F463375

General Info

Members Datasets Scaffolds Average Seq Length
557 276 557 158

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_1283715|Ga0501084_1283715_34_525
Length 163
Sequence MTEYSFLTTWCLAAHRERVWDAIWESERWPEWWRGMVGSRRLVDGDETGVGQVGRYTWRSRLPYTLDFEMTTTRVDKPHLLEGHAVGELDGTGRWRLFEEGAAAGDGPLTVVVYEWNVRTTKPWMNLLAPIARPAFEWNHDWVMRRGGEGIARLLGCRLLAID

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 11.85
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000380 3300001977 Bacteria 6533
2 JGI24748J21848_1000396 3300002074 Bacteria 4941
3 JGI24034J26672_10000160 3300002239 Bacteria 9507
4 JGI24742J22300_10009641 3300002244 Bacteria 1594
5 Ga0070683_100010098 3300005329 Bacteria 8100
6 Ga0070683_100011494 3300005329 Bacteria 7656
7 Ga0070683_100016073 3300005329 Bacteria 6587
8 Ga0070683_100027424 3300005329 Bacteria 5137
9 Ga0070683_100098772 3300005329 Bacteria 2747
10 Ga0070683_100347727 3300005329 Bacteria 1412
11 Ga0070670_100226127 3300005331 Bacteria 1628
12 Ga0070677_10000075 3300005333 Bacteria 31359
13 Ga0070682_100539397 3300005337 Bacteria 911
14 Ga0068868_100003875 3300005338 Bacteria 10443
15 Ga0070689_100305118 3300005340 Bacteria 1326
16 Ga0070661_100000524 3300005344 Bacteria 29415
17 Ga0070692_10117953 3300005345 Bacteria 1476
18 Ga0070668_100042034 3300005347 Bacteria 3503
19 Ga0070668_100305930 3300005347 Bacteria 1334
20 Ga0070668_100455260 3300005347 Bacteria 1101
21 Ga0070675_100000008 3300005354 Bacteria 250004
22 Ga0070671_101256541 3300005355 Unclassified 652
23 Ga0070674_100000047 3300005356 Bacteria 52597
24 Ga0070674_100000105 3300005356 Bacteria 39263
25 Ga0070673_100115152 3300005364 Bacteria 2235
26 Ga0070688_100000151 3300005365 Bacteria 37674
27 Ga0070688_100043464 3300005365 Bacteria 2768
28 Ga0070659_100092521 3300005366 Bacteria 2425
29 Ga0070659_100822131 3300005366 Bacteria 809
30 Ga0070667_100002491 3300005367 Bacteria 16067
31 Ga0070667_100022130 3300005367 Bacteria 5273
32 Ga0070667_100459792 3300005367 Bacteria 1164
33 Ga0070714_100025876 3300005435 Bacteria 4846
34 Ga0070713_100001587 3300005436 Bacteria 14561
35 Ga0070711_100010236 3300005439 Bacteria 5798
36 Ga0070711_100035451 3300005439 Bacteria 3336
37 Ga0070663_100009347 3300005455 Bacteria 6067
38 Ga0070663_100846578 3300005455 Bacteria 787
39 Ga0070678_100013711 3300005456 Bacteria 5092
40 Ga0070678_100198218 3300005456 Bacteria 1655
41 Ga0070681_10064130 3300005458 Bacteria 3645
42 Ga0070685_10000092 3300005466 Bacteria 55484
43 Ga0070685_10002231 3300005466 Bacteria 10002
44 Ga0070679_100000804 3300005530 Bacteria 27213
45 Ga0070679_100020824 3300005530 Bacteria 6397
46 Ga0070684_100062642 3300005535 Bacteria 3258
47 Ga0070684_100146206 3300005535 Bacteria 2140
48 Ga0070684_100476029 3300005535 Bacteria 1155
49 Ga0070684_101453701 3300005535 Unclassified 646
50 Ga0068853_100014352 3300005539 Bacteria 6486
51 Ga0068853_100232363 3300005539 Bacteria 1687
52 Ga0068853_100376159 3300005539 Bacteria 1326
53 Ga0070672_100001255 3300005543 Bacteria 15606
54 Ga0070686_100296421 3300005544 Bacteria 1198
55 Ga0070693_100002159 3300005547 Bacteria 9022
56 Ga0070665_100000128 3300005548 Bacteria 142568
57 Ga0070665_100002491 3300005548 Bacteria 20261
58 Ga0070665_100157060 3300005548 Bacteria 2276
59 Ga0070665_100225941 3300005548 Bacteria 1872
60 Ga0070665_100420946 3300005548 Bacteria 1344
61 Ga0070665_100603457 3300005548 Bacteria 1111
62 Ga0070704_100368844 3300005549 Bacteria 1217
63 Ga0070704_101014756 3300005549 Bacteria 751
64 Ga0068855_100145972 3300005563 Bacteria 2693
65 Ga0068855_100434410 3300005563 Bacteria 1435
66 Ga0070664_100094706 3300005564 Bacteria 2590
67 Ga0070664_100115747 3300005564 Bacteria 2344
68 Ga0068854_100000123 3300005578 Bacteria 53446
69 Ga0068856_100019149 3300005614 Bacteria 6644
70 Ga0068856_100206002 3300005614 Bacteria 1981
71 Ga0068856_100315286 3300005614 Bacteria 1581
72 Ga0068856_100851730 3300005614 Bacteria 931
73 Ga0068856_101621381 3300005614 Bacteria 660
74 Ga0068852_100000050 3300005616 Bacteria 84306
75 Ga0068852_100787226 3300005616 Bacteria 965
76 Ga0068866_10000006 3300005718 Bacteria 176129
77 Ga0068866_10000124 3300005718 Bacteria 33822
78 Ga0068866_10361900 3300005718 Bacteria 925
79 Ga0068851_10001237 3300005834 Bacteria 11090
80 Ga0068863_100000039 3300005841 Bacteria 161450
81 Ga0068863_100003181 3300005841 Bacteria 16230
82 Ga0068858_100000354 3300005842 Bacteria 48397
83 Ga0068858_100001452 3300005842 Bacteria 24367
84 Ga0068858_100233866 3300005842 Bacteria 1742
