F463419

General Info

Members Datasets Scaffolds Average Seq Length
558 240 1116 298

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100107437|Ga0068858_1001074372
Length 321
Sequence LAVDMGRGKEQRMVRSGWEAVMSIRPVKRLIKAKPTMEGAGVHLRRAFGFGNTNEFDPFLLLDDFRNDVPEDYLAGFPWHPHRGIETVTYVLAGNVEHGDSMGNQGTIGAGDVQWMTAGRGIIHQEMPKGDAEGRMHGFQLWANLPAAQKMTAPRYQEVKAPDIPVITDDDGTHVRIVCGSFWGSKGPVDGIASDPVYIDVSVGPGRRKTLPVETTRHAFAYVFAGGGKFCNASGPLAVPTEGLGWADKVPPAEADNRSLVLFDRGDEVTVQAGEEGIRFLLVSGKPLQEPVAWYGPIVMNTQDQLREAFEELDKGTFLKK

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
181 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
182 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100107437 3300005842 Bacteria 2605
2 Ga0065715_10208762 3300005293 Bacteria 1324
3 Ga0070658_10235719 3300005327 Bacteria 1550
4 Ga0070658_10270149 3300005327 Bacteria 1446
5 Ga0070683_100024914 3300005329 Bacteria 5365
6 Ga0070683_100064893 3300005329 Bacteria 3399
7 Ga0070683_100293709 3300005329 Bacteria 1546
8 Ga0070683_100302062 3300005329 Bacteria 1523
9 Ga0070670_100149119 3300005331 Bacteria 2024
10 Ga0068869_100101303 3300005334 Bacteria 2179
11 Ga0068869_100115201 3300005334 Bacteria 2049
12 Ga0070666_10001068 3300005335 Bacteria 16742
13 Ga0070666_10124840 3300005335 Bacteria 1786
14 Ga0070680_100002717 3300005336 Bacteria 13118
15 Ga0070682_100009366 3300005337 Bacteria 5542
16 Ga0068868_100005954 3300005338 Bacteria 8600
17 Ga0068868_100042442 3300005338 Unclassified 3550
18 Ga0068868_100209769 3300005338 Bacteria 1627
19 Ga0068868_100441070 3300005338 Bacteria 1131
20 Ga0070660_100195956 3300005339 Bacteria 1637
21 Ga0070689_100049514 3300005340 Bacteria 3244
22 Ga0070691_10020544 3300005341 Bacteria 3051
23 Ga0070661_100042778 3300005344 Unclassified 3307
24 Ga0070661_100062753 3300005344 Bacteria 2728
25 Ga0070661_100339840 3300005344 Bacteria 1176
26 Ga0070671_100006727 3300005355 Bacteria 9198
27 Ga0070688_100022814 3300005365 Bacteria 3674
28 Ga0070659_100103041 3300005366 Bacteria 2298
29 Ga0070667_100053433 3300005367 Bacteria 3409
30 Ga0070667_100225309 3300005367 Bacteria 1670
31 Ga0070667_100421980 3300005367 Bacteria 1216
32 Ga0070709_10043844 3300005434 Bacteria 2768
33 Ga0070709_10110616 3300005434 Bacteria 1846
34 Ga0070714_100070429 3300005435 Bacteria 3023
35 Ga0070714_100236991 3300005435 Bacteria 1683
36 Ga0070714_100627839 3300005435 Bacteria 1033
37 Ga0070713_100064097 3300005436 Bacteria 3083
38 Ga0070713_100096354 3300005436 Bacteria 2554
39 Ga0070713_100272283 3300005436 Bacteria 1551
40 Ga0070711_100010546 3300005439 Bacteria 5722
41 Ga0070711_100382742 3300005439 Bacteria 1138
42 Ga0070708_100000611 3300005445 Bacteria 26919
43 Ga0070708_100007812 3300005445 Bacteria 8572
44 Ga0070708_100121581 3300005445 Bacteria 2409
45 Ga0070708_100237087 3300005445 Bacteria 1712
46 Ga0070708_100319252 3300005445 Bacteria 1463
47 Ga0070663_100185711 3300005455 Bacteria 1615
48 Ga0070678_100223718 3300005456 Unclassified 1565
49 Ga0070681_10029991 3300005458 Bacteria 5459
50 Ga0070681_10086173 3300005458 Bacteria 3094
51 Ga0070681_10086483 3300005458 Bacteria 3088
52 Ga0070681_10146190 3300005458 Bacteria 2293
53 Ga0070681_10237977 3300005458 Bacteria 1734
54 Ga0070681_10357139 3300005458 Bacteria 1371
55 Ga0068867_100007916 3300005459 Bacteria 7506
56 Ga0068867_100062427 3300005459 Bacteria 2768
57 Ga0070706_100111202 3300005467 Bacteria 2549
58 Ga0070706_100438109 3300005467 Bacteria 1216
59 Ga0070707_100002607 3300005468 Bacteria 17130
60 Ga0070707_100007551 3300005468 Bacteria 10099
61 Ga0070707_100087416 3300005468 Bacteria 3015
62 Ga0070698_100000203 3300005471 Bacteria 57165
63 Ga0070698_100023255 3300005471 Bacteria 6479
64 Ga0070698_100251758 3300005471 Bacteria 1699
65 Ga0070699_100034036 3300005518 Bacteria 4403
66 Ga0070679_100017046 3300005530 Bacteria 7022
67 Ga0070679_100241035 3300005530 Bacteria 1765
68 Ga0070679_100413138 3300005530 Bacteria 1295
69 Ga0070679_100650538 3300005530 Bacteria 997
70 Ga0070684_100003654 3300005535 Bacteria 11603
71 Ga0070684_100028094 3300005535 Bacteria 4755
72 Ga0070684_100098765 3300005535 Bacteria 2605
73 Ga0070684_100169252 3300005535 Bacteria 1984
74 Ga0070684_100373062 3300005535 Bacteria 1314
75 Ga0070697_100019473 3300005536 Bacteria 5361
76 Ga0070697_100125027 3300005536 Bacteria 2154
77 Ga0070697_100316612 3300005536 Bacteria 1343
78 Ga0070672_100311112 3300005543 Bacteria 1337
79 Ga0070695_100055203 3300005545 Bacteria 2559
80 Ga0070696_100033352 3300005546 Bacteria 3537
81 Ga0070693_100067278 3300005547 Bacteria 2099
82 Ga0070665_100242763 3300005548 Bacteria 1802
83 Ga0070665_100427257 3300005548 Bacteria 1334
84 Ga0068855_100009965 3300005563 Bacteria 11454
85 Ga0068855_100063468 3300005563 Bacteria 4311
86 Ga0068855_100100942 3300005563 Bacteria 3322
87 Ga0068855_100108255 3300005563 Bacteria 3192
88 Ga0068855_100182165 3300005563 Bacteria 2374
89 Ga0068855_100270876 3300005563 Bacteria 1888
90 Ga0068855_100654229 3300005563 Bacteria 1128
91 Ga0068857_100000413 3300005577 Bacteria 30166
92 Ga0068857_100009450 3300005577 Bacteria 8466
93 Ga0068857_100096093 3300005577 Bacteria 2655
94 Ga0068857_100315259 3300005577 Bacteria 1443
95 Ga0068854_100087673 3300005578 Bacteria 2309
