F463398

General Info

Members Datasets Scaffolds Average Seq Length
558 272 1116 117

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100006120|Ga0070690_1000061204
Length 122
Sequence MKTKTISRPRRKRTVTATTKRGAPHSNGAKHWSLRLYLAGQTPRSLTAFANLKRLCDEYLAGRYDIEIIDLAKHPHLAQNDQIVALPTLVRKLPEPIKRLIGDLSNRERVMIALDLQTTEKN

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 2.87
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 29.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100006120 3300005330 Bacteria 6811
2 SwRhRL2b_contig_1837978 2162886007 Bacteria 5029
3 JGI24751J29686_10000136 3300002459 Bacteria 36776
4 rootH1_10241251 3300003323 Unclassified 3987
5 Ga0065704_10072770 3300005289 Bacteria 8034
6 Ga0065712_10002422 3300005290 Bacteria 7909
7 Ga0065712_10632698 3300005290 Unclassified 575
8 Ga0065715_10002359 3300005293 Bacteria 5601
9 Ga0065715_10240915 3300005293 Bacteria 1173
10 Ga0065707_10105310 3300005295 Bacteria 2651
11 Ga0070676_10253071 3300005328 Bacteria 1176
12 Ga0070676_10367133 3300005328 Bacteria 993
13 Ga0070690_100563434 3300005330 Unclassified 860
14 Ga0070670_100000098 3300005331 Bacteria 80608
15 Ga0070670_100029104 3300005331 Bacteria 4753
16 Ga0070670_100049583 3300005331 Bacteria 3610
17 Ga0070670_100063533 3300005331 Unclassified 3169
18 Ga0070670_100098922 3300005331 Bacteria 2510
19 Ga0070670_100136651 3300005331 Bacteria 2118
20 Ga0068869_100047783 3300005334 Bacteria 3092
21 Ga0068869_100481626 3300005334 Bacteria 1033
22 Ga0068869_100763280 3300005334 Unclassified 829
23 Ga0068869_101242805 3300005334 Bacteria 656
24 Ga0070680_100471061 3300005336 Unclassified 1073
25 Ga0070680_101145515 3300005336 Bacteria 672
26 Ga0070680_101269414 3300005336 Unclassified 637
27 Ga0070682_100072626 3300005337 Unclassified 2205
28 Ga0070682_100101014 3300005337 Bacteria 1904
29 Ga0070682_100314741 3300005337 Bacteria 1154
30 Ga0068868_100491272 3300005338 Unclassified 1074
31 Ga0068868_101421678 3300005338 Bacteria 647
32 Ga0068868_101964791 3300005338 Unclassified 555
33 Ga0070689_101377469 3300005340 Unclassified 637
34 Ga0070687_100438015 3300005343 Bacteria 866
35 Ga0070687_100815304 3300005343 Unclassified 662
36 Ga0070687_101501496 3300005343 Unclassified 507
37 Ga0070661_101130181 3300005344 Unclassified 653
38 Ga0070692_10004063 3300005345 Bacteria 6048
39 Ga0070692_10038139 3300005345 Bacteria 2447
40 Ga0070692_10346767 3300005345 Unclassified 921
41 Ga0070668_100524174 3300005347 Unclassified 1028
42 Ga0070669_100239068 3300005353 Bacteria 1442
43 Ga0070675_100224159 3300005354 Bacteria 1638
44 Ga0070675_100286112 3300005354 Bacteria 1450
45 Ga0070675_100473769 3300005354 Bacteria 1125
46 Ga0070675_100939071 3300005354 Unclassified 793
47 Ga0070671_100500145 3300005355 Bacteria 1046
48 Ga0070671_100556511 3300005355 Bacteria 989
49 Ga0070674_101247144 3300005356 Unclassified 661
50 Ga0070673_100052021 3300005364 Bacteria 3212
51 Ga0070673_100197608 3300005364 Bacteria 1731
52 Ga0070673_100537941 3300005364 Bacteria 1060
53 Ga0070673_101725458 3300005364 Unclassified 593
54 Ga0070673_102292340 3300005364 Unclassified 513
55 Ga0070688_100358375 3300005365 Bacteria 1070
56 Ga0070688_100465094 3300005365 Unclassified 948
57 Ga0070659_100300141 3300005366 Bacteria 1339
58 Ga0070667_100149772 3300005367 Bacteria 2049
59 Ga0070667_100350267 3300005367 Bacteria 1337
60 Ga0070709_10082699 3300005434 Bacteria 2098
61 Ga0070709_10164737 3300005434 Bacteria 1544
62 Ga0070709_10432681 3300005434 Unclassified 988
63 Ga0070714_100113794 3300005435 Unclassified 2399
64 Ga0070714_100144263 3300005435 Bacteria 2140
65 Ga0070714_100470232 3300005435 Bacteria 1196
66 Ga0070714_102269000 3300005435 Unclassified 528
67 Ga0070713_100005159 3300005436 Bacteria 8897
68 Ga0070713_100035657 3300005436 Bacteria 4007
69 Ga0070713_100159307 3300005436 Bacteria 2014
70 Ga0070713_100286496 3300005436 Unclassified 1513
71 Ga0070713_100660636 3300005436 Unclassified 996
72 Ga0070710_10002926 3300005437 Bacteria 8110
73 Ga0070710_10015813 3300005437 Unclassified 3826
74 Ga0070710_10190568 3300005437 Unclassified 1289
75 Ga0070710_10215065 3300005437 Bacteria 1220
76 Ga0070701_10257885 3300005438 Unclassified 1055
77 Ga0070701_10553526 3300005438 Bacteria 755
78 Ga0070701_11016109 3300005438 Unclassified 579
79 Ga0070711_100070588 3300005439 Bacteria 2460
80 Ga0070711_100244223 3300005439 Bacteria 1405
81 Ga0070711_100399540 3300005439 Bacteria 1115
82 Ga0070711_100916937 3300005439 Unclassified 748
83 Ga0070705_100387788 3300005440 Unclassified 1030
84 Ga0070705_100581931 3300005440 Bacteria 863
85 Ga0070705_101040335 3300005440 Bacteria 667
86 Ga0070700_100017654 3300005441 Bacteria 4086
87 Ga0070700_100095908 3300005441 Bacteria 1945
88 Ga0070700_100783194 3300005441 Bacteria 766
89 Ga0070694_100003386 3300005444 Bacteria 9552
90 Ga0070694_100081573 3300005444 Bacteria 2250
91 Ga0070694_100375765 3300005444 Bacteria 1107
92 Ga0070663_100049775 3300005455 Bacteria 2978
93 Ga0070663_100946095 3300005455 Unclassified 746
94 Ga0068867_100450057 3300005459 Bacteria 1097
95 Ga0070685_10399886 3300005466 Bacteria 951