85 Ga0068858_100452807 3300005842 Bacteria 1237
86 Ga0068858_101140294 3300005842 Bacteria 766
87 Ga0068862_100013835 3300005844 Bacteria 6688
88 Ga0081455_10052747 3300005937 Bacteria 3479
89 Ga0075365_10266720 3300006038 Bacteria 1204
90 Ga0070715_10000003 3300006163 Bacteria 345282
91 Ga0070716_100182683 3300006173 Bacteria 1378
92 Ga0070712_100019703 3300006175 Bacteria 4405
93 Ga0070712_100544160 3300006175 Bacteria 978
94 Ga0097621_101284342 3300006237 Bacteria 691
95 Ga0075431_100011442 3300006847 Bacteria 8942
96 Ga0075433_10000875 3300006852 Bacteria 21136
97 Ga0075434_100024738 3300006871 Bacteria 5873
98 Ga0075436_100560786 3300006914 Bacteria 839
99 Ga0075436_100655048 3300006914 Bacteria 776
100 Ga0075435_100202618 3300007076 Bacteria 1682
101 Ga0105240_10339563 3300009093 Bacteria 1707
102 Ga0105240_10852643 3300009093 Bacteria 983
103 Ga0111539_10067976 3300009094 Bacteria 4207
104 Ga0105245_10000012 3300009098 Bacteria 267151
105 Ga0105245_10000067 3300009098 Bacteria 107929
106 Ga0105245_10000246 3300009098 Bacteria 51410
107 Ga0105245_10009989 3300009098 Bacteria 8264
108 Ga0105245_11798275 3300009098 Bacteria 665
109 Ga0105247_10197438 3300009101 Bacteria 1350
110 Ga0114129_10059127 3300009147 Bacteria 5359
111 Ga0105243_10009568 3300009148 Bacteria 7379
112 Ga0105243_10091763 3300009148 Bacteria 2502
113 Ga0105241_10248208 3300009174 Bacteria 1508
114 Ga0105241_10256321 3300009174 Bacteria 1485
115 Ga0105242_10000010 3300009176 Bacteria 151649
116 Ga0105242_10149891 3300009176 Bacteria 2033
117 Ga0105248_10000307 3300009177 Bacteria 58221
118 Ga0105248_10260295 3300009177 Bacteria 1953
119 Ga0105248_12421266 3300009177 Unclassified 598
120 Ga0105237_10169985 3300009545 Bacteria 2179
121 Ga0105238_10000014 3300009551 Bacteria 241954
122 Ga0105238_11487729 3300009551 Unclassified 706
123 Ga0105249_10000159 3300009553 Bacteria 82172
124 Ga0105249_10070387 3300009553 Bacteria 3229
125 Ga0099796_10357347 3300010159 Bacteria 631
126 Ga0105239_10232460 3300010375 Bacteria 2068
127 Ga0157371_10002341 3300013102 Bacteria 18157
128 Ga0157370_10040358 3300013104 Bacteria 4506
129 Ga0157370_10316975 3300013104 Bacteria 1439
130 Ga0157369_10000222 3300013105 Bacteria 78413
131 Ga0157374_10000281 3300013296 Bacteria 46977
132 Ga0157374_11406981 3300013296 Bacteria 720
133 Ga0157378_10009857 3300013297 Bacteria 8326
134 Ga0163162_10139140 3300013306 Bacteria 2540
135 Ga0163162_10641534 3300013306 Bacteria 1186
136 Ga0157372_10006714 3300013307 Bacteria 12237
137 Ga0157375_10000095 3300013308 Bacteria 88952
138 Ga0157375_10035586 3300013308 Bacteria 4754
139 Ga0157375_10071355 3300013308 Bacteria 3486
140 Ga0157375_11835863 3300013308 Bacteria 719
141 Ga0157375_11902153 3300013308 Bacteria 706
142 Ga0163163_10758016 3300014325 Bacteria 1034
143 Ga0163163_11356208 3300014325 Unclassified 773
144 Ga0163163_11456178 3300014325 Bacteria 746
145 Ga0157380_10000594 3300014326 Bacteria 22281
146 Ga0157380_12078593 3300014326 Unclassified 631
147 Ga0157377_10334854 3300014745 Bacteria 1010
148 Ga0157379_10013677 3300014968 Bacteria 7111
149 Ga0157379_10165185 3300014968 Bacteria 1998
150 Ga0157376_10202790 3300014969 Bacteria 1826
151 Ga0157376_10259601 3300014969 Bacteria 1627
152 Ga0157376_10544287 3300014969 Bacteria 1148
153 Ga0163161_10000140 3300017792 Bacteria 66684
154 Ga0163161_10072390 3300017792 Bacteria 2523
155 Ga0206356_11783605 3300020070 Bacteria 1631
156 Ga0206353_10708015 3300020082 Bacteria 1610
157 Ga0207682_10000217 3300025893 Bacteria 25947
158 Ga0207642_10000001 3300025899 Bacteria 714030
159 Ga0207642_10000003 3300025899 Bacteria 650651
160 Ga0207642_10000004 3300025899 Bacteria 407822
161 Ga0207642_10000152 3300025899 Bacteria 19609
162 Ga0207642_10262102 3300025899 Bacteria 986
163 Ga0207642_10407673 3300025899 Bacteria 815
164 Ga0207710_10181282 3300025900 Bacteria 1033
165 Ga0207680_10055188 3300025903 Bacteria 2393
166 Ga0207685_10000003 3300025905 Bacteria 344527
167 Ga0207705_10102922 3300025909 Bacteria 2103
168 Ga0207654_10106448 3300025911 Bacteria 1737
169 Ga0207707_10098235 3300025912 Bacteria 2559
170 Ga0207693_10023691 3300025915 Bacteria 4871
171 Ga0207693_10772702 3300025915 Bacteria 741
172 Ga0207663_10005102 3300025916 Bacteria 6597
173 Ga0207663_10149444 3300025916 Bacteria 1637
174 Ga0207657_10875486 3300025919 Bacteria 692
175 Ga0207649_10000610 3300025920 Bacteria 24162
176 Ga0207652_10000119 3300025921 Bacteria 86757
177 Ga0207652_10000332 3300025921 Bacteria 49012
178 Ga0207694_10000008 3300025924 Bacteria 484902