96 Ga0068856_100012748 3300005614 Bacteria 8139
97 Ga0068856_100024650 3300005614 Bacteria 5857
98 Ga0068856_100064360 3300005614 Bacteria 3623
99 Ga0068856_100175328 3300005614 Bacteria 2156
100 Ga0068856_100176710 3300005614 Bacteria 2147
101 Ga0068856_100192768 3300005614 Bacteria 2052
102 Ga0068856_100260611 3300005614 Bacteria 1749
103 Ga0068856_100262250 3300005614 Bacteria 1743
104 Ga0068856_100333553 3300005614 Bacteria 1534
105 Ga0068852_100033369 3300005616 Bacteria 4273
106 Ga0068859_100033565 3300005617 Bacteria 5154
107 Ga0068859_100166260 3300005617 Bacteria 2286
108 Ga0068859_100192290 3300005617 Bacteria 2125
109 Ga0068864_100017625 3300005618 Bacteria 5953
110 Ga0068864_100078976 3300005618 Bacteria 2880
111 Ga0068864_100093522 3300005618 Bacteria 2656
112 Ga0068866_10068492 3300005718 Bacteria 1866
113 Ga0068851_10171168 3300005834 Bacteria 1199
114 Ga0068863_100052090 3300005841 Bacteria 3879
115 Ga0068863_100087504 3300005841 Bacteria 2952
116 Ga0068858_100002519 3300005842 Bacteria 18453
117 Ga0068858_100045988 3300005842 Bacteria 4047
118 Ga0068858_100103113 3300005842 Bacteria 2661
119 Ga0068858_100524594 3300005842 Bacteria 1145
120 Ga0068860_100002618 3300005843 Bacteria 18713
121 Ga0068860_100100426 3300005843 Bacteria 2760
122 Ga0068860_100182464 3300005843 Bacteria 2029
123 Ga0070717_10012609 3300006028 Bacteria 6449
124 Ga0070717_10048039 3300006028 Bacteria 3499
125 Ga0070716_100000130 3300006173 Bacteria 30032
126 Ga0070716_100009477 3300006173 Bacteria 4856
127 Ga0070716_100035303 3300006173 Bacteria 2748
128 Ga0070716_100058924 3300006173 Bacteria 2212
129 Ga0070716_100069562 3300006173 Bacteria 2063
130 Ga0070712_100000892 3300006175 Bacteria 17878
131 Ga0070712_100001308 3300006175 Bacteria 15079
132 Ga0070712_100042183 3300006175 Bacteria 3137
133 Ga0070712_100450229 3300006175 Bacteria 1072
134 Ga0097621_100001702 3300006237 Bacteria 15036
135 Ga0097621_100013474 3300006237 Bacteria 6095
136 Ga0097621_100028935 3300006237 Bacteria 4372
137 Ga0097621_100100128 3300006237 Bacteria 2438
138 Ga0097621_100239534 3300006237 Bacteria 1585
139 Ga0097621_100300410 3300006237 Bacteria 1418
140 Ga0068871_100000567 3300006358 Bacteria 25299
141 Ga0068871_100015210 3300006358 Bacteria 5753
142 Ga0068871_100044462 3300006358 Bacteria 3572
143 Ga0068871_100095783 3300006358 Bacteria 2479
144 Ga0068871_100106961 3300006358 Bacteria 2349
145 Ga0068871_100134075 3300006358 Bacteria 2102
146 Ga0068871_100142207 3300006358 Bacteria 2041
147 Ga0068871_100529675 3300006358 Bacteria 1065
148 Ga0075428_100030516 3300006844 Bacteria 5961
149 Ga0075433_10012751 3300006852 Bacteria 6805
150 Ga0075434_100000323 3300006871 Bacteria 34240
151 Ga0075434_100004373 3300006871 Bacteria 12724
152 Ga0068865_100051243 3300006881 Bacteria 2856
153 Ga0068865_100056214 3300006881 Bacteria 2741
154 Ga0068865_100233279 3300006881 Bacteria 1445
155 Ga0075436_100262380 3300006914 Bacteria 1232
156 Ga0097620_100033564 3300006931 Bacteria 5154
157 Ga0097620_100166261 3300006931 Bacteria 2286
158 Ga0097620_100192300 3300006931 Bacteria 2125
159 Ga0075435_100050876 3300007076 Bacteria 3335
160 Ga0075435_100291241 3300007076 Bacteria 1395
161 Ga0075435_100300465 3300007076 Bacteria 1373
162 Ga0099794_10004676 3300007265 Bacteria 5418
163 Ga0099795_10017889 3300007788 Bacteria 2267
164 Ga0105240_10001187 3300009093 Bacteria 45557
165 Ga0105240_10049943 3300009093 Bacteria 5276
166 Ga0105240_10207384 3300009093 Bacteria 2293
167 Ga0105240_10260666 3300009093 Bacteria 2000
168 Ga0105240_10274985 3300009093 Bacteria 1938
169 Ga0111539_10046328 3300009094 Bacteria 5201
170 Ga0111539_10217922 3300009094 Bacteria 2223
171 Ga0105245_10009564 3300009098 Bacteria 8455
172 Ga0105245_10011221 3300009098 Bacteria 7799
173 Ga0105245_10016300 3300009098 Bacteria 6480
174 Ga0105245_10030294 3300009098 Bacteria 4784
175 Ga0105245_10118583 3300009098 Bacteria 2470
176 Ga0105245_10126786 3300009098 Bacteria 2390
177 Ga0105245_10181361 3300009098 Bacteria 2012
178 Ga0105247_10085162 3300009101 Bacteria 1998
179 Ga0105243_10044004 3300009148 Bacteria 3501
180 Ga0105243_10098776 3300009148 Bacteria 2419
181 Ga0105243_10231794 3300009148 Bacteria 1639
182 Ga0105243_10246178 3300009148 Bacteria 1594
183 Ga0105241_10015240 3300009174 Bacteria 5629
184 Ga0105241_10025188 3300009174 Bacteria 4422
185 Ga0105241_10025426 3300009174 Bacteria 4399
186 Ga0105241_10057564 3300009174 Bacteria 2982
187 Ga0105241_10081142 3300009174 Bacteria 2540
188 Ga0105241_10107162 3300009174 Bacteria 2232
189 Ga0105241_10141125 3300009174 Bacteria 1962
190 Ga0105241_10507068 3300009174 Bacteria 1077
191 Ga0105242_10006597 3300009176 Bacteria 8941
192 Ga0105242_10027849 3300009176 Bacteria 4493
193 Ga0105242_10045953 3300009176 Bacteria 3541
194 Ga0105242_10059787 3300009176 Bacteria 3128
195 Ga0105242_10066694 3300009176 Bacteria 2973
196 Ga0105242_10074102 3300009176 Bacteria 2832
197 Ga0105242_10097223 3300009176 Bacteria 2489
198 Ga0105242_10162800 3300009176 Bacteria 1954
199 Ga0105248_10003076 3300009177 Bacteria 18501
200 Ga0105248_10081233 3300009177 Bacteria 3643
201 Ga0105248_10087520 3300009177 Bacteria 3506
202 Ga0105248_10104186 3300009177 Unclassified 3198
203 Ga0105248_10105920 3300009177 Bacteria 3170