96 Ga0070707_100035223 3300005468 Bacteria 4775
97 Ga0070698_100008974 3300005471 Bacteria 10758
98 Ga0070698_101377443 3300005471 Unclassified 656
99 Ga0070699_100007018 3300005518 Bacteria 9788
100 Ga0070697_100016179 3300005536 Bacteria 5865
101 Ga0068853_100150809 3300005539 Bacteria 2093
102 Ga0068853_100157534 3300005539 Bacteria 2047
103 Ga0070672_100003867 3300005543 Bacteria 9749
104 Ga0070672_100010339 3300005543 Bacteria 6471
105 Ga0070686_100025519 3300005544 Bacteria 3557
106 Ga0070695_100171157 3300005545 Bacteria 1532
107 Ga0070695_101339527 3300005545 Bacteria 592
108 Ga0070695_101405894 3300005545 Unclassified 579
109 Ga0070695_101632480 3300005545 Unclassified 539
110 Ga0070693_100052185 3300005547 Bacteria 2344
111 Ga0070693_100829735 3300005547 Unclassified 687
112 Ga0070665_100104468 3300005548 Bacteria 2835
113 Ga0070665_100271356 3300005548 Unclassified 1698
114 Ga0070665_100286506 3300005548 Bacteria 1649
115 Ga0070665_101136691 3300005548 Bacteria 792
116 Ga0070665_101602012 3300005548 Unclassified 659
117 Ga0070704_100007136 3300005549 Bacteria 6635
118 Ga0070704_100652979 3300005549 Unclassified 929
119 Ga0068855_100168315 3300005563 Bacteria 2483
120 Ga0070664_100068645 3300005564 Bacteria 3031
121 Ga0068857_100100957 3300005577 Bacteria 2589
122 Ga0068857_100277777 3300005577 Bacteria 1540
123 Ga0068857_100447929 3300005577 Bacteria 1207
124 Ga0068857_101153100 3300005577 Bacteria 749
125 Ga0068854_100944506 3300005578 Unclassified 760
126 Ga0068856_101411687 3300005614 Unclassified 711
127 Ga0068856_101461120 3300005614 Unclassified 698
128 Ga0070702_100363217 3300005615 Unclassified 1024
129 Ga0070702_100850585 3300005615 Unclassified 710
130 Ga0070702_101084207 3300005615 Unclassified 639
131 Ga0068852_100237267 3300005616 Bacteria 1741
132 Ga0068852_100653506 3300005616 Bacteria 1059
133 Ga0068859_100077749 3300005617 Bacteria 3359
134 Ga0068859_100130917 3300005617 Bacteria 2580
135 Ga0068859_100181433 3300005617 Bacteria 2188
136 Ga0068859_100468393 3300005617 Unclassified 1356
137 Ga0068859_100896958 3300005617 Unclassified 971
138 Ga0068859_101688088 3300005617 Bacteria 700
139 Ga0068859_103002711 3300005617 Bacteria 515
140 Ga0068864_100022014 3300005618 Bacteria 5342
141 Ga0068864_100245338 3300005618 Bacteria 1661
142 Ga0068864_100287185 3300005618 Unclassified 1537
143 Ga0068864_100416997 3300005618 Bacteria 1279
144 Ga0068864_100665230 3300005618 Unclassified 1015
145 Ga0068864_102387845 3300005618 Bacteria 535
146 Ga0068861_100346556 3300005719 Unclassified 1301
147 Ga0068870_10829021 3300005840 Unclassified 648
148 Ga0068870_11097128 3300005840 Bacteria 572
149 Ga0068863_100076624 3300005841 Bacteria 3163
150 Ga0068863_100185130 3300005841 Bacteria 2000
151 Ga0068863_101591662 3300005841 Unclassified 662
152 Ga0068858_100074624 3300005842 Unclassified 3149
153 Ga0068858_100308295 3300005842 Bacteria 1511
154 Ga0068858_100419644 3300005842 Bacteria 1287
155 Ga0068858_100680383 3300005842 Unclassified 1000
156 Ga0068858_100761697 3300005842 Unclassified 943
157 Ga0068858_101312558 3300005842 Unclassified 712
158 Ga0068860_100028493 3300005843 Bacteria 5375
159 Ga0068860_100237573 3300005843 Bacteria 1772
160 Ga0068860_100588237 3300005843 Bacteria 1118
161 Ga0068860_102374241 3300005843 Unclassified 550
162 Ga0068862_100157513 3300005844 Bacteria 2025
163 Ga0068862_101177025 3300005844 Bacteria 764
164 Ga0070717_10042001 3300006028 Bacteria 3730
165 Ga0070717_10046587 3300006028 Bacteria 3548
166 Ga0070717_10647436 3300006028 Unclassified 959
167 Ga0070717_11395285 3300006028 Unclassified 636
168 Ga0070717_11475506 3300006028 Unclassified 617
169 Ga0070717_11954228 3300006028 Unclassified 529
170 Ga0070715_10040159 3300006163 Unclassified 1954
171 Ga0070715_10145322 3300006163 Unclassified 1156
172 Ga0070716_100096185 3300006173 Bacteria 1804
173 Ga0070716_100633701 3300006173 Unclassified 808
174 Ga0070716_100778469 3300006173 Unclassified 739
175 Ga0070712_100000462 3300006175 Bacteria 23332
176 Ga0070712_100003628 3300006175 Bacteria 9520
177 Ga0070712_100078531 3300006175 Bacteria 2383
178 Ga0070712_100241103 3300006175 Bacteria 1440
179 Ga0075362_10143047 3300006177 Bacteria 1144
180 Ga0075367_10610924 3300006178 Bacteria 693
181 Ga0075366_10080895 3300006195 Bacteria 1940
182 Ga0097621_100079232 3300006237 Bacteria 2730
183 Ga0097621_100603321 3300006237 Unclassified 1004
184 Ga0097621_101659711 3300006237 Unclassified 608
185 Ga0068871_100030454 3300006358 Bacteria 4249
186 Ga0075428_100020012 3300006844 Bacteria 7412
187 Ga0075433_10032427 3300006852 Bacteria 4474
188 Ga0075433_10056849 3300006852 Bacteria 3419
189 Ga0075434_100003952 3300006871 Bacteria 13275
190 Ga0075434_100121591 3300006871 Bacteria 2626
191 Ga0075434_100757233 3300006871 Bacteria 988
192 Ga0075429_100020614 3300006880 Bacteria 5721
193 Ga0068865_100315835 3300006881 Bacteria 1255
194 Ga0068865_101101324 3300006881 Unclassified 699
195 Ga0068865_101672218 3300006881 Unclassified 573
196 Ga0075436_101420791 3300006914 Unclassified 526
197 Ga0097620_100077748 3300006931 Bacteria 3359
198 Ga0097620_100130909 3300006931 Bacteria 2580