179 Ga0207650_10448111 3300025925 Bacteria 1074
180 Ga0207659_10000049 3300025926 Bacteria 82923
181 Ga0207687_10000011 3300025927 Bacteria 388349
182 Ga0207687_10000012 3300025927 Bacteria 370729
183 Ga0207687_10000503 3300025927 Bacteria 26341
184 Ga0207687_10004483 3300025927 Bacteria 9293
185 Ga0207700_10000016 3300025928 Bacteria 202434
186 Ga0207664_10012655 3300025929 Bacteria 6036
187 Ga0207690_10002643 3300025932 Bacteria 10792
188 Ga0207690_10062808 3300025932 Bacteria 2530
189 Ga0207690_10561362 3300025932 Bacteria 929
190 Ga0207686_10000227 3300025934 Bacteria 42647
191 Ga0207686_10043634 3300025934 Bacteria 2749
192 Ga0207709_10030724 3300025935 Bacteria 3128
193 Ga0207709_10078365 3300025935 Bacteria 2121
194 Ga0207670_10490313 3300025936 Bacteria 996
195 Ga0207670_10969441 3300025936 Bacteria 714
196 Ga0207669_10000002 3300025937 Bacteria 377651
197 Ga0207669_10000765 3300025937 Bacteria 13768
198 Ga0207665_10116043 3300025939 Bacteria 1887
199 Ga0207691_10001495 3300025940 Bacteria 23287
200 Ga0207711_10000024 3300025941 Bacteria 293596
201 Ga0207661_10001860 3300025944 Bacteria 14445
202 Ga0207661_10009394 3300025944 Bacteria 7012
203 Ga0207661_10037300 3300025944 Bacteria 3800
204 Ga0207661_10082420 3300025944 Bacteria 2659
205 Ga0207661_10230695 3300025944 Bacteria 1639
206 Ga0207661_10772679 3300025944 Bacteria 884
207 Ga0207679_10078469 3300025945 Bacteria 2515
208 Ga0207679_10134505 3300025945 Bacteria 1989
209 Ga0207712_10000003 3300025961 Bacteria 615314
210 Ga0207712_10003211 3300025961 Bacteria 10389
211 Ga0207712_10402858 3300025961 Bacteria 1150
212 Ga0207668_10007500 3300025972 Bacteria 6489
213 Ga0207668_10143184 3300025972 Bacteria 1841
214 Ga0207668_10278908 3300025972 Bacteria 1370
215 Ga0207668_10503023 3300025972 Bacteria 1043
216 Ga0207640_10000040 3300025981 Bacteria 106134
217 Ga0207640_10045984 3300025981 Bacteria 2806
218 Ga0207658_10000871 3300025986 Bacteria 25155
219 Ga0207658_10014542 3300025986 Bacteria 5389
220 Ga0207658_10724983 3300025986 Bacteria 899
221 Ga0207677_10000787 3300026023 Bacteria 18192
222 Ga0207677_10002766 3300026023 Bacteria 9266
223 Ga0207703_10000028 3300026035 Bacteria 208682
224 Ga0207703_10000185 3300026035 Bacteria 72988
225 Ga0207703_10438661 3300026035 Bacteria 1218
226 Ga0207639_10009852 3300026041 Bacteria 6599
227 Ga0207639_10265008 3300026041 Bacteria 1505
228 Ga0207639_10351258 3300026041 Bacteria 1317
229 Ga0207639_10361023 3300026041 Bacteria 1300
230 Ga0207678_10000953 3300026067 Bacteria 26430
231 Ga0207678_10848147 3300026067 Bacteria 807
232 Ga0207708_10765206 3300026075 Bacteria 829
233 Ga0207708_10960104 3300026075 Bacteria 742
234 Ga0207702_10001168 3300026078 Bacteria 26815
235 Ga0207702_10008030 3300026078 Bacteria 8929
236 Ga0207702_10040826 3300026078 Bacteria 3890
237 Ga0207702_10722281 3300026078 Bacteria 982
238 Ga0207702_11632617 3300026078 Bacteria 638
239 Ga0207641_10000072 3300026088 Bacteria 151067
240 Ga0207674_10162179 3300026116 Bacteria 2190
241 Ga0207683_10155832 3300026121 Bacteria 2063
242 Ga0207683_10348842 3300026121 Bacteria 1358
243 Ga0207683_10370228 3300026121 Bacteria 1316
244 Ga0207698_10000009 3300026142 Bacteria 281300
245 Ga0207698_10608688 3300026142 Bacteria 1078
246 Ga0207428_10062230 3300027907 Bacteria 2952
247 Ga0268266_10000023 3300028379 Bacteria 501899
248 Ga0268266_10001616 3300028379 Bacteria 26283
249 Ga0268266_10001763 3300028379 Bacteria 24641
250 Ga0268266_10225668 3300028379 Bacteria 1723
251 Ga0268266_10439078 3300028379 Bacteria 1239
252 Ga0268265_10008225 3300028380 Bacteria 7046
253 Ga0268264_10264461 3300028381 Bacteria 1604
254 Ga0265337_1000041 3300028556 Bacteria 56264
255 Ga0265326_10000015 3300028558 Bacteria 159279
256 Ga0265319_1063361 3300028563 Bacteria 1196
257 Ga0265323_10079655 3300028653 Bacteria 1108
258 Ga0265322_10000003 3300028654 Bacteria 468671
259 Ga0265336_10005910 3300028666 Bacteria 4465
260 Ga0265324_10000907 3300029957 Bacteria 18733
261 Ga0265332_10126602 3300031238 Bacteria 1072
262 Ga0265328_10001369 3300031239 Bacteria 11243
263 Ga0265320_10000001 3300031240 Bacteria 847191
264 Ga0265339_10017679 3300031249 Bacteria 4218
265 Ga0265331_10009641 3300031250 Bacteria 5405
266 Ga0265327_10000003 3300031251 Bacteria 852750
267 Ga0265316_10024452 3300031344 Bacteria 5062
268 Ga0265314_10020220 3300031711 Bacteria 5141
269 Ga0307415_100093025 3300032126 Bacteria 2188
270 Ga0373937_0023647 3300036401 Bacteria 5537
271 Ga0373937_0070670 3300036401 Bacteria 3220