204 Ga0105248_10214380 3300009177 Bacteria 2169
205 Ga0105237_10000017 3300009545 Bacteria 246292
206 Ga0105237_10001552 3300009545 Bacteria 29969
207 Ga0105237_10108363 3300009545 Bacteria 2769
208 Ga0105237_10143312 3300009545 Bacteria 2384
209 Ga0105237_10312565 3300009545 Bacteria 1574
210 Ga0105237_10467815 3300009545 Bacteria 1267
211 Ga0105238_10004574 3300009551 Bacteria 13680
212 Ga0105238_10009281 3300009551 Bacteria 9845
213 Ga0105238_10014676 3300009551 Bacteria 7920
214 Ga0105238_10019083 3300009551 Bacteria 6985
215 Ga0105238_10038533 3300009551 Bacteria 4853
216 Ga0105238_10045069 3300009551 Bacteria 4455
217 Ga0105238_10062281 3300009551 Bacteria 3731
218 Ga0105238_10143228 3300009551 Unclassified 2367
219 Ga0105238_10222023 3300009551 Bacteria 1866
220 Ga0105238_10311791 3300009551 Bacteria 1558
221 Ga0105238_10423373 3300009551 Bacteria 1326
222 Ga0105249_10033230 3300009553 Bacteria 4670
223 Ga0105249_10118916 3300009553 Unclassified 2509
224 Ga0099796_10015941 3300010159 Bacteria 2209
225 Ga0105239_10016063 3300010375 Bacteria 8283
226 Ga0105239_10037749 3300010375 Bacteria 5294
227 Ga0105239_10119134 3300010375 Bacteria 2930
228 Ga0105239_10121929 3300010375 Bacteria 2896
229 Ga0105239_10265172 3300010375 Bacteria 1931
230 Ga0105239_10311867 3300010375 Bacteria 1773
231 Ga0105246_10013144 3300011119 Bacteria 5182
232 Ga0105246_10033065 3300011119 Bacteria 3435
233 Ga0105246_10092055 3300011119 Bacteria 2187
234 Ga0157371_10068121 3300013102 Bacteria 2519
235 Ga0157370_10003281 3300013104 Bacteria 19071
236 Ga0157370_10039592 3300013104 Bacteria 4555
237 Ga0157370_10365747 3300013104 Bacteria 1329
238 Ga0157369_10015552 3300013105 Bacteria 8577
239 Ga0157369_10017082 3300013105 Bacteria 8153
240 Ga0157369_10087606 3300013105 Bacteria 3324
241 Ga0157369_10250175 3300013105 Bacteria 1850
242 Ga0157369_10311020 3300013105 Bacteria 1638
243 Ga0157369_10448378 3300013105 Bacteria 1336
244 Ga0157374_10050288 3300013296 Bacteria 3874
245 Ga0157374_10215667 3300013296 Bacteria 1882
246 Ga0157374_10334342 3300013296 Bacteria 1503
247 Ga0157374_10368835 3300013296 Bacteria 1429
248 Ga0157378_10003467 3300013297 Bacteria 13995
249 Ga0157378_10007189 3300013297 Bacteria 9724
250 Ga0157378_10066228 3300013297 Bacteria 3235
251 Ga0157378_10084790 3300013297 Bacteria 2869
252 Ga0157378_10185252 3300013297 Bacteria 1960
253 Ga0163162_10008909 3300013306 Bacteria 9758
254 Ga0163162_10012597 3300013306 Bacteria 8259
255 Ga0163162_10085110 3300013306 Bacteria 3238
256 Ga0157372_10022006 3300013307 Bacteria 6893
257 Ga0157372_10074036 3300013307 Bacteria 3840
258 Ga0157372_10175247 3300013307 Bacteria 2482
259 Ga0157372_10191210 3300013307 Bacteria 2371
260 Ga0157372_10450179 3300013307 Bacteria 1500
261 Ga0157375_10012854 3300013308 Bacteria 7436
262 Ga0157375_10129426 3300013308 Bacteria 2642
263 Ga0157375_10184976 3300013308 Bacteria 2236
264 Ga0163163_10011176 3300014325 Bacteria 8131
265 Ga0163163_10042904 3300014325 Bacteria 4432
266 Ga0163163_10045245 3300014325 Bacteria 4320
267 Ga0163163_10133155 3300014325 Bacteria 2526
268 Ga0163163_10150783 3300014325 Bacteria 2369
269 Ga0163163_10179995 3300014325 Bacteria 2161
270 Ga0163163_10218314 3300014325 Bacteria 1955
271 Ga0163163_10635211 3300014325 Bacteria 1131
272 Ga0157377_10237462 3300014745 Bacteria 1175
273 Ga0157379_10007304 3300014968 Bacteria 9560
274 Ga0157376_10108580 3300014969 Bacteria 2438
275 Ga0157376_10235601 3300014969 Bacteria 1703
276 Ga0157376_10407619 3300014969 Bacteria 1316
277 Ga0157376_10485205 3300014969 Bacteria 1212
278 Ga0213872_10001079 3300021361 Bacteria 18793
279 Ga0213872_10051631 3300021361 Bacteria 1866
280 Ga0213876_10156399 3300021384 Bacteria 1213
281 Ga0213875_10032178 3300021388 Bacteria 2479
282 Ga0213875_10090753 3300021388 Bacteria 1425
283 Ga0224712_10023033 3300022467 Bacteria 2156
284 Ga0207656_10117270 3300025321 Bacteria 1236
285 Ga0207642_10142998 3300025899 Bacteria 1264
286 Ga0207680_10008341 3300025903 Bacteria 5079
287 Ga0207680_10073488 3300025903 Bacteria 2126
288 Ga0207699_10093955 3300025906 Bacteria 1888
289 Ga0207645_10016738 3300025907 Bacteria 4848
290 Ga0207705_10028833 3300025909 Bacteria 3956
291 Ga0207705_10136374 3300025909 Unclassified 1830
292 Ga0207684_10003562 3300025910 Bacteria 15153
293 Ga0207654_10017347 3300025911 Bacteria 3760
294 Ga0207654_10036892 3300025911 Bacteria 2734
295 Ga0207654_10041513 3300025911 Bacteria 2598
296 Ga0207654_10071839 3300025911 Bacteria 2059
297 Ga0207654_10179092 3300025911 Bacteria 1382
298 Ga0207654_10207112 3300025911 Bacteria 1294
299 Ga0207707_10001558 3300025912 Bacteria 21102
300 Ga0207707_10030800 3300025912 Bacteria 4693
301 Ga0207707_10045858 3300025912 Bacteria 3807
302 Ga0207707_10136055 3300025912 Bacteria 2148
303 Ga0207707_10300447 3300025912 Bacteria 1388
304 Ga0207695_10001191 3300025913 Bacteria 44742
305 Ga0207695_10002239 3300025913 Bacteria 28994
306 Ga0207695_10011055 3300025913 Bacteria 10967
307 Ga0207695_10025610 3300025913 Bacteria 6599
308 Ga0207695_10070542 3300025913 Bacteria 3571
309 Ga0207695_10075889 3300025913 Bacteria 3419
310 Ga0207695_10184230 3300025913 Bacteria 2008
311 Ga0207671_10008124 3300025914 Bacteria 8954
312 Ga0207671_10022281 3300025914 Bacteria 4791