199 Ga0097620_100181440 3300006931 Bacteria 2188
200 Ga0097620_100247120 3300006931 Bacteria 1874
201 Ga0097620_100468405 3300006931 Unclassified 1356
202 Ga0097620_100897001 3300006931 Unclassified 971
203 Ga0097620_101687981 3300006931 Bacteria 700
204 Ga0097620_103002683 3300006931 Bacteria 515
205 Ga0075435_100213391 3300007076 Bacteria 1638
206 Ga0075435_100908312 3300007076 Unclassified 768
207 Ga0075435_102025882 3300007076 Bacteria 505
208 Ga0105250_10385516 3300009092 Unclassified 619
209 Ga0105240_10008188 3300009093 Bacteria 14983
210 Ga0105240_10084314 3300009093 Bacteria 3896
211 Ga0105240_10926895 3300009093 Bacteria 936
212 Ga0111539_10014009 3300009094 Bacteria 10020
213 Ga0111539_10062947 3300009094 Bacteria 4390
214 Ga0111539_10690203 3300009094 Bacteria 1188
215 Ga0111539_10983232 3300009094 Unclassified 981
216 Ga0105245_10044761 3300009098 Bacteria 3951
217 Ga0105245_10298315 3300009098 Unclassified 1580
218 Ga0105247_10000841 3300009101 Bacteria 23337
219 Ga0105247_10008706 3300009101 Bacteria 6186
220 Ga0114129_10093049 3300009147 Bacteria 4176
221 Ga0105243_10296068 3300009148 Bacteria 1464
222 Ga0105241_10042055 3300009174 Bacteria 3455
223 Ga0105241_10116404 3300009174 Bacteria 2147
224 Ga0105241_10168802 3300009174 Bacteria 1806
225 Ga0105241_10869083 3300009174 Bacteria 835
226 Ga0105241_11119779 3300009174 Bacteria 742
227 Ga0105248_10969836 3300009177 Bacteria 960
228 Ga0105237_10209510 3300009545 Bacteria 1949
229 Ga0105237_10230602 3300009545 Unclassified 1852
230 Ga0105238_10006163 3300009551 Bacteria 11903
231 Ga0105238_10060690 3300009551 Unclassified 3785
232 Ga0105238_10496771 3300009551 Unclassified 1220
233 Ga0105249_10100186 3300009553 Unclassified 2724
234 Ga0105249_10298039 3300009553 Bacteria 1616
235 Ga0105249_10306027 3300009553 Bacteria 1596
236 Ga0099796_10225952 3300010159 Unclassified 769
237 Ga0105239_10007611 3300010375 Bacteria 12412
238 Ga0105239_10533009 3300010375 Bacteria 1336
239 Ga0105239_13183344 3300010375 Unclassified 534
240 Ga0105246_10326188 3300011119 Bacteria 1250
241 Ga0157373_11486129 3300013100 Unclassified 517
242 Ga0157371_10163198 3300013102 Bacteria 1591
243 Ga0157369_10050997 3300013105 Bacteria 4479
244 Ga0157369_10111307 3300013105 Bacteria 2910
245 Ga0157369_10364647 3300013105 Bacteria 1500
246 Ga0157374_10011084 3300013296 Bacteria 7788
247 Ga0157374_10198481 3300013296 Bacteria 1964
248 Ga0157374_10411452 3300013296 Bacteria 1350
249 Ga0157378_10252183 3300013297 Bacteria 1690
250 Ga0157378_10843570 3300013297 Unclassified 944
251 Ga0163162_10048169 3300013306 Bacteria 4270
252 Ga0163162_10074135 3300013306 Bacteria 3461
253 Ga0163162_10124619 3300013306 Bacteria 2682
254 Ga0163162_10239839 3300013306 Bacteria 1944
255 Ga0163162_10572051 3300013306 Unclassified 1257
256 Ga0163162_10596786 3300013306 Bacteria 1231
257 Ga0163162_11274403 3300013306 Bacteria 835
258 Ga0163162_12682750 3300013306 Unclassified 573
259 Ga0157372_10011101 3300013307 Bacteria 9580
260 Ga0157372_11234255 3300013307 Bacteria 863
261 Ga0157372_12602959 3300013307 Unclassified 581
262 Ga0157375_10248160 3300013308 Bacteria 1940
263 Ga0157375_10268821 3300013308 Bacteria 1867
264 Ga0157375_12794243 3300013308 Unclassified 584
265 Ga0163163_10000465 3300014325 Bacteria 36944
266 Ga0163163_10341099 3300014325 Unclassified 1554
267 Ga0163163_10477690 3300014325 Unclassified 1307
268 Ga0163163_10604788 3300014325 Bacteria 1159
269 Ga0157380_10888140 3300014326 Bacteria 916
270 Ga0157377_10219557 3300014745 Bacteria 1216
271 Ga0157377_11652705 3300014745 Unclassified 515
272 Ga0157379_10022874 3300014968 Bacteria 5540
273 Ga0157379_10347012 3300014968 Bacteria 1358
274 Ga0157379_10606008 3300014968 Unclassified 1023
275 Ga0157376_11566005 3300014969 Unclassified 693
276 Ga0163161_10463576 3300017792 Bacteria 1026
277 Ga0163161_10992729 3300017792 Unclassified 716
278 Ga0224571_100230 3300022734 Bacteria 2737
279 Ga0224572_1000658 3300024225 Bacteria 4345
280 Ga0228598_1000187 3300024227 Bacteria 11221
281 Ga0228598_1004846 3300024227 Bacteria 2837
282 Ga0207713_1100356 3300025735 Unclassified 1000
283 Ga0207692_10002149 3300025898 Bacteria 7531
284 Ga0207692_10171973 3300025898 Bacteria 1256
285 Ga0207692_10303460 3300025898 Unclassified 972
286 Ga0207692_10354752 3300025898 Unclassified 905
287 Ga0207710_10000563 3300025900 Bacteria 22203
288 Ga0207710_10012384 3300025900 Bacteria 3589
289 Ga0207710_10541051 3300025900 Unclassified 606
290 Ga0207688_10599925 3300025901 Unclassified 694
291 Ga0207647_10116972 3300025904 Unclassified 1574
292 Ga0207685_10028980 3300025905 Unclassified 1955
293 Ga0207685_10295977 3300025905 Unclassified 799
294 Ga0207699_10014387 3300025906 Bacteria 4077
295 Ga0207699_10112666 3300025906 Bacteria 1746
296 Ga0207699_10580421 3300025906 Bacteria 815
297 Ga0207645_10685221 3300025907 Unclassified 696
298 Ga0207643_10782254 3300025908 Bacteria 618
299 Ga0207643_11024528 3300025908 Unclassified 534
300 Ga0207695_10015919 3300025913 Bacteria 8831
301 Ga0207695_10333760 3300025913 Bacteria 1404
302 Ga0207695_10610481 3300025913 Bacteria 972