272 Ga0395901_0848828 3300038443 Bacteria 899
273 Ga0395901_1919451 3300038443 Unclassified 539
274 Ga0451802_0438050 3300041460 Bacteria 984
275 Ga0451807_1796160 3300041486 Bacteria 596
276 Ga0451807_2307049 3300041486 Unclassified 1140
277 Ga0451833_0634948 3300041491 Bacteria 1724
278 Ga0451839_0844376 3300041496 Bacteria 957
279 Ga0451853_3731523 3300041512 Bacteria 4069
280 Ga0466963_0000002 3300044694 Bacteria 108477
281 Ga0466957_0016522 3300044842 Bacteria 4316
282 Ga0466957_0155944 3300044842 Bacteria 1480
283 Ga0466958_0021909 3300045836 Bacteria 3737
284 Ga0466967_0000020 3300045976 Bacteria 78851
285 Ga0495592_0000999 3300046454 Bacteria 19653
286 Ga0495592_0387725 3300046454 Bacteria 888
287 Ga0495603_0000057 3300046455 Bacteria 48728
288 Ga0495603_0002491 3300046455 Bacteria 10836
289 Ga0495603_0003192 3300046455 Bacteria 9755
290 Ga0495629_0000028 3300046459 Bacteria 127409
291 Ga0495629_0004331 3300046459 Bacteria 10642
292 Ga0495629_0389110 3300046459 Bacteria 948
293 Ga0495629_0463522 3300046459 Bacteria 857
294 Ga0495641_0001934 3300046461 Bacteria 16875
295 Ga0495641_0067435 3300046461 Bacteria 1609
296 Ga0495651_0146464 3300046462 Bacteria 1707
297 Ga0495653_0096141 3300046463 Bacteria 2154
298 Ga0495653_0186428 3300046463 Bacteria 1419
299 Ga0495653_0223183 3300046463 Bacteria 1266
300 Ga0495582_0000048 3300046473 Bacteria 60887
301 Ga0495662_0000659 3300046476 Bacteria 16224
302 Ga0495662_0018027 3300046476 Bacteria 3415
303 Ga0495662_0053835 3300046476 Bacteria 1943
304 Ga0495664_0343379 3300046477 Bacteria 899
305 Ga0495606_0000294 3300046507 Bacteria 85998
306 Ga0495608_0000001 3300046511 Bacteria 411278
307 Ga0495608_0004024 3300046511 Bacteria 10551
308 Ga0495608_0119306 3300046511 Bacteria 1692
309 Ga0495628_0001728 3300046516 Bacteria 19872
310 Ga0495628_0011273 3300046516 Bacteria 7562
311 Ga0495628_0011510 3300046516 Bacteria 7479
312 Ga0495628_0232549 3300046516 Bacteria 1381
313 Ga0495628_0673367 3300046516 Unclassified 733
314 Ga0495630_0000165 3300046517 Bacteria 51355
315 Ga0495630_0037128 3300046517 Bacteria 3642
316 Ga0495630_0485403 3300046517 Bacteria 947
317 Ga0495637_0262121 3300046520 Unclassified 620
318 Ga0495644_0001304 3300046523 Bacteria 10235
319 Ga0495652_0047825 3300046529 Bacteria 3668
320 Ga0495652_0131103 3300046529 Bacteria 1984
321 Ga0495640_0040475 3300046533 Bacteria 3264
322 Ga0495640_0050074 3300046533 Bacteria 2879
323 Ga0495586_0032837 3300046535 Bacteria 2783
324 Ga0495587_0003143 3300046536 Bacteria 11040
325 Ga0495645_0001401 3300046543 Bacteria 16267
326 Ga0495645_0017457 3300046543 Bacteria 5141
327 Ga0495667_0000057 3300046559 Bacteria 100656
328 Ga0495667_0289804 3300046559 Bacteria 1038
329 Ga0495668_0277651 3300046616 Bacteria 918
330 Ga0495634_0000555 3300046642 Bacteria 36577
331 Ga0495634_0013405 3300046642 Bacteria 5922
332 Ga0495634_0055729 3300046642 Bacteria 2643
333 Ga0495588_0000195 3300046674 Bacteria 64337
334 Ga0495657_0000002 3300046675 Bacteria 411958
335 Ga0495657_0079405 3300046675 Bacteria 2125
336 Ga0495657_0096415 3300046675 Bacteria 1890
337 Ga0495599_0008656 3300046678 Bacteria 6192
338 Ga0495623_0208494 3300046679 Bacteria 1120
339 Ga0495623_0528165 3300046679 Unclassified 620
340 Ga0495623_0570039 3300046679 Unclassified 591
341 Ga0495647_0000020 3300046681 Bacteria 77355
342 Ga0495647_0002424 3300046681 Bacteria 5870
343 Ga0495647_0003249 3300046681 Bacteria 5202
344 Ga0495658_0000031 3300046683 Bacteria 71165
345 Ga0495669_0000064 3300046684 Bacteria 70549
346 Ga0495669_0186990 3300046684 Bacteria 988
347 Ga0495669_0210253 3300046684 Bacteria 931
348 Ga0495613_0000003 3300046689 Bacteria 248826
349 Ga0495613_0000500 3300046689 Bacteria 33170
350 Ga0495613_0185425 3300046689 Bacteria 1472
351 Ga0495624_0000087 3300046690 Bacteria 61504
352 Ga0495624_0000652 3300046690 Bacteria 27147
353 Ga0495671_0251249 3300046692 Bacteria 853
354 Ga0495649_0008654 3300046694 Bacteria 6111
355 Ga0495600_0020410 3300046809 Bacteria 4238
356 Ga0495600_0036363 3300046809 Bacteria 3200
357 Ga0495600_0067052 3300046809 Bacteria 2346
358 Ga0495600_0150174 3300046809 Bacteria 1509
359 Ga0495604_0001970 3300047317 Bacteria 16586
360 Ga0495604_0002487 3300047317 Bacteria 14713
361 Ga0495604_0148075 3300047317 Bacteria 1671
362 Ga0495674_0000007 3300047319 Bacteria 336257
363 Ga0495672_0024890 3300047320 Bacteria 3846
364 Ga0495676_0000263 3300047321 Bacteria 42431
365 Ga0495676_0005813 3300047321 Bacteria 11317
366 Ga0495676_0067438 3300047321 Bacteria 2768
367 Ga0495676_0121108 3300047321 Bacteria 1903