313 Ga0207671_10023399 3300025914 Bacteria 4659
314 Ga0207671_10028584 3300025914 Bacteria 4165
315 Ga0207671_10102722 3300025914 Bacteria 2167
316 Ga0207693_10000649 3300025915 Bacteria 31124
317 Ga0207693_10001686 3300025915 Bacteria 19453
318 Ga0207693_10050199 3300025915 Bacteria 3276
319 Ga0207693_10142245 3300025915 Bacteria 1886
320 Ga0207663_10000855 3300025916 Bacteria 13827
321 Ga0207663_10111620 3300025916 Bacteria 1856
322 Ga0207660_10015377 3300025917 Bacteria 5049
323 Ga0207660_10043698 3300025917 Bacteria 3149
324 Ga0207657_10001429 3300025919 Bacteria 25496
325 Ga0207657_10004076 3300025919 Bacteria 15508
326 Ga0207649_10140359 3300025920 Bacteria 1652
327 Ga0207649_10152581 3300025920 Bacteria 1593
328 Ga0207649_10170842 3300025920 Bacteria 1514
329 Ga0207649_10216135 3300025920 Bacteria 1363
330 Ga0207652_10051898 3300025921 Bacteria 3517
331 Ga0207646_10001451 3300025922 Bacteria 29389
332 Ga0207646_10003662 3300025922 Bacteria 17171
333 Ga0207646_10144540 3300025922 Bacteria 2143
334 Ga0207694_10001026 3300025924 Bacteria 24356
335 Ga0207694_10005812 3300025924 Bacteria 9453
336 Ga0207694_10015190 3300025924 Bacteria 5807
337 Ga0207694_10035068 3300025924 Bacteria 3847
338 Ga0207694_10039365 3300025924 Bacteria 3638
339 Ga0207694_10076242 3300025924 Bacteria 2626
340 Ga0207694_10166264 3300025924 Bacteria 1784
341 Ga0207687_10000640 3300025927 Bacteria 23648
342 Ga0207687_10003715 3300025927 Bacteria 10272
343 Ga0207687_10004024 3300025927 Bacteria 9849
344 Ga0207687_10064107 3300025927 Bacteria 2604
345 Ga0207687_10140150 3300025927 Bacteria 1834
346 Ga0207700_10063452 3300025928 Bacteria 2810
347 Ga0207700_10067524 3300025928 Bacteria 2737
348 Ga0207664_10493698 3300025929 Bacteria 1096
349 Ga0207644_10024996 3300025931 Bacteria 4103
350 Ga0207706_10001454 3300025933 Bacteria 23707
351 Ga0207686_10004228 3300025934 Bacteria 7695
352 Ga0207686_10047493 3300025934 Bacteria 2654
353 Ga0207686_10099437 3300025934 Bacteria 1939
354 Ga0207709_10123836 3300025935 Bacteria 1750
355 Ga0207709_10144162 3300025935 Bacteria 1641
356 Ga0207709_10279696 3300025935 Bacteria 1232
357 Ga0207669_10123326 3300025937 Bacteria 1764
358 Ga0207704_10002771 3300025938 Bacteria 7911
359 Ga0207665_10002575 3300025939 Bacteria 12182
360 Ga0207665_10017092 3300025939 Bacteria 4764
361 Ga0207665_10026421 3300025939 Bacteria 3832
362 Ga0207711_10000954 3300025941 Bacteria 27678
363 Ga0207711_10057172 3300025941 Bacteria 3353
364 Ga0207711_10059770 3300025941 Bacteria 3282
365 Ga0207711_10136212 3300025941 Unclassified 2206
366 Ga0207689_10052131 3300025942 Bacteria 3372
367 Ga0207661_10263380 3300025944 Bacteria 1536
368 Ga0207661_10333120 3300025944 Bacteria 1366
369 Ga0207679_10316799 3300025945 Bacteria 1349
370 Ga0207667_10007381 3300025949 Bacteria 13228
371 Ga0207667_10018079 3300025949 Bacteria 7915
372 Ga0207667_10019050 3300025949 Bacteria 7672
373 Ga0207667_10052607 3300025949 Bacteria 4287
374 Ga0207667_10078204 3300025949 Bacteria 3429
375 Ga0207667_10165645 3300025949 Bacteria 2272
376 Ga0207712_10016489 3300025961 Bacteria 4786
377 Ga0207712_10024609 3300025961 Bacteria 3990
378 Ga0207668_10030200 3300025972 Bacteria 3560
379 Ga0207658_10241505 3300025986 Bacteria 1530
380 Ga0207677_10418665 3300026023 Bacteria 1140
381 Ga0207703_10003769 3300026035 Bacteria 12601
382 Ga0207703_10087026 3300026035 Bacteria 2619
383 Ga0207703_10577591 3300026035 Bacteria 1062
384 Ga0207639_10090164 3300026041 Bacteria 2452
385 Ga0207678_10004519 3300026067 Bacteria 12510
386 Ga0207702_10000215 3300026078 Bacteria 67893
387 Ga0207702_10001936 3300026078 Bacteria 20214
388 Ga0207702_10033713 3300026078 Bacteria 4278
389 Ga0207702_10076687 3300026078 Bacteria 2890
390 Ga0207702_10097259 3300026078 Bacteria 2591
391 Ga0207641_10085906 3300026088 Bacteria 2742
392 Ga0207641_10219247 3300026088 Bacteria 1763
393 Ga0207648_10008119 3300026089 Bacteria 10213
394 Ga0207648_10013228 3300026089 Bacteria 7687
395 Ga0207648_10118913 3300026089 Bacteria 2322
396 Ga0207676_10030237 3300026095 Bacteria 4063
397 Ga0207676_10086964 3300026095 Bacteria 2555
398 Ga0207674_10000628 3300026116 Bacteria 46099
399 Ga0207674_10010833 3300026116 Bacteria 10280
400 Ga0207674_10016835 3300026116 Bacteria 7989
401 Ga0207674_10038820 3300026116 Bacteria 4940
402 Ga0207674_10042728 3300026116 Bacteria 4679
403 Ga0207674_10115542 3300026116 Bacteria 2655
404 Ga0207674_10354766 3300026116 Bacteria 1418
405 Ga0207683_10525692 3300026121 Bacteria 1093
406 Ga0207698_10017522 3300026142 Bacteria 4862
407 Ga0207698_10211667 3300026142 Bacteria 1745
408 Ga0209588_1013728 3300027671 Bacteria 2474
409 Ga0207428_10040311 3300027907 Bacteria 3789
410 Ga0268266_10051414 3300028379 Bacteria 3537
411 Ga0268266_10206397 3300028379 Bacteria 1800
412 Ga0268266_10303778 3300028379 Bacteria 1489
413 Ga0268264_10061996 3300028381 Unclassified 3139
414 Ga0268264_10123916 3300028381 Bacteria 2281
415 Ga0265318_10020232 3300028577 Unclassified 2687
416 Ga0265338_10055350 3300028800 Bacteria 3529
417 Ga0265324_10040276 3300029957 Bacteria 1619
418 Ga0265332_10000116 3300031238 Bacteria 67434
419 Ga0265332_10018439 3300031238 Bacteria 3080
420 Ga0265328_10003977 3300031239 Bacteria 6489
421 Ga0265325_10061313 3300031241 Bacteria 1908