303 Ga0207671_10196023 3300025914 Bacteria 1576
304 Ga0207693_10000966 3300025915 Bacteria 25811
305 Ga0207693_10024836 3300025915 Bacteria 4753
306 Ga0207693_10064578 3300025915 Bacteria 2867
307 Ga0207693_10198522 3300025915 Bacteria 1578
308 Ga0207693_10822937 3300025915 Bacteria 715
309 Ga0207663_10065308 3300025916 Bacteria 2326
310 Ga0207663_10291568 3300025916 Bacteria 1216
311 Ga0207663_10350203 3300025916 Bacteria 1118
312 Ga0207662_10023799 3300025918 Bacteria 3521
313 Ga0207662_10509246 3300025918 Unclassified 830
314 Ga0207646_10034183 3300025922 Bacteria 4595
315 Ga0207694_10063671 3300025924 Bacteria 2873
316 Ga0207694_10597463 3300025924 Unclassified 928
317 Ga0207650_10000156 3300025925 Bacteria 81983
318 Ga0207650_10030182 3300025925 Bacteria 3903
319 Ga0207650_10207176 3300025925 Bacteria 1573
320 Ga0207659_10055587 3300025926 Bacteria 2832
321 Ga0207659_10180299 3300025926 Bacteria 1673
322 Ga0207659_10201798 3300025926 Bacteria 1589
323 Ga0207659_11733549 3300025926 Bacteria 531
324 Ga0207687_10181215 3300025927 Bacteria 1632
325 Ga0207687_10829189 3300025927 Unclassified 790
326 Ga0207700_10002454 3300025928 Bacteria 10641
327 Ga0207700_10054589 3300025928 Bacteria 3000
328 Ga0207700_10206865 3300025928 Archaea 1657
329 Ga0207700_10488747 3300025928 Bacteria 1088
330 Ga0207700_10673602 3300025928 Unclassified 923
331 Ga0207664_10091990 3300025929 Unclassified 2488
332 Ga0207664_10536060 3300025929 Bacteria 1050
333 Ga0207664_10796718 3300025929 Bacteria 850
334 Ga0207690_10795003 3300025932 Bacteria 782
335 Ga0207706_10221261 3300025933 Bacteria 1657
336 Ga0207706_10746658 3300025933 Bacteria 834
337 Ga0207670_10595002 3300025936 Bacteria 908
338 Ga0207670_10665747 3300025936 Unclassified 859
339 Ga0207704_10626362 3300025938 Unclassified 883
340 Ga0207665_10014667 3300025939 Bacteria 5158
341 Ga0207665_10070776 3300025939 Unclassified 2380
342 Ga0207665_10073650 3300025939 Bacteria 2336
343 Ga0207665_10617763 3300025939 Unclassified 847
344 Ga0207691_10010906 3300025940 Bacteria 8722
345 Ga0207691_10373777 3300025940 Bacteria 1217
346 Ga0207689_10038886 3300025942 Bacteria 3939
347 Ga0207689_10095032 3300025942 Bacteria 2448
348 Ga0207689_10133479 3300025942 Bacteria 2044
349 Ga0207689_10195134 3300025942 Bacteria 1671
350 Ga0207679_10050311 3300025945 Bacteria 3044
351 Ga0207667_10011505 3300025949 Bacteria 10279
352 Ga0207667_10157036 3300025949 Bacteria 2340
353 Ga0207651_10054473 3300025960 Bacteria 2741
354 Ga0207651_10209000 3300025960 Bacteria 1570
355 Ga0207651_11873061 3300025960 Unclassified 539
356 Ga0207712_10969893 3300025961 Unclassified 753
357 Ga0207640_10536366 3300025981 Bacteria 981
358 Ga0207640_11059204 3300025981 Bacteria 716
359 Ga0207677_10185887 3300026023 Unclassified 1639
360 Ga0207677_10701101 3300026023 Bacteria 898
361 Ga0207703_10067667 3300026035 Bacteria 2940
362 Ga0207703_10150554 3300026035 Bacteria 2028
363 Ga0207703_10214430 3300026035 Bacteria 1718
364 Ga0207703_10898940 3300026035 Bacteria 848
365 Ga0207703_11064904 3300026035 Unclassified 776
366 Ga0207639_10243636 3300026041 Unclassified 1564
367 Ga0207639_10488162 3300026041 Bacteria 1124
368 Ga0207639_11994903 3300026041 Unclassified 541
369 Ga0207678_10073868 3300026067 Bacteria 2922
370 Ga0207708_10036198 3300026075 Bacteria 3757
371 Ga0207708_10084597 3300026075 Bacteria 2439
372 Ga0207708_11263706 3300026075 Unclassified 646
373 Ga0207702_11107855 3300026078 Bacteria 786
374 Ga0207641_10064505 3300026088 Bacteria 3131
375 Ga0207641_10105794 3300026088 Bacteria 2486
376 Ga0207641_11548883 3300026088 Unclassified 665
377 Ga0207648_10424333 3300026089 Bacteria 1208
378 Ga0207676_10018185 3300026095 Bacteria 5104
379 Ga0207676_10354082 3300026095 Bacteria 1359
380 Ga0207676_10459554 3300026095 Unclassified 1202
381 Ga0207676_10628451 3300026095 Unclassified 1034
382 Ga0207674_10176358 3300026116 Bacteria 2089
383 Ga0207674_10282491 3300026116 Bacteria 1608
384 Ga0207674_10700973 3300026116 Bacteria 977
385 Ga0207674_10729667 3300026116 Unclassified 956
386 Ga0207675_100110454 3300026118 Bacteria 2594
387 Ga0207675_100171041 3300026118 Bacteria 2077
388 Ga0207698_10042597 3300026142 Bacteria 3394
389 Ga0207428_10067686 3300027907 Bacteria 2811
390 Ga0207428_10244218 3300027907 Bacteria 1341
391 Ga0268266_10075828 3300028379 Bacteria 2921
392 Ga0268266_10197048 3300028379 Bacteria 1842
393 Ga0268266_10215035 3300028379 Unclassified 1764
394 Ga0268266_11430079 3300028379 Unclassified 667
395 Ga0268265_10269868 3300028380 Bacteria 1517
396 Ga0268265_10540396 3300028380 Bacteria 1105
397 Ga0268265_12453230 3300028380 Bacteria 528
398 Ga0268264_10077263 3300028381 Unclassified 2835
399 Ga0268264_10087093 3300028381 Bacteria 2685
400 Ga0268264_10102103 3300028381 Bacteria 2495
401 Ga0265337_1007010 3300028556 Bacteria 4263
402 Ga0307515_10333601 3300028794 Archaea 1173
403 Ga0265338_10082174 3300028800 Unclassified 2698
404 Ga0265338_10098537 3300028800 Bacteria 2391
405 Ga0265338_10119486 3300028800 Bacteria 2104
406 Ga0265338_10666905 3300028800 Bacteria 720
407 Ga0265765_1057942 3300030879 Bacteria 543