368 Ga0495676_0240941 3300047321 Bacteria 1238
369 Ga0495680_0005894 3300047322 Bacteria 11462
370 Ga0495680_0017444 3300047322 Bacteria 6131
371 Ga0495680_0017984 3300047322 Bacteria 6014
372 Ga0495680_0363471 3300047322 Bacteria 1005
373 Ga0495675_0000696 3300047444 Bacteria 21058
374 Ga0495686_0059362 3300047472 Bacteria 2381
375 Ga0495593_0374673 3300047673 Unclassified 711
376 Ga0495602_0002467 3300048088 Bacteria 18845
377 Ga0495602_0007803 3300048088 Bacteria 11187
378 Ga0495602_0057467 3300048088 Bacteria 3412
379 Ga0495602_0166800 3300048088 Bacteria 1713
380 Ga0495602_0541469 3300048088 Bacteria 808
381 Ga0495602_0878383 3300048088 Unclassified 598
382 Ga0496100_0000004 3300048903 Bacteria 321778
383 Ga0496100_0000032 3300048903 Bacteria 99877
384 Ga0496101_0000007 3300048904 Bacteria 321778
385 Ga0496101_0000012 3300048904 Bacteria 268127
386 Ga0496101_0851716 3300048904 Bacteria 718
387 Ga0496102_0000021 3300048905 Bacteria 246920
388 Ga0496102_0182497 3300048905 Bacteria 1977
389 Ga0496103_0000001 3300048906 Bacteria 643471
390 Ga0496103_0276652 3300048906 Bacteria 1080
391 Ga0496103_0422725 3300048906 Archaea 855
392 Ga0496104_0000002 3300048907 Bacteria 686017
393 Ga0496104_0000003 3300048907 Bacteria 669219
394 Ga0496104_0002073 3300048907 Bacteria 17411
395 Ga0496104_0038835 3300048907 Bacteria 4456
396 Ga0496104_0092123 3300048907 Bacteria 2898
397 Ga0496105_0000001 3300048908 Bacteria 1328178
398 Ga0496105_0000003 3300048908 Bacteria 713251
399 Ga0496105_0009688 3300048908 Bacteria 7541
400 Ga0496105_0066404 3300048908 Bacteria 2978
401 Ga0496105_0098035 3300048908 Bacteria 2421
402 Ga0496106_0000004 3300048909 Bacteria 279896
403 Ga0496106_0000096 3300048909 Bacteria 67122
404 Ga0496106_0000470 3300048909 Bacteria 28737
405 Ga0496107_0000001 3300048910 Bacteria 321778
406 Ga0496107_0000031 3300048910 Bacteria 100522
407 Ga0496107_0854378 3300048910 Unclassified 665
408 Ga0496108_0000002 3300048911 Bacteria 700890
409 Ga0496108_0000012 3300048911 Bacteria 258433
410 Ga0496108_0004840 3300048911 Bacteria 10866
411 Ga0496108_0014174 3300048911 Bacteria 6504
412 Ga0496108_0353449 3300048911 Bacteria 1282
413 Ga0496109_0000001 3300048912 Bacteria 700852
414 Ga0496109_0000106 3300048912 Bacteria 86550
415 Ga0496109_0003327 3300048912 Bacteria 13446
416 Ga0496109_0321988 3300048912 Bacteria 1459
417 Ga0496109_0359242 3300048912 Bacteria 1376
418 Ga0496109_0804154 3300048912 Bacteria 878
419 Ga0496109_1010087 3300048912 Bacteria 769
420 Ga0496110_0014901 3300048913 Bacteria 6461
421 Ga0496110_0029771 3300048913 Bacteria 4703
422 Ga0496110_0103834 3300048913 Bacteria 2549
423 Ga0496110_0112254 3300048913 Bacteria 2450
424 Ga0496110_1434511 3300048913 Bacteria 600
425 Ga0496111_0000001 3300048914 Bacteria 194837
426 Ga0496111_0036458 3300048914 Bacteria 3516
427 Ga0496111_0683239 3300048914 Bacteria 747
428 Ga0496112_0000002 3300048915 Bacteria 782039
429 Ga0496112_0000762 3300048915 Bacteria 22616
430 Ga0496112_0157492 3300048915 Bacteria 2238
431 Ga0496112_1316127 3300048915 Bacteria 638
432 Ga0496113_0000317 3300048916 Bacteria 22880
433 Ga0496113_0032061 3300048916 Bacteria 3817
434 Ga0496113_0170718 3300048916 Bacteria 1722
435 Ga0496113_0430122 3300048916 Bacteria 1060
436 Ga0496113_0727332 3300048916 Bacteria 791
437 Ga0496114_0000080 3300048917 Bacteria 68701
438 Ga0496114_0074984 3300048917 Bacteria 2849
439 Ga0496114_0267643 3300048917 Bacteria 1505
440 Ga0496114_0593221 3300048917 Bacteria 977
441 Ga0496115_0000004 3300048918 Bacteria 319734
442 Ga0496115_0000104 3300048918 Bacteria 79824
443 Ga0496115_0108391 3300048918 Bacteria 2280
444 Ga0496115_0491423 3300048918 Bacteria 987
445 Ga0496116_0000500 3300048919 Bacteria 53809
446 Ga0496117_0058517 3300048920 Bacteria 2668
447 Ga0496117_0454479 3300048920 Unclassified 632
448 Ga0496118_0018764 3300048921 Bacteria 6215
449 Ga0496118_0125217 3300048921 Bacteria 1665
450 Ga0496118_0371483 3300048921 Unclassified 754
451 Ga0496119_0002689 3300048922 Bacteria 19205
452 Ga0496119_0036838 3300048922 Bacteria 3186
453 Ga0496119_0040316 3300048922 Bacteria 2988
454 Ga0496120_0008224 3300048923 Bacteria 7634
455 Ga0496121_0021758 3300048924 Bacteria 6265
456 Ga0496121_0145946 3300048924 Bacteria 1748
457 Ga0496121_0259346 3300048924 Unclassified 1201
458 Ga0496121_0405538 3300048924 Unclassified 891
459 Ga0496124_0019847 3300048927 Bacteria 6236
460 Ga0496125_0038506 3300048928 Bacteria 4137
461 Ga0496125_0100923 3300048928 Bacteria 2126