422 Ga0265340_10010950 3300031247 Bacteria 4839
423 Ga0265340_10096411 3300031247 Bacteria 1378
424 Ga0265331_10000048 3300031250 Bacteria 182667
425 Ga0265331_10107920 3300031250 Bacteria 1278
426 Ga0265331_10117892 3300031250 Bacteria 1214
427 Ga0265316_10000101 3300031344 Bacteria 93478
428 Ga0265316_10007489 3300031344 Bacteria 10281
429 Ga0265316_10042888 3300031344 Bacteria 3612
430 Ga0265313_10077953 3300031595 Bacteria 1512
431 Ga0316575_10015637 3300031665 Bacteria 2862
432 Ga0265314_10000129 3300031711 Bacteria 115188
433 Ga0265314_10003772 3300031711 Bacteria 14487
434 Ga0265314_10034647 3300031711 Bacteria 3686
435 Ga0265342_10002020 3300031712 Bacteria 18041
436 Ga0265342_10048554 3300031712 Bacteria 2544
437 Ga0265342_10152382 3300031712 Bacteria 1283
438 Ga0316576_10027549 3300031727 Bacteria 3997
439 Ga0316576_10031257 3300031727 Bacteria 3777
440 Ga0316576_10034261 3300031727 Bacteria 3619
441 Ga0316576_10060372 3300031727 Bacteria 2777
442 Ga0316576_10237984 3300031727 Bacteria 1368
443 Ga0316578_10033365 3300031728 Bacteria 2949
444 Ga0316578_10058904 3300031728 Bacteria 2258
445 Ga0316583_10010410 3300032133 Bacteria 3353
446 Ga0316585_10019661 3300032137 Bacteria 2060
447 Ga0316593_10020995 3300032168 Bacteria 2037
448 Ga0373930_0007620 3300034816 Bacteria 1869
449 Ga0373934_0002272 3300035086 Bacteria 7070
450 Ga0373940_0009573 3300035088 Bacteria 2256
451 Ga0373954_0054949 3300035118 Bacteria 1873
452 Ga0373955_0001642 3300035172 Bacteria 9574
453 Ga0373931_0016373 3300035691 Bacteria 3649
454 Ga0373931_0019230 3300035691 Bacteria 3407
455 Ga0373927_0000333 3300035695 Bacteria 36933
456 Ga0373927_0041408 3300035695 Bacteria 2988
457 Ga0373933_0176557 3300035724 Bacteria 1361
458 Ga0373947_0000910 3300035725 Bacteria 17924
459 Ga0373937_0004799 3300036401 Bacteria 11484
460 Ga0373937_0070926 3300036401 Bacteria 3214
461 Ga0373937_0171732 3300036401 Bacteria 2034
462 Ga0373937_0178610 3300036401 Bacteria 1993
463 Ga0316582_0201331 3300036647 Bacteria 1358
464 Ga0316584_0026554 3300036712 Bacteria 4257
465 Ga0373925_0003551 3300037068 Bacteria 12026
466 Ga0373925_0011554 3300037068 Bacteria 6387
467 Ga0316581_0147913 3300037588 Bacteria 724
468 Ga0436364_0130141 3300037853 Bacteria 2153
469 Ga0436364_1255431 3300037853 Bacteria 3846
470 Ga0436364_1377625 3300037853 Bacteria 3264
471 Ga0400484_04818 3300038725 Bacteria 3433
472 Ga0400491_06493 3300038727 Bacteria 1284
473 Ga0400488_11814 3300038741 Bacteria 11483
474 Ga0400486_25894 3300038742 Bacteria 11730
475 Ga0436365_0903109 3300039437 Unclassified 1630
476 Ga0436360_0413852 3300039438 Bacteria 1579
477 Ga0436360_0435719 3300039438 Bacteria 5303
478 Ga0436361_0306192 3300039447 Bacteria 136694
479 Ga0436361_0878656 3300039447 Bacteria 5256
480 Ga0439448_0102640 3300042005 Bacteria 973
481 Ga0451577_0002637 3300042876 Bacteria 21011
482 Ga0451577_0070596 3300042876 Bacteria 3115
483 Ga0453683_0007373 3300044673 Bacteria 7468
484 Ga0453684_0000544 3300044712 Bacteria 142537
485 Ga0453684_0007026 3300044712 Bacteria 21033
486 Ga0453684_0011547 3300044712 Bacteria 14776
487 Ga0453684_0509238 3300044712 Bacteria 1332
488 Ga0451576_0005232 3300045051 Bacteria 16382
489 Ga0451576_0017777 3300045051 Bacteria 7812
490 Ga0451576_0023344 3300045051 Bacteria 6698
491 Ga0451576_0142096 3300045051 Unclassified 2503
492 Ga0451576_0172611 3300045051 Bacteria 2257
493 Ga0451576_0683368 3300045051 Bacteria 1078
494 Ga0495592_0036434 3300046454 Bacteria 3705
495 Ga0495651_0020855 3300046462 Bacteria 5086
496 Ga0495580_0002882 3300046472 Bacteria 14812
497 Ga0495580_0051857 3300046472 Bacteria 2899
498 Ga0495662_0016540 3300046476 Bacteria 3573
499 Ga0495664_0001912 3300046477 Bacteria 11082
500 Ga0495608_0041784 3300046511 Bacteria 3067
501 Ga0495608_0096485 3300046511 Bacteria 1910
502 Ga0495628_0010620 3300046516 Bacteria 7810
503 Ga0495630_0074521 3300046517 Bacteria 2556
504 Ga0495642_0009328 3300046528 Bacteria 3757
505 Ga0495652_0022721 3300046529 Bacteria 5566
506 Ga0495652_0296715 3300046529 Bacteria 1177
507 Ga0495640_0025801 3300046533 Bacteria 4256
508 Ga0495586_0022970 3300046535 Bacteria 3330
509 Ga0495587_0010311 3300046536 Bacteria 5953
510 Ga0495587_0059659 3300046536 Bacteria 2238
511 Ga0495609_0024699 3300046538 Bacteria 2755
512 Ga0495645_0001668 3300046543 Bacteria 15083
513 Ga0495667_0163044 3300046559 Bacteria 1433
514 Ga0495656_0082587 3300046615 Bacteria 1453
515 Ga0495635_0068638 3300046663 Bacteria 2431
516 Ga0495659_0004380 3300046664 Bacteria 4442
517 Ga0495599_0002154 3300046678 Bacteria 11451
518 Ga0495599_0083410 3300046678 Bacteria 1996
519 Ga0495623_0055507 3300046679 Bacteria 2497
520 Ga0495658_0092847 3300046683 Bacteria 1790
521 Ga0495669_0035882 3300046684 Bacteria 2190
522 Ga0495669_0142024 3300046684 Bacteria 1134
523 Ga0495613_0033920 3300046689 Bacteria 3791
524 Ga0495613_0311400 3300046689 Bacteria 1088
525 Ga0495600_0023184 3300046809 Bacteria 3992
526 Ga0495636_0002595 3300047318 Bacteria 6945
527 Ga0495674_0075737 3300047319 Bacteria 2895
528 Ga0495680_0029085 3300047322 Bacteria 4527
529 Ga0495680_0359191 3300047322 Bacteria 1013
530 Ga0495677_0014305 3300047445 Bacteria 2890
531 Ga0495684_0040430 3300047471 Bacteria 3575