408 Ga0265771_1009326 3300031010 Bacteria 702
409 Ga0265760_10097307 3300031090 Bacteria 927
410 Ga0265760_10107296 3300031090 Bacteria 887
411 Ga0265320_10004602 3300031240 Bacteria 9016
412 Ga0265325_10017888 3300031241 Bacteria 3936
413 Ga0265325_10181906 3300031241 Unclassified 979
414 Ga0265340_10063347 3300031247 Bacteria 1765
415 Ga0265327_10216864 3300031251 Unclassified 862
416 Ga0307513_10100233 3300031456 Bacteria 2922
417 Ga0307513_10538882 3300031456 Unclassified 881
418 Ga0307413_10048702 3300031824 Bacteria 2535
419 Ga0307410_10017464 3300031852 Bacteria 4310
420 Ga0307410_10027716 3300031852 Bacteria 3583
421 Ga0307407_10521112 3300031903 Bacteria 874
422 Ga0307412_10067080 3300031911 Bacteria 2435
423 Ga0307412_11393208 3300031911 Bacteria 634
424 Ga0307409_100183555 3300031995 Bacteria 1854
425 Ga0307409_101488570 3300031995 Unclassified 704
426 Ga0307409_102377437 3300031995 Unclassified 559
427 Ga0307416_100360677 3300032002 Bacteria 1475
428 Ga0307416_101452583 3300032002 Bacteria 791
429 Ga0307414_10164640 3300032004 Bacteria 1766
430 Ga0307414_10796835 3300032004 Bacteria 861
431 Ga0307411_10646356 3300032005 Bacteria 915
432 Ga0307411_11394052 3300032005 Bacteria 641
433 Ga0307415_100754667 3300032126 Bacteria 884
434 Ga0373926_0119071 3300035083 Bacteria 995
435 Ga0373944_0025744 3300035089 Bacteria 1734
436 Ga0373923_0114941 3300035111 Unclassified 1198
437 Ga0373945_0454669 3300035116 Bacteria 567
438 Ga0373956_0356652 3300035119 Bacteria 697
439 Ga0373961_0318640 3300035241 Unclassified 579
440 Ga0373924_0024863 3300035410 Bacteria 2364
441 Ga0373931_0871324 3300035691 Unclassified 604
442 Ga0373935_0188045 3300035692 Bacteria 1421
443 Ga0373927_0126138 3300035695 Bacteria 1671
444 Ga0373927_0277561 3300035695 Bacteria 1102
445 Ga0373933_0547725 3300035724 Bacteria 759
446 Ga0373933_0853752 3300035724 Unclassified 599
447 Ga0373933_1027379 3300035724 Unclassified 543
448 Ga0373937_0099970 3300036401 Bacteria 2691
449 Ga0373937_1486886 3300036401 Unclassified 625
450 Ga0373925_0011716 3300037068 Bacteria 6342
451 Ga0373925_0025441 3300037068 Bacteria 4324
452 Ga0373925_0319976 3300037068 Bacteria 1255
453 Ga0373925_1378279 3300037068 Bacteria 578
454 Ga0451798_1094494 3300041458 Bacteria 1080
455 Ga0451807_2527478 3300041486 Unclassified 629
456 Ga0451577_0024902 3300042876 Bacteria 5436
457 Ga0466965_0320603 3300044683 Bacteria 844
458 Ga0453684_0113323 3300044712 Bacteria 3290
459 Ga0466968_0009934 3300044735 Bacteria 3674
460 Ga0466970_0027830 3300044765 Bacteria 2968
461 Ga0466960_0184731 3300044901 Bacteria 1132
462 Ga0451576_0041746 3300045051 Bacteria 4848
463 Ga0451576_0205379 3300045051 Unclassified 2057
464 Ga0451576_1010802 3300045051 Unclassified 871
465 Ga0466967_0007155 3300045976 Bacteria 8012
466 Ga0495592_0872856 3300046454 Unclassified 530
467 Ga0495603_0609782 3300046455 Bacteria 625
468 Ga0495603_0735049 3300046455 Unclassified 564
469 Ga0495629_0000266 3300046459 Bacteria 45368
470 Ga0495641_0106328 3300046461 Bacteria 1252
471 Ga0495580_0736083 3300046472 Bacteria 643
472 Ga0495582_0001126 3300046473 Bacteria 15037
473 Ga0495582_0009394 3300046473 Bacteria 5387
474 Ga0495639_0006640 3300046475 Bacteria 4976
475 Ga0495662_0015375 3300046476 Bacteria 3717
476 Ga0495594_0012807 3300046499 Bacteria 4373
477 Ga0495618_0842562 3300046514 Unclassified 532
478 Ga0495630_0714788 3300046517 Bacteria 766
479 Ga0495652_0240349 3300046529 Bacteria 1348
480 Ga0495665_0127418 3300046531 Bacteria 1333
481 Ga0495665_0336670 3300046531 Bacteria 769
482 Ga0495640_0054854 3300046533 Bacteria 2728
483 Ga0495586_0029663 3300046535 Bacteria 2928
484 Ga0495635_0000161 3300046663 Bacteria 41328
485 Ga0495647_0040833 3300046681 Bacteria 1765
486 Ga0495647_0282782 3300046681 Bacteria 744
487 Ga0495658_0000178 3300046683 Bacteria 36369
488 Ga0495658_0069419 3300046683 Bacteria 2042
489 Ga0495613_0018558 3300046689 Bacteria 5186
490 Ga0495613_0028348 3300046689 Bacteria 4164
491 Ga0495581_0001807 3300047315 Bacteria 11963
492 Ga0495581_0129239 3300047315 Bacteria 1472
493 Ga0495581_0706289 3300047315 Bacteria 581
494 Ga0495674_0092804 3300047319 Bacteria 2577
495 Ga0495680_0000386 3300047322 Bacteria 49193
496 Ga0495680_0382892 3300047322 Bacteria 974
497 Ga0495684_0625890 3300047471 Unclassified 723
498 Ga0495684_0929026 3300047471 Bacteria 558
499 Ga0495614_0012709 3300048089 Bacteria 3693
500 Ga0495614_0084107 3300048089 Bacteria 1380
501 Ga0496100_0027449 3300048903 Bacteria 3501
502 Ga0496101_0054528 3300048904 Bacteria 2886
503 Ga0496102_0064082 3300048905 Bacteria 3366
504 Ga0496103_0982403 3300048906 Bacteria 526
505 Ga0496104_0174721 3300048907 Bacteria 2058
506 Ga0496107_0110211 3300048910 Bacteria 2022
507 Ga0496109_0808399 3300048912 Unclassified 875
508 Ga0496112_0267071 3300048915 Bacteria 1660
509 Ga0496112_0339426 3300048915 Unclassified 1446
510 Ga0496112_1152214 3300048915 Unclassified 693
511 Ga0496112_1250798 3300048915 Unclassified 658
512 Ga0496112_1669237 3300048915 Unclassified 550
513 Ga0496114_0036287 3300048917 Bacteria 4074
514 Ga0496115_0027247 3300048918 Bacteria 4468