462 Ga0496125_0122629 3300048928 Bacteria 1850
463 Ga0496125_0150150 3300048928 Bacteria 1602
464 Ga0496126_0045261 3300048929 Bacteria 4046
465 Ga0496126_0329647 3300048929 Bacteria 1253
466 Ga0496126_0380782 3300048929 Bacteria 1148
467 Ga0496126_0486175 3300048929 Bacteria 988
468 Ga0501031_0001419 3300049568 Bacteria 14839
469 Ga0501031_0628606 3300049568 Bacteria 690
470 Ga0501032_0007104 3300049569 Bacteria 8198
471 Ga0501032_0286475 3300049569 Bacteria 1066
472 Ga0501033_0001230 3300049570 Bacteria 22966
473 Ga0501034_0142713 3300049571 Bacteria 2373
474 Ga0501034_1002042 3300049571 Bacteria 719
475 Ga0501036_0002324 3300049572 Bacteria 14869
476 Ga0501037_0009222 3300049573 Bacteria 7233
477 Ga0501038_0003498 3300049574 Bacteria 14625
478 Ga0501039_0117898 3300049575 Bacteria 2079
479 Ga0501039_0225757 3300049575 Bacteria 1472
480 Ga0501040_0088651 3300049576 Bacteria 2149
481 Ga0501040_0282803 3300049576 Bacteria 1185
482 Ga0501041_0464774 3300049577 Bacteria 804
483 Ga0501042_0085688 3300049578 Bacteria 2259
484 Ga0501043_0008013 3300049579 Bacteria 8338
485 Ga0501046_0013436 3300049580 Bacteria 6931
486 Ga0501047_0003396 3300049581 Bacteria 15073
487 Ga0501047_0050207 3300049581 Bacteria 4028
488 Ga0501047_0087996 3300049581 Bacteria 2983
489 Ga0501047_0104712 3300049581 Bacteria 2709
490 Ga0501048_0006756 3300049582 Bacteria 8716
491 Ga0501048_0096970 3300049582 Bacteria 2080
492 Ga0501067_0128593 3300049583 Bacteria 1409
493 Ga0501068_0188838 3300049584 Bacteria 1304
494 Ga0501069_0226497 3300049585 Bacteria 1087
495 Ga0501069_0299059 3300049585 Bacteria 943
496 Ga0501069_0372968 3300049585 Bacteria 842
497 Ga0501070_0008745 3300049586 Bacteria 8563
498 Ga0501070_0034838 3300049586 Bacteria 4207
499 Ga0501070_0369112 3300049586 Bacteria 1163
500 Ga0501070_0407342 3300049586 Bacteria 1099
501 Ga0501070_1444887 3300049586 Unclassified 521
502 Ga0501071_0139456 3300049587 Bacteria 1805
503 Ga0501071_0387094 3300049587 Bacteria 1067
504 Ga0501072_0070995 3300049588 Bacteria 2751
505 Ga0501072_0091493 3300049588 Bacteria 2415
506 Ga0501073_0036554 3300049589 Bacteria 3489
507 Ga0501074_0024156 3300049590 Bacteria 4417
508 Ga0501074_0072580 3300049590 Bacteria 2472
509 Ga0501074_0219286 3300049590 Bacteria 1354
510 Ga0501075_0004075 3300049591 Bacteria 9867
511 Ga0501079_0091109 3300049741 Bacteria 2362
512 Ga0501079_0208730 3300049741 Bacteria 1525
513 Ga0501080_0102745 3300049742 Bacteria 2651
514 Ga0501080_0265644 3300049742 Bacteria 1562
515 Ga0501083_0009230 3300049744 Bacteria 6964
516 Ga0501083_0147141 3300049744 Bacteria 1542
517 Ga0501035_0001056 3300049822 Bacteria 28872
518 Ga0501044_0004552 3300049823 Bacteria 15505
519 Ga0501044_0049531 3300049823 Bacteria 4336
520 Ga0501044_0319919 3300049823 Bacteria 1476
521 nmdc:mga05p37_55968_c1 3300050507 Bacteria 4855
522 nmdc:mga06r32_8550_c1 3300050510 Bacteria 9228
523 nmdc:mga08y16_21284_c2 3300050511 Bacteria 2951
524 nmdc:mga0n895_11734_c1 3300050512 Bacteria 7831
525 nmdc:mga0rr50_87665_c1 3300050513 Bacteria 2416
526 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
527 nmdc:mga0a205_43692_c1 3300050515 Bacteria 4319
528 Ga0495601_0000041 3300053077 Bacteria 79353
529 Ga0495601_0000246 3300053077 Bacteria 28887
530 Ga0495601_0011564 3300053077 Bacteria 5287
531 Ga0495601_0102767 3300053077 Bacteria 1847
532 Ga0495601_0387691 3300053077 Bacteria 906
533 Ga0495612_0000149 3300053078 Bacteria 29381
534 Ga0495612_0004092 3300053078 Bacteria 6043
535 Ga0495612_0028033 3300053078 Bacteria 2266
536 Ga0495612_0200826 3300053078 Bacteria 880
537 Ga0495655_0000012 3300053083 Bacteria 92485
538 Ga0495655_0041556 3300053083 Bacteria 1176
539 Ga0495595_0000001 3300053084 Bacteria 495226
540 Ga0495595_0000652 3300053084 Bacteria 13194
541 Ga0495595_0015879 3300053084 Bacteria 3215
542 Ga0495595_0329613 3300053084 Bacteria 769
543 Ga0495619_0000018 3300053085 Bacteria 209943
544 Ga0495619_0000041 3300053085 Bacteria 112824
545 Ga0495619_0000143 3300053085 Bacteria 53216
546 Ga0495619_0009926 3300053085 Bacteria 5996
547 Ga0495619_0331783 3300053085 Bacteria 1053
548 Ga0500583_0147121 3300053092 Bacteria 1172
549 Ga0500595_087041 3300053119 Bacteria 908
550 Ga0500614_000125 3300053123 Bacteria 18595
551 Ga0500628_000014 3300053129 Bacteria 102838
552 Ga0500658_0147680 3300053134 Bacteria 1058
553 Ga0501084_0612395 3300054114 Bacteria 920
554 Ga0501084_1283715 3300054114 Unclassified 614
555 Ga0501082_0015708 3300060353 Bacteria 6513
556 Ga0501082_0581555 3300060353 Bacteria 980
557 Ga0501082_0881069 3300060353 Bacteria 783