532 Ga0495684_0119655 3300047471 Bacteria 1984
533 Ga0495602_0106715 3300048088 Bacteria 2285
534 Ga0496101_0043621 3300048904 Bacteria 3206
535 Ga0496102_0003316 3300048905 Bacteria 13648
536 Ga0496102_0018357 3300048905 Bacteria 6145
537 Ga0496102_0399287 3300048905 Bacteria 1293
538 Ga0496103_0002160 3300048906 Bacteria 12498
539 Ga0496104_0025372 3300048907 Bacteria 5463
540 Ga0496105_0023861 3300048908 Bacteria 4967
541 Ga0496109_0104875 3300048912 Bacteria 2625
542 Ga0496126_0010452 3300048929 Bacteria 9727
543 Ga0501036_0130253 3300049572 Bacteria 2124
544 Ga0501042_0023696 3300049578 Bacteria 4298
545 Ga0501075_0364095 3300049591 Bacteria 1102
546 Ga0501076_0143438 3300049592 Bacteria 1941
547 Ga0501083_0000461 3300049744 Bacteria 26109
548 Ga0501083_0075176 3300049744 Bacteria 2244
549 Ga0501045_0216512 3300049824 Bacteria 1426
550 nmdc:mga08y16_191597_c1 3300050511 Bacteria 2121
551 nmdc:mga08y16_52721_c1 3300050511 Bacteria 4256
552 nmdc:mga0n895_1391_c1 3300050512 Bacteria 18017
553 nmdc:mga0n895_80951_c1 3300050512 Bacteria 3236
554 nmdc:mga0rr50_380049_c1 3300050513 Bacteria 1191
555 nmdc:mga0rr50_388323_c1 3300050513 Bacteria 1178
556 nmdc:mga0rr50_40132_c1 3300050513 Bacteria 3401
557 nmdc:mga0a205_2117_c1 3300050515 Bacteria 17410
558 Ga0495619_0120864 3300053085 Bacteria 1796
559 Ga0068858_100107437
560 Ga0065715_10208762
561 Ga0070658_10235719
562 Ga0070658_10270149
563 Ga0070683_100024914
564 Ga0070683_100064893
565 Ga0070683_100293709
566 Ga0070683_100302062
567 Ga0070670_100149119
568 Ga0068869_100101303
569 Ga0068869_100115201
570 Ga0070666_10001068
571 Ga0070666_10124840
572 Ga0070680_100002717
573 Ga0070682_100009366
574 Ga0068868_100005954
575 Ga0068868_100042442
576 Ga0068868_100209769
577 Ga0068868_100441070
578 Ga0070660_100195956
579 Ga0070689_100049514
580 Ga0070691_10020544
581 Ga0070661_100042778
582 Ga0070661_100062753
583 Ga0070661_100339840
584 Ga0070671_100006727
585 Ga0070688_100022814
586 Ga0070659_100103041
587 Ga0070667_100053433
588 Ga0070667_100225309
589 Ga0070667_100421980
590 Ga0070709_10043844
591 Ga0070709_10110616
592 Ga0070714_100070429
593 Ga0070714_100236991
594 Ga0070714_100627839
595 Ga0070713_100064097
596 Ga0070713_100096354
597 Ga0070713_100272283
598 Ga0070711_100010546
599 Ga0070711_100382742
600 Ga0070708_100000611
601 Ga0070708_100007812
602 Ga0070708_100121581
603 Ga0070708_100237087
604 Ga0070708_100319252
605 Ga0070663_100185711
606 Ga0070678_100223718
607 Ga0070681_10029991
608 Ga0070681_10086173
609 Ga0070681_10086483
610 Ga0070681_10146190
611 Ga0070681_10237977
612 Ga0070681_10357139
613 Ga0068867_100007916
614 Ga0068867_100062427
615 Ga0070706_100111202
616 Ga0070706_100438109
617 Ga0070707_100002607
618 Ga0070707_100007551
619 Ga0070707_100087416
620 Ga0070698_100000203
621 Ga0070698_100023255
622 Ga0070698_100251758
623 Ga0070699_100034036
624 Ga0070679_100017046
625 Ga0070679_100241035
626 Ga0070679_100413138
627 Ga0070679_100650538
628 Ga0070684_100003654
629 Ga0070684_100028094
630 Ga0070684_100098765
631 Ga0070684_100169252
632 Ga0070684_100373062
633 Ga0070697_100019473
634 Ga0070697_100125027
635 Ga0070697_100316612
636 Ga0070672_100311112
637 Ga0070695_100055203
638 Ga0070696_100033352
639 Ga0070693_100067278
640 Ga0070665_100242763
641 Ga0070665_100427257
642 Ga0068855_100009965
643 Ga0068855_100063468
644 Ga0068855_100100942
645 Ga0068855_100108255
646 Ga0068855_100182165
647 Ga0068855_100270876
648 Ga0068855_100654229
649 Ga0068857_100000413
650 Ga0068857_100009450
651 Ga0068857_100096093
652 Ga0068857_100315259
653 Ga0068854_100087673
654 Ga0068856_100012748
655 Ga0068856_100024650
656 Ga0068856_100064360
657 Ga0068856_100175328
658 Ga0068856_100176710
659 Ga0068856_100192768
660 Ga0068856_100260611
661 Ga0068856_100262250
662 Ga0068856_100333553
663 Ga0068852_100033369
664 Ga0068859_100033565
665 Ga0068859_100166260
666 Ga0068859_100192290
667 Ga0068864_100017625
668 Ga0068864_100078976
669 Ga0068864_100093522
670 Ga0068866_10068492
671 Ga0068851_10171168
672 Ga0068863_100052090
673 Ga0068863_100087504
674 Ga0068858_100002519
675 Ga0068858_100045988
676 Ga0068858_100103113
677 Ga0068858_100524594
678 Ga0068860_100002618
679 Ga0068860_100100426
680 Ga0068860_100182464
681 Ga0070717_10012609
682 Ga0070717_10048039
683 Ga0070716_100000130
684 Ga0070716_100009477
685 Ga0070716_100035303
686 Ga0070716_100058924
687 Ga0070716_100069562
688 Ga0070712_100000892
689 Ga0070712_100001308
690 Ga0070712_100042183
691 Ga0070712_100450229
692 Ga0097621_100001702
693 Ga0097621_100013474
694 Ga0097621_100028935
695 Ga0097621_100100128
696 Ga0097621_100239534
697 Ga0097621_100300410
698 Ga0068871_100000567
699 Ga0068871_100015210
700 Ga0068871_100044462
701 Ga0068871_100095783
702 Ga0068871_100106961
703 Ga0068871_100134075
704 Ga0068871_100142207
705 Ga0068871_100529675
706 Ga0075428_100030516
707 Ga0075433_10012751
708 Ga0075434_100000323
709 Ga0075434_100004373
710 Ga0068865_100051243
711 Ga0068865_100056214
712 Ga0068865_100233279
713 Ga0075436_100262380
714 Ga0097620_100033564
715 Ga0097620_100166261
716 Ga0097620_100192300
717 Ga0075435_100050876
718 Ga0075435_100291241
719 Ga0075435_100300465
720 Ga0099794_10004676
721 Ga0099795_10017889
722 Ga0105240_10001187
723 Ga0105240_10049943
724 Ga0105240_10207384