515 Ga0501037_0097704 3300049573 Bacteria 2122
516 Ga0501038_0082680 3300049574 Bacteria 2704
517 Ga0501038_0362111 3300049574 Unclassified 1128
518 Ga0501039_0285727 3300049575 Bacteria 1297
519 Ga0501040_0059195 3300049576 Bacteria 2632
520 Ga0501041_0195018 3300049577 Unclassified 1269
521 Ga0501042_0378830 3300049578 Bacteria 1024
522 Ga0501068_0678127 3300049584 Unclassified 673
523 Ga0501071_0500720 3300049587 Unclassified 932
524 Ga0501071_1292799 3300049587 Unclassified 563
525 Ga0501072_0131459 3300049588 Bacteria 1995
526 Ga0501075_0100873 3300049591 Bacteria 2192
527 Ga0501075_0663035 3300049591 Unclassified 795
528 Ga0501076_0675744 3300049592 Unclassified 852
529 Ga0501076_1118706 3300049592 Unclassified 648
530 Ga0501077_0005585 3300049593 Bacteria 7659
531 Ga0501077_0135276 3300049593 Bacteria 1563
532 Ga0501079_0040045 3300049741 Bacteria 3615
533 Ga0501081_0010295 3300049743 Bacteria 6106
534 Ga0501035_0143483 3300049822 Bacteria 2075
535 Ga0501044_0010303 3300049823 Bacteria 10155
536 Ga0501045_0893756 3300049824 Unclassified 653
537 nmdc:mga03683_12487_c1 3300050489 Unclassified 3104
538 nmdc:mga0k408_84299_c1 3300050493 Bacteria 1864
539 nmdc:mga05p37_152384_c1 3300050507 Bacteria 2827
540 nmdc:mga09592_97222_c1 3300050508 Bacteria 2520
541 nmdc:mga06r32_236285_c1 3300050510 Bacteria 1815
542 nmdc:mga08y16_211692_c1 3300050511 Unclassified 2008
543 nmdc:mga08y16_692156_c1 3300050511 Bacteria 1020
544 nmdc:mga08y16_98778_c1 3300050511 Bacteria 3040
545 nmdc:mga0n895_1921634_c1 3300050512 Bacteria 550
546 nmdc:mga0n895_1978_c1 3300050512 Bacteria 15722
547 nmdc:mga0rr50_280241_c1 3300050513 Bacteria 1391
548 nmdc:mga0a205_21416_c1 3300050515 Bacteria 4553
549 nmdc:mga0a205_317072_c1 3300050515 Bacteria 1430
550 nmdc:mga0a205_63630_c1 3300050515 Bacteria 3564
551 Ga0495601_0192818 3300053077 Unclassified 1332
552 Ga0495612_0447617 3300053078 Unclassified 590
553 Ga0495619_0000586 3300053085 Bacteria 24267
554 Ga0495619_0030790 3300053085 Bacteria 3474
555 Ga0501084_0065318 3300054114 Bacteria 3044
556 Ga0501084_0611491 3300054114 Unclassified 921
557 Ga0501082_0110298 3300060353 Bacteria 2382
558 Ga0530510_0024109 3300061734 Bacteria 4340
559 Ga0070690_100006120
560 SwRhRL2b_contig_1837978
561 JGI24751J29686_10000136
562 rootH1_10241251
563 Ga0065704_10072770
564 Ga0065712_10002422
565 Ga0065712_10632698
566 Ga0065715_10002359
567 Ga0065715_10240915
568 Ga0065707_10105310
569 Ga0070676_10253071
570 Ga0070676_10367133
571 Ga0070690_100563434
572 Ga0070670_100000098
573 Ga0070670_100029104
574 Ga0070670_100049583
575 Ga0070670_100063533
576 Ga0070670_100098922
577 Ga0070670_100136651
578 Ga0068869_100047783
579 Ga0068869_100481626
580 Ga0068869_100763280
581 Ga0068869_101242805
582 Ga0070680_100471061
583 Ga0070680_101145515
584 Ga0070680_101269414
585 Ga0070682_100072626
586 Ga0070682_100101014
587 Ga0070682_100314741
588 Ga0068868_100491272
589 Ga0068868_101421678
590 Ga0068868_101964791
591 Ga0070689_101377469
592 Ga0070687_100438015
593 Ga0070687_100815304
594 Ga0070687_101501496
595 Ga0070661_101130181
596 Ga0070692_10004063
597 Ga0070692_10038139
598 Ga0070692_10346767
599 Ga0070668_100524174
600 Ga0070669_100239068
601 Ga0070675_100224159
602 Ga0070675_100286112
603 Ga0070675_100473769
604 Ga0070675_100939071
605 Ga0070671_100500145
606 Ga0070671_100556511
607 Ga0070674_101247144
608 Ga0070673_100052021
609 Ga0070673_100197608
610 Ga0070673_100537941
611 Ga0070673_101725458
612 Ga0070673_102292340
613 Ga0070688_100358375
614 Ga0070688_100465094
615 Ga0070659_100300141
616 Ga0070667_100149772
617 Ga0070667_100350267
618 Ga0070709_10082699
619 Ga0070709_10164737
620 Ga0070709_10432681
621 Ga0070714_100113794
622 Ga0070714_100144263
623 Ga0070714_100470232
624 Ga0070714_102269000
625 Ga0070713_100005159
626 Ga0070713_100035657
627 Ga0070713_100159307
628 Ga0070713_100286496
629 Ga0070713_100660636
630 Ga0070710_10002926
631 Ga0070710_10015813
632 Ga0070710_10190568
633 Ga0070710_10215065
634 Ga0070701_10257885
635 Ga0070701_10553526
636 Ga0070701_11016109
637 Ga0070711_100070588
638 Ga0070711_100244223
639 Ga0070711_100399540
640 Ga0070711_100916937
641 Ga0070705_100387788
642 Ga0070705_100581931
643 Ga0070705_101040335
644 Ga0070700_100017654
645 Ga0070700_100095908
646 Ga0070700_100783194
647 Ga0070694_100003386
648 Ga0070694_100081573
649 Ga0070694_100375765
650 Ga0070663_100049775
651 Ga0070663_100946095
652 Ga0068867_100450057
653 Ga0070685_10399886
654 Ga0070707_100035223
655 Ga0070698_100008974
656 Ga0070698_101377443
657 Ga0070699_100007018
658 Ga0070697_100016179
659 Ga0068853_100150809
660 Ga0068853_100157534
661 Ga0070672_100003867
662 Ga0070672_100010339
663 Ga0070686_100025519
664 Ga0070695_100171157
665 Ga0070695_101339527
666 Ga0070695_101405894
667 Ga0070695_101632480
668 Ga0070693_100052185
669 Ga0070693_100829735
670 Ga0070665_100104468
671 Ga0070665_100271356
672 Ga0070665_100286506
673 Ga0070665_101136691
674 Ga0070665_101602012
675 Ga0070704_100007136
676 Ga0070704_100652979
677 Ga0068855_100168315
678 Ga0070664_100068645
679 Ga0068857_100100957
680 Ga0068857_100277777