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1919451 Ga0395901_1919451_70_498 129
2 3300006847 Ga0075431_100011442 Ga0075431_1000114426 147
3 3300006871 Ga0075434_100024738 Ga0075434_1000247386 147
4 3300006914 Ga0075436_100560786 Ga0075436_1005607862 147
5 3300007076 Ga0075435_100202618 Ga0075435_1002026183 147
6 3300009094 Ga0111539_10067976 Ga0111539_100679763 147
7 3300009147 Ga0114129_10059127 Ga0114129_100591276 147
8 3300027907 Ga0207428_10062230 Ga0207428_100622302 147
9 3300050507 nmdc:mga05p37_55968_c1 nmdc:mga05p37_55968_c1_3327_3809 147
10 3300050510 nmdc:mga06r32_8550_c1 nmdc:mga06r32_8550_c1_6412_6894 147
11 3300050511 nmdc:mga08y16_21284_c2 nmdc:mga08y16_21284_c2_527_1009 147
12 3300050512 nmdc:mga0n895_11734_c1 nmdc:mga0n895_11734_c1_1054_1536 147
13 3300050513 nmdc:mga0rr50_87665_c1 nmdc:mga0rr50_87665_c1_79_561 147
14 3300050515 nmdc:mga0a205_43692_c1 nmdc:mga0a205_43692_c1_656_1138 147
15 3300005337 Ga0070682_100539397 Ga0070682_1005393971 155
16 3300049586 Ga0501070_0034838 Ga0501070_0034838_401_874 155
17 3300005365 Ga0070688_100043464 Ga0070688_1000434643 156
18 3300005466 Ga0070685_10000092 Ga0070685_100000923 156
19 3300005548 Ga0070665_100603457 Ga0070665_1006034571 156
20 3300005937 Ga0081455_10052747 Ga0081455_100527473 156
21 3300014968 Ga0157379_10165185 Ga0157379_101651852 156
22 3300025900 Ga0207710_10181282 Ga0207710_101812822 156
23 3300025961 Ga0207712_10402858 Ga0207712_104028581 156
24 3300046536 Ga0495587_0003143 Ga0495587_0003143_5735_6208 156
25 3300046642 Ga0495634_0013405 Ga0495634_0013405_4376_4846 156
26 3300046692 Ga0495671_0251249 Ga0495671_0251249_359_829 156
27 3300047321 Ga0495676_0005813 Ga0495676_0005813_5415_5888 156
28 3300048903 Ga0496100_0000032 Ga0496100_0000032_5444_5917 156
29 3300048904 Ga0496101_0000012 Ga0496101_0000012_94124_94597 156
30 3300048905 Ga0496102_0182497 Ga0496102_0182497_389_859 156
31 3300048906 Ga0496103_0276652 Ga0496103_0276652_257_727 156
32 3300048906 Ga0496103_0422725 Ga0496103_0422725_202_672 156
33 3300048909 Ga0496106_0000470 Ga0496106_0000470_22332_22805 156
34 3300048910 Ga0496107_0000031 Ga0496107_0000031_5954_6427 156
35 3300048910 Ga0496107_0854378 Ga0496107_0854378_99_569 156
36 3300048916 Ga0496113_0727332 Ga0496113_0727332_71_544 156
37 3300048917 Ga0496114_0000080 Ga0496114_0000080_36385_36858 156
38 3300048917 Ga0496114_0267643 Ga0496114_0267643_426_899 156
39 3300048918 Ga0496115_0000004 Ga0496115_0000004_93232_93705 156
40 3300048918 Ga0496115_0000104 Ga0496115_0000104_78608_79081 156
41 3300048918 Ga0496115_0491423 Ga0496115_0491423_229_699 156
42 3300048919 Ga0496116_0000500 Ga0496116_0000500_43514_43984 156
43 3300048920 Ga0496117_0058517 Ga0496117_0058517_1891_2361 156
44 3300048920 Ga0496117_0454479 Ga0496117_0454479_78_548 156
45 3300048921 Ga0496118_0018764 Ga0496118_0018764_5351_5821 156
46 3300048921 Ga0496118_0125217 Ga0496118_0125217_902_1372 156
47 3300048921 Ga0496118_0371483 Ga0496118_0371483_162_632 156
48 3300048922 Ga0496119_0036838 Ga0496119_0036838_1590_2060 156
49 3300048922 Ga0496119_0040316 Ga0496119_0040316_882_1352 156
50 3300048923 Ga0496120_0008224 Ga0496120_0008224_2336_2806 156
51 3300048924 Ga0496121_0021758 Ga0496121_0021758_3932_4402 156
52 3300048924 Ga0496121_0259346 Ga0496121_0259346_602_1072 156
53 3300048924 Ga0496121_0405538 Ga0496121_0405538_277_747 156
54 3300048928 Ga0496125_0038506 Ga0496125_0038506_2465_2935 156
55 3300048929 Ga0496126_0329647 Ga0496126_0329647_692_1162 156
56 3300048929 Ga0496126_0380782 Ga0496126_0380782_269_739 156
57 3300049569 Ga0501032_0286475 Ga0501032_0286475_306_776 156
58 3300049581 Ga0501047_0087996 Ga0501047_0087996_563_1033 156
59 3300049586 Ga0501070_0369112 Ga0501070_0369112_48_518 156
60 3300049823 Ga0501044_0319919 Ga0501044_0319919_367_837 156
61 3300053078 Ga0495612_0028033 Ga0495612_0028033_1037_1510 156
62 3300053092 Ga0500583_0147121 Ga0500583_0147121_101_571 156
63 3300053119 Ga0500595_087041 Ga0500595_087041_178_648 156
64 3300053134 Ga0500658_0147680 Ga0500658_0147680_113_583 156
65 3300001977 JGI24746J21847_1000380 JGI24746J21847_10003805 157
66 3300002074 JGI24748J21848_1000396 JGI24748J21848_10003965 157
67 3300002239 JGI24034J26672_10000160 JGI24034J26672_100001605 157
68 3300002244 JGI24742J22300_10009641 JGI24742J22300_100096411 157
69 3300005329 Ga0070683_100010098 Ga0070683_1000100988 157
70 3300005329 Ga0070683_100011494 Ga0070683_1000114943 157
71 3300005329 Ga0070683_100016073 Ga0070683_1000160732 157
