64_456 125
460 3300045836 Ga0466958_0183193 Ga0466958_0183193_496_888 125
461 3300046452 Ga0495617_000117 Ga0495617_000117_32103_32492 125
462 3300046452 Ga0495617_009842 Ga0495617_009842_1036_1425 125
463 3300046460 Ga0495638_0000153 Ga0495638_0000153_213_602 125
464 3300046460 Ga0495638_0063908 Ga0495638_0063908_248_637 125
465 3300046471 Ga0495650_0003006 Ga0495650_0003006_1435_1824 125
466 3300046492 Ga0495585_0001084 Ga0495585_0001084_8452_8841 125
467 3300046501 Ga0495607_0000120 Ga0495607_0000120_76495_76884 125
468 3300046506 Ga0495583_0385049 Ga0495583_0385049_85_474 125
469 3300046507 Ga0495606_0001210 Ga0495606_0001210_19075_19464 125
470 3300046507 Ga0495606_0002719 Ga0495606_0002719_3109_3498 125
471 3300046507 Ga0495606_0025920 Ga0495606_0025920_690_1079 125
472 3300046512 Ga0495610_0002124 Ga0495610_0002124_704_1093 125
473 3300046512 Ga0495610_0030866 Ga0495610_0030866_119_508 125
474 3300046513 Ga0495616_0080241 Ga0495616_0080241_1045_1434 125
475 3300046515 Ga0495620_0005183 Ga0495620_0005183_2319_2708 125
476 3300046518 Ga0495631_0000029 Ga0495631_0000029_85582_85971 125
477 3300046518 Ga0495631_0001826 Ga0495631_0001826_10744_11133 125
478 3300046519 Ga0495632_0000004 Ga0495632_0000004_256351_256740 125
479 3300046519 Ga0495632_0088872 Ga0495632_0088872_766_1155 125
480 3300046522 Ga0495643_0094780 Ga0495643_0094780_856_1245 125
481 3300046524 Ga0495648_0001512 Ga0495648_0001512_13584_13973 125
482 3300046524 Ga0495648_0013046 Ga0495648_0013046_1536_1925 125
483 3300046538 Ga0495609_0005899 Ga0495609_0005899_4473_4862 125
484 3300046648 Ga0495611_0000001 Ga0495611_0000001_2071432_2071821 125
485 3300046648 Ga0495611_0000060 Ga0495611_0000060_57212_57601 125
486 3300046660 Ga0495625_0000022 Ga0495625_0000022_184975_185364 125
487 3300046660 Ga0495625_0029807 Ga0495625_0029807_3620_4009 125
488 3300046660 Ga0495625_0161202 Ga0495625_0161202_247_636 125
489 3300046665 Ga0495661_0000438 Ga0495661_0000438_7239_7628 125
490 3300046691 Ga0495670_0005573 Ga0495670_0005573_343_732 125
491 3300046691 Ga0495670_0038632 Ga0495670_0038632_481_870 125
492 3300046692 Ga0495671_0024804 Ga0495671_0024804_1361_1750 125
493 3300046694 Ga0495649_0008445 Ga0495649_0008445_1094_1483 125
494 3300046794 Ga0495589_0000237 Ga0495589_0000237_41589_41978 125
495 3300046810 Ga0495660_0000092 Ga0495660_0000092_8162_8551 125
496 3300046810 Ga0495660_0004103 Ga0495660_0004103_8105_8494 125
497 3300047446 Ga0495679_000004 Ga0495679_000004_182191_182580 125
498 3300047469 Ga0495673_0000004 Ga0495673_0000004_10379_10768 125
499 3300047469 Ga0495673_0001152 Ga0495673_0001152_21885_22274 125
500 3300047469 Ga0495673_0001469 Ga0495673_0001469_16593_16982 125
501 3300047472 Ga0495686_0000017 Ga0495686_0000017_93944_94339 125
502 3300047472 Ga0495686_0011096 Ga0495686_0011096_5043_5432 125
503 3300047472 Ga0495686_0105700 Ga0495686_0105700_830_1219 125
504 3300048903 Ga0496100_0028387 Ga0496100_0028387_1389_1778 125
505 3300048904 Ga0496101_0001374 Ga0496101_0001374_1966_2355 125
506 3300048905 Ga0496102_0387398 Ga0496102_0387398_614_1009 125
507 3300048909 Ga0496106_0000309 Ga0496106_0000309_32704_33093 125
508 3300048909 Ga0496106_0921086 Ga0496106_0921086_156_551 125
509 3300048919 Ga0496116_0116936 Ga0496116_0116936_919_1314 125
510 3300048920 Ga0496117_0027842 Ga0496117_0027842_69_464 125
511 3300048920 Ga0496117_0129266 Ga0496117_0129266_265_660 125
512 3300048921 Ga0496118_0002637 Ga0496118_0002637_4647_5042 125
513 3300048921 Ga0496118_0092608 Ga0496118_0092608_276_671 125
514 3300048921 Ga0496118_0503770 Ga0496118_0503770_15_404 125
515 3300048922 Ga0496119_0071853 Ga0496119_0071853_965_1354 125
516 3300048924 Ga0496121_0000045 Ga0496121_0000045_251578_251973 125
517 3300048924 Ga0496121_0006695 Ga0496121_0006695_13497_13886 125
518 3300048924 Ga0496121_0181665 Ga0496121_0181665_904_1293 125
519 3300048925 Ga0496122_0181748 Ga0496122_0181748_45_440 125