725 Ga0105240_10260666
726 Ga0105240_10274985
727 Ga0111539_10046328
728 Ga0111539_10217922
729 Ga0105245_10009564
730 Ga0105245_10011221
731 Ga0105245_10016300
732 Ga0105245_10030294
733 Ga0105245_10118583
734 Ga0105245_10126786
735 Ga0105245_10181361
736 Ga0105247_10085162
737 Ga0105243_10044004
738 Ga0105243_10098776
739 Ga0105243_10231794
740 Ga0105243_10246178
741 Ga0105241_10015240
742 Ga0105241_10025188
743 Ga0105241_10025426
744 Ga0105241_10057564
745 Ga0105241_10081142
746 Ga0105241_10107162
747 Ga0105241_10141125
748 Ga0105241_10507068
749 Ga0105242_10006597
750 Ga0105242_10027849
751 Ga0105242_10045953
752 Ga0105242_10059787
753 Ga0105242_10066694
754 Ga0105242_10074102
755 Ga0105242_10097223
756 Ga0105242_10162800
757 Ga0105248_10003076
758 Ga0105248_10081233
759 Ga0105248_10087520
760 Ga0105248_10104186
761 Ga0105248_10105920
762 Ga0105248_10214380
763 Ga0105237_10000017
764 Ga0105237_10001552
765 Ga0105237_10108363
766 Ga0105237_10143312
767 Ga0105237_10312565
768 Ga0105237_10467815
769 Ga0105238_10004574
770 Ga0105238_10009281
771 Ga0105238_10014676
772 Ga0105238_10019083
773 Ga0105238_10038533
774 Ga0105238_10045069
775 Ga0105238_10062281
776 Ga0105238_10143228
777 Ga0105238_10222023
778 Ga0105238_10311791
779 Ga0105238_10423373
780 Ga0105249_10033230
781 Ga0105249_10118916
782 Ga0099796_10015941
783 Ga0105239_10016063
784 Ga0105239_10037749
785 Ga0105239_10119134
786 Ga0105239_10121929
787 Ga0105239_10265172
788 Ga0105239_10311867
789 Ga0105246_10013144
790 Ga0105246_10033065
791 Ga0105246_10092055
792 Ga0157371_10068121
793 Ga0157370_10003281
794 Ga0157370_10039592
795 Ga0157370_10365747
796 Ga0157369_10015552
797 Ga0157369_10017082
798 Ga0157369_10087606
799 Ga0157369_10250175
800 Ga0157369_10311020
801 Ga0157369_10448378
802 Ga0157374_10050288
803 Ga0157374_10215667
804 Ga0157374_10334342
805 Ga0157374_10368835
806 Ga0157378_10003467
807 Ga0157378_10007189
808 Ga0157378_10066228
809 Ga0157378_10084790
810 Ga0157378_10185252
811 Ga0163162_10008909
812 Ga0163162_10012597
813 Ga0163162_10085110
814 Ga0157372_10022006
815 Ga0157372_10074036
816 Ga0157372_10175247
817 Ga0157372_10191210
818 Ga0157372_10450179
819 Ga0157375_10012854
820 Ga0157375_10129426
821 Ga0157375_10184976
822 Ga0163163_10011176
823 Ga0163163_10042904
824 Ga0163163_10045245
825 Ga0163163_10133155
826 Ga0163163_10150783
827 Ga0163163_10179995
828 Ga0163163_10218314
829 Ga0163163_10635211
830 Ga0157377_10237462
831 Ga0157379_10007304
832 Ga0157376_10108580
833 Ga0157376_10235601
834 Ga0157376_10407619
835 Ga0157376_10485205
836 Ga0213872_10001079
837 Ga0213872_10051631
838 Ga0213876_10156399
839 Ga0213875_10032178
840 Ga0213875_10090753
841 Ga0224712_10023033
842 Ga0207656_10117270
843 Ga0207642_10142998
844 Ga0207680_10008341
845 Ga0207680_10073488
846 Ga0207699_10093955
847 Ga0207645_10016738
848 Ga0207705_10028833
849 Ga0207705_10136374
850 Ga0207684_10003562
851 Ga0207654_10017347
852 Ga0207654_10036892
853 Ga0207654_10041513
854 Ga0207654_10071839
855 Ga0207654_10179092
856 Ga0207654_10207112
857 Ga0207707_10001558
858 Ga0207707_10030800
859 Ga0207707_10045858
860 Ga0207707_10136055
861 Ga0207707_10300447
862 Ga0207695_10001191
863 Ga0207695_10002239
864 Ga0207695_10011055
865 Ga0207695_10025610
866 Ga0207695_10070542
867 Ga0207695_10075889
868 Ga0207695_10184230
869 Ga0207671_10008124
870 Ga0207671_10022281
871 Ga0207671_10023399
872 Ga0207671_10028584
873 Ga0207671_10102722
874 Ga0207693_10000649
875 Ga0207693_10001686
876 Ga0207693_10050199
877 Ga0207693_10142245
878 Ga0207663_10000855
879 Ga0207663_10111620
880 Ga0207660_10015377
881 Ga0207660_10043698
882 Ga0207657_10001429
883 Ga0207657_10004076
884 Ga0207649_10140359
885 Ga0207649_10152581
886 Ga0207649_10170842
887 Ga0207649_10216135
888 Ga0207652_10051898
889 Ga0207646_10001451
890 Ga0207646_10003662
891 Ga0207646_10144540
892 Ga0207694_10001026
893 Ga0207694_10005812
894 Ga0207694_10015190
895 Ga0207694_10035068
896 Ga0207694_10039365
897 Ga0207694_10076242
898 Ga0207694_10166264
899 Ga0207687_10000640
900 Ga0207687_10003715
901 Ga0207687_10004024
902 Ga0207687_10064107
903 Ga0207687_10140150
904 Ga0207700_10063452
905 Ga0207700_10067524
906 Ga0207664_10493698
907 Ga0207644_10024996
908 Ga0207706_10001454
909 Ga0207686_10004228
910 Ga0207686_10047493
911 Ga0207686_10099437
912 Ga0207709_10123836
913 Ga0207709_10144162
914 Ga0207709_10279696
915 Ga0207669_10123326
916 Ga0207704_10002771
917 Ga0207665_10002575
918 Ga0207665_10017092
919 Ga0207665_10026421
920 Ga0207711_10000954
921 Ga0207711_10057172
922 Ga0207711_10059770
923 Ga0207711_10136212
924 Ga0207689_10052131
925 Ga0207661_10263380
926 Ga0207661_10333120
927 Ga0207679_10316799
928 Ga0207667_10007381
929 Ga0207667_10018079
930 Ga0207667_10019050
931 Ga0207667_10052607
932 Ga0207667_10078204
933 Ga0207667_10165645
934 Ga0207712_10016489
935 Ga0207712_10024609
936 Ga0207668_10030200
937 Ga0207658_10241505
938 Ga0207677_10418665
939 Ga0207703_10003769
940 Ga0207703_10087026
941 Ga0207703_10577591
942 Ga0207639_10090164
943 Ga0207678_10004519
944 Ga0207702_10000215
945 Ga0207702_10001936
946 Ga0207702_10033713
947 Ga0207702_10076687
948 Ga0207702_10097259
949 Ga0207641_10085906
950 Ga0207641_10219247
951 Ga0207648_10008119
952 Ga0207648_10013228