681 Ga0068857_100447929
682 Ga0068857_101153100
683 Ga0068854_100944506
684 Ga0068856_101411687
685 Ga0068856_101461120
686 Ga0070702_100363217
687 Ga0070702_100850585
688 Ga0070702_101084207
689 Ga0068852_100237267
690 Ga0068852_100653506
691 Ga0068859_100077749
692 Ga0068859_100130917
693 Ga0068859_100181433
694 Ga0068859_100468393
695 Ga0068859_100896958
696 Ga0068859_101688088
697 Ga0068859_103002711
698 Ga0068864_100022014
699 Ga0068864_100245338
700 Ga0068864_100287185
701 Ga0068864_100416997
702 Ga0068864_100665230
703 Ga0068864_102387845
704 Ga0068861_100346556
705 Ga0068870_10829021
706 Ga0068870_11097128
707 Ga0068863_100076624
708 Ga0068863_100185130
709 Ga0068863_101591662
710 Ga0068858_100074624
711 Ga0068858_100308295
712 Ga0068858_100419644
713 Ga0068858_100680383
714 Ga0068858_100761697
715 Ga0068858_101312558
716 Ga0068860_100028493
717 Ga0068860_100237573
718 Ga0068860_100588237
719 Ga0068860_102374241
720 Ga0068862_100157513
721 Ga0068862_101177025
722 Ga0070717_10042001
723 Ga0070717_10046587
724 Ga0070717_10647436
725 Ga0070717_11395285
726 Ga0070717_11475506
727 Ga0070717_11954228
728 Ga0070715_10040159
729 Ga0070715_10145322
730 Ga0070716_100096185
731 Ga0070716_100633701
732 Ga0070716_100778469
733 Ga0070712_100000462
734 Ga0070712_100003628
735 Ga0070712_100078531
736 Ga0070712_100241103
737 Ga0075362_10143047
738 Ga0075367_10610924
739 Ga0075366_10080895
740 Ga0097621_100079232
741 Ga0097621_100603321
742 Ga0097621_101659711
743 Ga0068871_100030454
744 Ga0075428_100020012
745 Ga0075433_10032427
746 Ga0075433_10056849
747 Ga0075434_100003952
748 Ga0075434_100121591
749 Ga0075434_100757233
750 Ga0075429_100020614
751 Ga0068865_100315835
752 Ga0068865_101101324
753 Ga0068865_101672218
754 Ga0075436_101420791
755 Ga0097620_100077748
756 Ga0097620_100130909
757 Ga0097620_100181440
758 Ga0097620_100247120
759 Ga0097620_100468405
760 Ga0097620_100897001
761 Ga0097620_101687981
762 Ga0097620_103002683
763 Ga0075435_100213391
764 Ga0075435_100908312
765 Ga0075435_102025882
766 Ga0105250_10385516
767 Ga0105240_10008188
768 Ga0105240_10084314
769 Ga0105240_10926895
770 Ga0111539_10014009
771 Ga0111539_10062947
772 Ga0111539_10690203
773 Ga0111539_10983232
774 Ga0105245_10044761
775 Ga0105245_10298315
776 Ga0105247_10000841
777 Ga0105247_10008706
778 Ga0114129_10093049
779 Ga0105243_10296068
780 Ga0105241_10042055
781 Ga0105241_10116404
782 Ga0105241_10168802
783 Ga0105241_10869083
784 Ga0105241_11119779
785 Ga0105248_10969836
786 Ga0105237_10209510
787 Ga0105237_10230602
788 Ga0105238_10006163
789 Ga0105238_10060690
790 Ga0105238_10496771
791 Ga0105249_10100186
792 Ga0105249_10298039
793 Ga0105249_10306027
794 Ga0099796_10225952
795 Ga0105239_10007611
796 Ga0105239_10533009
797 Ga0105239_13183344
798 Ga0105246_10326188
799 Ga0157373_11486129
800 Ga0157371_10163198
801 Ga0157369_10050997
802 Ga0157369_10111307
803 Ga0157369_10364647
804 Ga0157374_10011084
805 Ga0157374_10198481
806 Ga0157374_10411452
807 Ga0157378_10252183
808 Ga0157378_10843570
809 Ga0163162_10048169
810 Ga0163162_10074135
811 Ga0163162_10124619
812 Ga0163162_10239839
813 Ga0163162_10572051
814 Ga0163162_10596786
815 Ga0163162_11274403
816 Ga0163162_12682750
817 Ga0157372_10011101
818 Ga0157372_11234255
819 Ga0157372_12602959
820 Ga0157375_10248160
821 Ga0157375_10268821
822 Ga0157375_12794243
823 Ga0163163_10000465
824 Ga0163163_10341099
825 Ga0163163_10477690
826 Ga0163163_10604788
827 Ga0157380_10888140
828 Ga0157377_10219557
829 Ga0157377_11652705
830 Ga0157379_10022874
831 Ga0157379_10347012
832 Ga0157379_10606008
833 Ga0157376_11566005
834 Ga0163161_10463576
835 Ga0163161_10992729
836 Ga0224571_100230
837 Ga0224572_1000658
838 Ga0228598_1000187
839 Ga0228598_1004846
840 Ga0207713_1100356
841 Ga0207692_10002149
842 Ga0207692_10171973
843 Ga0207692_10303460
844 Ga0207692_10354752
845 Ga0207710_10000563
846 Ga0207710_10012384
847 Ga0207710_10541051
848 Ga0207688_10599925
849 Ga0207647_10116972
850 Ga0207685_10028980
851 Ga0207685_10295977
852 Ga0207699_10014387
853 Ga0207699_10112666
854 Ga0207699_10580421
855 Ga0207645_10685221
856 Ga0207643_10782254
857 Ga0207643_11024528
858 Ga0207695_10015919
859 Ga0207695_10333760
860 Ga0207695_10610481
861 Ga0207671_10196023
862 Ga0207693_10000966
863 Ga0207693_10024836
864 Ga0207693_10064578
865 Ga0207693_10198522
866 Ga0207693_10822937
867 Ga0207663_10065308
868 Ga0207663_10291568
869 Ga0207663_10350203
870 Ga0207662_10023799
871 Ga0207662_10509246
872 Ga0207646_10034183
873 Ga0207694_10063671
874 Ga0207694_10597463
875 Ga0207650_10000156
876 Ga0207650_10030182
877 Ga0207650_10207176
878 Ga0207659_10055587
879 Ga0207659_10180299
880 Ga0207659_10201798
881 Ga0207659_11733549
882 Ga0207687_10181215
883 Ga0207687_10829189
884 Ga0207700_10002454
885 Ga0207700_10054589
886 Ga0207700_10206865
887 Ga0207700_10488747
888 Ga0207700_10673602
889 Ga0207664_10091990
890 Ga0207664_10536060
891 Ga0207664_10796718
892 Ga0207690_10795003
893 Ga0207706_10221261
894 Ga0207706_10746658
895 Ga0207670_10595002
896 Ga0207670_10665747
897 Ga0207704_10626362
898 Ga0207665_10014667
899 Ga0207665_10070776
900 Ga0207665_10073650