520 3300048926 Ga0496123_0017670 Ga0496123_0017670_2744_3139 125
521 3300048927 Ga0496124_0373776 Ga0496124_0373776_451_840 125
522 3300048928 Ga0496125_0010765 Ga0496125_0010765_7427_7822 125
523 3300048929 Ga0496126_0183782 Ga0496126_0183782_310_705 125
524 3300049459 Ga0495678_001379 Ga0495678_001379_3892_4281 125
525 3300049460 Ga0495682_0006075 Ga0495682_0006075_254_643 125
526 3300049460 Ga0495682_0064224 Ga0495682_0064224_616_1005 125
527 3300053087 Ga0500643_000108 Ga0500643_000108_11383_11772 125
528 3300053103 Ga0500555_000942 Ga0500555_000942_8440_8829 125
529 3300053730 Ga0500645_002222 Ga0500645_002222_7101_7490 125
530 iso_pu_bacteria 2919085039 2919087588 125
531 3300026142 Ga0207698_10265152 Ga0207698_102651522 126
532 3300001979 JGI24740J21852_10174049 JGI24740J21852_101740491 127
533 3300005327 Ga0070658_10001446 Ga0070658_100014467 127
534 3300005335 Ga0070666_10000007 Ga0070666_1000000797 127
535 3300005344 Ga0070661_100232873 Ga0070661_1002328732 127
536 3300005347 Ga0070668_100431163 Ga0070668_1004311632 127
537 3300005367 Ga0070667_100087948 Ga0070667_1000879482 127
538 3300005548 Ga0070665_100005386 Ga0070665_10000538612 127
539 3300005843 Ga0068860_100218111 Ga0068860_1002181112 127
540 3300009176 Ga0105242_10613184 Ga0105242_106131841 127
541 3300009551 Ga0105238_10000972 Ga0105238_1000097228 127
542 3300013306 Ga0163162_10010824 Ga0163162_100108247 127
543 3300025903 Ga0207680_10000002 Ga0207680_10000002731 127
544 3300025909 Ga0207705_10040657 Ga0207705_100406573 127
545 3300025920 Ga0207649_10088430 Ga0207649_100884302 127
546 3300025924 Ga0207694_10000470 Ga0207694_1000047028 127
547 3300025972 Ga0207668_10766201 Ga0207668_107662012 127
548 3300025986 Ga0207658_10182141 Ga0207658_101821413 127
549 3300026035 Ga0207703_11869879 Ga0207703_118698791 127
550 3300028379 Ga0268266_10000004 Ga0268266_10000004727 127
551 3300028381 Ga0268264_10057271 Ga0268264_100572714 127
552 3300033180 Ga0307510_10000770 Ga0307510_100007705 127
553 3300046471 Ga0495650_0000271 Ga0495650_0000271_49687_50070 127
554 3300046471 Ga0495650_0165229 Ga0495650_0165229_167_550 127
555 3300046660 Ga0495625_0154886 Ga0495625_0154886_367_750 127
556 3300048921 Ga0496118_0528659 Ga0496118_0528659_161_544 127
557 3300048924 Ga0496121_0062715 Ga0496121_0062715_691_1074 127
558 3300048929 Ga0496126_0058598 Ga0496126_0058598_1226_1609 127
559 3300053090 Ga0500646_0027234 Ga0500646_0027234_367_750 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

42

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9568 24 119
1p8c-assembly1.cif.gz_A crystal structure of tm1620 (apc4843) from thermotoga maritima 0.9534 15 119
1p8c-assembly1.cif.gz_B crystal structure of tm1620 (apc4843) from thermotoga maritima 0.9496 8 119
1vke-assembly1.cif.gz_A crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9457 9 120
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9379 24 119
ID Description Score Start End Superfamily
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9705 26 120 1.20.1290.10
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9618 26 120 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9568 24 119 1.20.1290.10
1p8cB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9496 8 119 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9379 24 119 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A3M1PWW5-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9998 46 115 GO:0051920
AF-A0A2R7P0P1-F1-model_v4 deleted 0.9985 38 116
AF-A0A7Z1R3G8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9965 48 115 GO:0051920
AF-A0A4Y7U3X9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9961 49 117 GO:0051920
AF-A0A520IVB4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9957 40 114 GO:0051920

Feature Viewer

pLDDT pTM Quality
88.64 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map