953 Ga0207648_10118913
954 Ga0207676_10030237
955 Ga0207676_10086964
956 Ga0207674_10000628
957 Ga0207674_10010833
958 Ga0207674_10016835
959 Ga0207674_10038820
960 Ga0207674_10042728
961 Ga0207674_10115542
962 Ga0207674_10354766
963 Ga0207683_10525692
964 Ga0207698_10017522
965 Ga0207698_10211667
966 Ga0209588_1013728
967 Ga0207428_10040311
968 Ga0268266_10051414
969 Ga0268266_10206397
970 Ga0268266_10303778
971 Ga0268264_10061996
972 Ga0268264_10123916
973 Ga0265318_10020232
974 Ga0265338_10055350
975 Ga0265324_10040276
976 Ga0265332_10000116
977 Ga0265332_10018439
978 Ga0265328_10003977
979 Ga0265325_10061313
980 Ga0265340_10010950
981 Ga0265340_10096411
982 Ga0265331_10000048
983 Ga0265331_10107920
984 Ga0265331_10117892
985 Ga0265316_10000101
986 Ga0265316_10007489
987 Ga0265316_10042888
988 Ga0265313_10077953
989 Ga0316575_10015637
990 Ga0265314_10000129
991 Ga0265314_10003772
992 Ga0265314_10034647
993 Ga0265342_10002020
994 Ga0265342_10048554
995 Ga0265342_10152382
996 Ga0316576_10027549
997 Ga0316576_10031257
998 Ga0316576_10034261
999 Ga0316576_10060372
1000 Ga0316576_10237984
1001 Ga0316578_10033365
1002 Ga0316578_10058904
1003 Ga0316583_10010410
1004 Ga0316585_10019661
1005 Ga0316593_10020995
1006 Ga0373930_0007620
1007 Ga0373934_0002272
1008 Ga0373940_0009573
1009 Ga0373954_0054949
1010 Ga0373955_0001642
1011 Ga0373931_0016373
1012 Ga0373931_0019230
1013 Ga0373927_0000333
1014 Ga0373927_0041408
1015 Ga0373933_0176557
1016 Ga0373947_0000910
1017 Ga0373937_0004799
1018 Ga0373937_0070926
1019 Ga0373937_0171732
1020 Ga0373937_0178610
1021 Ga0316582_0201331
1022 Ga0316584_0026554
1023 Ga0373925_0003551
1024 Ga0373925_0011554
1025 Ga0316581_0147913
1026 Ga0436364_0130141
1027 Ga0436364_1255431
1028 Ga0436364_1377625
1029 Ga0400484_04818
1030 Ga0400491_06493
1031 Ga0400488_11814
1032 Ga0400486_25894
1033 Ga0436365_0903109
1034 Ga0436360_0413852
1035 Ga0436360_0435719
1036 Ga0436361_0306192
1037 Ga0436361_0878656
1038 Ga0439448_0102640
1039 Ga0451577_0002637
1040 Ga0451577_0070596
1041 Ga0453683_0007373
1042 Ga0453684_0000544
1043 Ga0453684_0007026
1044 Ga0453684_0011547
1045 Ga0453684_0509238
1046 Ga0451576_0005232
1047 Ga0451576_0017777
1048 Ga0451576_0023344
1049 Ga0451576_0142096
1050 Ga0451576_0172611
1051 Ga0451576_0683368
1052 Ga0495592_0036434
1053 Ga0495651_0020855
1054 Ga0495580_0002882
1055 Ga0495580_0051857
1056 Ga0495662_0016540
1057 Ga0495664_0001912
1058 Ga0495608_0041784
1059 Ga0495608_0096485
1060 Ga0495628_0010620
1061 Ga0495630_0074521
1062 Ga0495642_0009328
1063 Ga0495652_0022721
1064 Ga0495652_0296715
1065 Ga0495640_0025801
1066 Ga0495586_0022970
1067 Ga0495587_0010311
1068 Ga0495587_0059659
1069 Ga0495609_0024699
1070 Ga0495645_0001668
1071 Ga0495667_0163044
1072 Ga0495656_0082587
1073 Ga0495635_0068638
1074 Ga0495659_0004380
1075 Ga0495599_0002154
1076 Ga0495599_0083410
1077 Ga0495623_0055507
1078 Ga0495658_0092847
1079 Ga0495669_0035882
1080 Ga0495669_0142024
1081 Ga0495613_0033920
1082 Ga0495613_0311400
1083 Ga0495600_0023184
1084 Ga0495636_0002595
1085 Ga0495674_0075737
1086 Ga0495680_0029085
1087 Ga0495680_0359191
1088 Ga0495677_0014305
1089 Ga0495684_0040430
1090 Ga0495684_0119655
1091 Ga0495602_0106715
1092 Ga0496101_0043621
1093 Ga0496102_0003316
1094 Ga0496102_0018357
1095 Ga0496102_0399287
1096 Ga0496103_0002160
1097 Ga0496104_0025372
1098 Ga0496105_0023861
1099 Ga0496109_0104875
1100 Ga0496126_0010452
1101 Ga0501036_0130253
1102 Ga0501042_0023696
1103 Ga0501075_0364095
1104 Ga0501076_0143438
1105 Ga0501083_0000461
1106 Ga0501083_0075176
1107 Ga0501045_0216512
1108 nmdc:mga08y16_191597_c1
1109 nmdc:mga08y16_52721_c1
1110 nmdc:mga0n895_1391_c1
1111 nmdc:mga0n895_80951_c1
1112 nmdc:mga0rr50_380049_c1
1113 nmdc:mga0rr50_388323_c1
1114 nmdc:mga0rr50_40132_c1
1115 nmdc:mga0a205_2117_c1
1116 Ga0495619_0120864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02678

Pirin

Pirin

41

143

0.95

PF05726

Pirin_C

Pirin C-terminal cupin domain

198

319

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hlt-assembly1.cif.gz_A crystal structure of ferric e32v pirin 0.8694 3 285
5jct-assembly1.cif.gz_A crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 0.8672 4 285
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.8478 8 283
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.828 163 253
4hlt-assembly1.cif.gz_A crystal structure of ferric e32v pirin 0.826 3 285
ID Description Score Start End Superfamily
af_Q54UY3_11_140_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9349 10 136 2.60.120.10
af_I1KYF4_44_139_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9275 35 135 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9178 37 124 2.60.120.10
af_Q557H8_87_213_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9117 17 136 2.60.120.10
af_I1KYF4_44_139_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9092 35 135 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A521A0J8-F1-model_v4 Pirin family protein 0.9769 4 136
AF-A0A353GVQ6-F1-model_v4 Pirin family protein 0.9657 3 136
AF-A0A2X3DCT5-F1-model_v4 Pirin (EC 1.13.11.24) 0.9537 4 120 GO:0008127
AF-A0A7J3TBE7-F1-model_v4 Pirin family protein 0.9506 17 136
AF-A0A2V9MJW3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9447 1 183 GO:0046872

Map