901 Ga0207665_10617763
902 Ga0207691_10010906
903 Ga0207691_10373777
904 Ga0207689_10038886
905 Ga0207689_10095032
906 Ga0207689_10133479
907 Ga0207689_10195134
908 Ga0207679_10050311
909 Ga0207667_10011505
910 Ga0207667_10157036
911 Ga0207651_10054473
912 Ga0207651_10209000
913 Ga0207651_11873061
914 Ga0207712_10969893
915 Ga0207640_10536366
916 Ga0207640_11059204
917 Ga0207677_10185887
918 Ga0207677_10701101
919 Ga0207703_10067667
920 Ga0207703_10150554
921 Ga0207703_10214430
922 Ga0207703_10898940
923 Ga0207703_11064904
924 Ga0207639_10243636
925 Ga0207639_10488162
926 Ga0207639_11994903
927 Ga0207678_10073868
928 Ga0207708_10036198
929 Ga0207708_10084597
930 Ga0207708_11263706
931 Ga0207702_11107855
932 Ga0207641_10064505
933 Ga0207641_10105794
934 Ga0207641_11548883
935 Ga0207648_10424333
936 Ga0207676_10018185
937 Ga0207676_10354082
938 Ga0207676_10459554
939 Ga0207676_10628451
940 Ga0207674_10176358
941 Ga0207674_10282491
942 Ga0207674_10700973
943 Ga0207674_10729667
944 Ga0207675_100110454
945 Ga0207675_100171041
946 Ga0207698_10042597
947 Ga0207428_10067686
948 Ga0207428_10244218
949 Ga0268266_10075828
950 Ga0268266_10197048
951 Ga0268266_10215035
952 Ga0268266_11430079
953 Ga0268265_10269868
954 Ga0268265_10540396
955 Ga0268265_12453230
956 Ga0268264_10077263
957 Ga0268264_10087093
958 Ga0268264_10102103
959 Ga0265337_1007010
960 Ga0307515_10333601
961 Ga0265338_10082174
962 Ga0265338_10098537
963 Ga0265338_10119486
964 Ga0265338_10666905
965 Ga0265765_1057942
966 Ga0265771_1009326
967 Ga0265760_10097307
968 Ga0265760_10107296
969 Ga0265320_10004602
970 Ga0265325_10017888
971 Ga0265325_10181906
972 Ga0265340_10063347
973 Ga0265327_10216864
974 Ga0307513_10100233
975 Ga0307513_10538882
976 Ga0307413_10048702
977 Ga0307410_10017464
978 Ga0307410_10027716
979 Ga0307407_10521112
980 Ga0307412_10067080
981 Ga0307412_11393208
982 Ga0307409_100183555
983 Ga0307409_101488570
984 Ga0307409_102377437
985 Ga0307416_100360677
986 Ga0307416_101452583
987 Ga0307414_10164640
988 Ga0307414_10796835
989 Ga0307411_10646356
990 Ga0307411_11394052
991 Ga0307415_100754667
992 Ga0373926_0119071
993 Ga0373944_0025744
994 Ga0373923_0114941
995 Ga0373945_0454669
996 Ga0373956_0356652
997 Ga0373961_0318640
998 Ga0373924_0024863
999 Ga0373931_0871324
1000 Ga0373935_0188045
1001 Ga0373927_0126138
1002 Ga0373927_0277561
1003 Ga0373933_0547725
1004 Ga0373933_0853752
1005 Ga0373933_1027379
1006 Ga0373937_0099970
1007 Ga0373937_1486886
1008 Ga0373925_0011716
1009 Ga0373925_0025441
1010 Ga0373925_0319976
1011 Ga0373925_1378279
1012 Ga0451798_1094494
1013 Ga0451807_2527478
1014 Ga0451577_0024902
1015 Ga0466965_0320603
1016 Ga0453684_0113323
1017 Ga0466968_0009934
1018 Ga0466970_0027830
1019 Ga0466960_0184731
1020 Ga0451576_0041746
1021 Ga0451576_0205379
1022 Ga0451576_1010802
1023 Ga0466967_0007155
1024 Ga0495592_0872856
1025 Ga0495603_0609782
1026 Ga0495603_0735049
1027 Ga0495629_0000266
1028 Ga0495641_0106328
1029 Ga0495580_0736083
1030 Ga0495582_0001126
1031 Ga0495582_0009394
1032 Ga0495639_0006640
1033 Ga0495662_0015375
1034 Ga0495594_0012807
1035 Ga0495618_0842562
1036 Ga0495630_0714788
1037 Ga0495652_0240349
1038 Ga0495665_0127418
1039 Ga0495665_0336670
1040 Ga0495640_0054854
1041 Ga0495586_0029663
1042 Ga0495635_0000161
1043 Ga0495647_0040833
1044 Ga0495647_0282782
1045 Ga0495658_0000178
1046 Ga0495658_0069419
1047 Ga0495613_0018558
1048 Ga0495613_0028348
1049 Ga0495581_0001807
1050 Ga0495581_0129239
1051 Ga0495581_0706289
1052 Ga0495674_0092804
1053 Ga0495680_0000386
1054 Ga0495680_0382892
1055 Ga0495684_0625890
1056 Ga0495684_0929026
1057 Ga0495614_0012709
1058 Ga0495614_0084107
1059 Ga0496100_0027449
1060 Ga0496101_0054528
1061 Ga0496102_0064082
1062 Ga0496103_0982403
1063 Ga0496104_0174721
1064 Ga0496107_0110211
1065 Ga0496109_0808399
1066 Ga0496112_0267071
1067 Ga0496112_0339426
1068 Ga0496112_1152214
1069 Ga0496112_1250798
1070 Ga0496112_1669237
1071 Ga0496114_0036287
1072 Ga0496115_0027247
1073 Ga0501037_0097704
1074 Ga0501038_0082680
1075 Ga0501038_0362111
1076 Ga0501039_0285727
1077 Ga0501040_0059195
1078 Ga0501041_0195018
1079 Ga0501042_0378830
1080 Ga0501068_0678127
1081 Ga0501071_0500720
1082 Ga0501071_1292799
1083 Ga0501072_0131459
1084 Ga0501075_0100873
1085 Ga0501075_0663035
1086 Ga0501076_0675744
1087 Ga0501076_1118706
1088 Ga0501077_0005585
1089 Ga0501077_0135276
1090 Ga0501079_0040045
1091 Ga0501081_0010295
1092 Ga0501035_0143483
1093 Ga0501044_0010303
1094 Ga0501045_0893756
1095 nmdc:mga03683_12487_c1
1096 nmdc:mga0k408_84299_c1
1097 nmdc:mga05p37_152384_c1
1098 nmdc:mga09592_97222_c1
1099 nmdc:mga06r32_236285_c1
1100 nmdc:mga08y16_211692_c1
1101 nmdc:mga08y16_692156_c1
1102 nmdc:mga08y16_98778_c1
1103 nmdc:mga0n895_1921634_c1
1104 nmdc:mga0n895_1978_c1
1105 nmdc:mga0rr50_280241_c1
1106 nmdc:mga0a205_21416_c1
1107 nmdc:mga0a205_317072_c1
1108 nmdc:mga0a205_63630_c1
1109 Ga0495601_0192818
1110 Ga0495612_0447617
1111 Ga0495619_0000586
1112 Ga0495619_0030790
1113 Ga0501084_0065318
1114 Ga0501084_0611491
1115 Ga0501082_0110298
1116 Ga0530510_0024109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

35

116

0.98

Map