72 3300005329 Ga0070683_100027424 Ga0070683_1000274245 157
73 3300005329 Ga0070683_100098772 Ga0070683_1000987723 157
74 3300005329 Ga0070683_100347727 Ga0070683_1003477273 157
75 3300005331 Ga0070670_100226127 Ga0070670_1002261271 157
76 3300005333 Ga0070677_10000075 Ga0070677_100000755 157
77 3300005338 Ga0068868_100003875 Ga0068868_1000038755 157
78 3300005340 Ga0070689_100305118 Ga0070689_1003051182 157
79 3300005344 Ga0070661_100000524 Ga0070661_1000005249 157
80 3300005345 Ga0070692_10117953 Ga0070692_101179531 157
81 3300005347 Ga0070668_100042034 Ga0070668_1000420342 157
82 3300005347 Ga0070668_100305930 Ga0070668_1003059302 157
83 3300005347 Ga0070668_100455260 Ga0070668_1004552602 157
84 3300005354 Ga0070675_100000008 Ga0070675_10000000876 157
85 3300005355 Ga0070671_101256541 Ga0070671_1012565411 157
86 3300005356 Ga0070674_100000047 Ga0070674_10000004758 157
87 3300005356 Ga0070674_100000105 Ga0070674_10000010534 157
88 3300005364 Ga0070673_100115152 Ga0070673_1001151523 157
89 3300005365 Ga0070688_100000151 Ga0070688_1000001513 157
90 3300005366 Ga0070659_100092521 Ga0070659_1000925213 157
91 3300005366 Ga0070659_100822131 Ga0070659_1008221311 157
92 3300005367 Ga0070667_100002491 Ga0070667_1000024916 157
93 3300005367 Ga0070667_100022130 Ga0070667_1000221307 157
94 3300005367 Ga0070667_100459792 Ga0070667_1004597922 157
95 3300005435 Ga0070714_100025876 Ga0070714_1000258765 157
96 3300005436 Ga0070713_100001587 Ga0070713_1000015872 157
97 3300005439 Ga0070711_100010236 Ga0070711_1000102363 157
98 3300005439 Ga0070711_100035451 Ga0070711_1000354514 157
99 3300005455 Ga0070663_100009347 Ga0070663_1000093471 157
100 3300005455 Ga0070663_100846578 Ga0070663_1008465781 157
101 3300005456 Ga0070678_100013711 Ga0070678_1000137113 157
102 3300005456 Ga0070678_100198218 Ga0070678_1001982182 157
103 3300005458 Ga0070681_10064130 Ga0070681_100641301 157
104 3300005466 Ga0070685_10002231 Ga0070685_100022313 157
105 3300005530 Ga0070679_100000804 Ga0070679_10000080420 157
106 3300005530 Ga0070679_100020824 Ga0070679_1000208247 157
107 3300005535 Ga0070684_100062642 Ga0070684_1000626423 157
108 3300005535 Ga0070684_100146206 Ga0070684_1001462063 157
109 3300005535 Ga0070684_100476029 Ga0070684_1004760292 157
110 3300005535 Ga0070684_101453701 Ga0070684_1014537011 157
111 3300005539 Ga0068853_100014352 Ga0068853_1000143521 157
112 3300005539 Ga0068853_100232363 Ga0068853_1002323633 157
113 3300005539 Ga0068853_100376159 Ga0068853_1003761592 157
114 3300005543 Ga0070672_100001255 Ga0070672_10000125518 157
115 3300005544 Ga0070686_100296421 Ga0070686_1002964211 157
116 3300005547 Ga0070693_100002159 Ga0070693_1000021596 157
117 3300005548 Ga0070665_100000128 Ga0070665_10000012810 157
118 3300005548 Ga0070665_100002491 Ga0070665_1000024913 157
119 3300005548 Ga0070665_100157060 Ga0070665_1001570602 157
120 3300005548 Ga0070665_100225941 Ga0070665_1002259412 157
121 3300005548 Ga0070665_100420946 Ga0070665_1004209462 157
122 3300005549 Ga0070704_100368844 Ga0070704_1003688441 157
123 3300005549 Ga0070704_101014756 Ga0070704_1010147561 157
124 3300005563 Ga0068855_100145972 Ga0068855_1001459723 157
125 3300005563 Ga0068855_100434410 Ga0068855_1004344103 157
126 3300005564 Ga0070664_100094706 Ga0070664_1000947063 157
127 3300005564 Ga0070664_100115747 Ga0070664_1001157473 157
128 3300005578 Ga0068854_100000123 Ga0068854_1000001237 157
129 3300005614 Ga0068856_100019149 Ga0068856_1000191498 157
130 3300005614 Ga0068856_100206002 Ga0068856_1002060023 157
131 3300005614 Ga0068856_100315286 Ga0068856_1003152862 157
132 3300005614 Ga0068856_100851730 Ga0068856_1008517301 157
133 3300005614 Ga0068856_101621381 Ga0068856_1016213812 157
134 3300005616 Ga0068852_100000050 Ga0068852_1000000508 157
135 3300005616 Ga0068852_100787226 Ga0068852_1007872262 157
136 3300005718 Ga0068866_10000006 Ga0068866_1000000659 157
137 3300005718 Ga0068866_10000124 Ga0068866_1000012431 157
138 3300005718 Ga0068866_10361900 Ga0068866_103619002 157
139 3300005834 Ga0068851_10001237 Ga0068851_100012373 157
140 3300005841 Ga0068863_100000039 Ga0068863_10000003949 157
141 3300005841 Ga0068863_100003181 Ga0068863_10000318112 157
142 3300005842 Ga0068858_100000354 Ga0068858_10000035413 157
143 3300005842 Ga0068858_100001452 Ga0068858_1000014526 157
144 3300005842 Ga0068858_100233866 Ga0068858_1002338663 157
145 3300005842 Ga0068858_100452807 Ga0068858_1004528073 157
146 3300005842 Ga0068858_101140294 Ga0068858_1011402941 157
147 3300005844 Ga0068862_100013835 Ga0068862_1000138356 157
148 3300006038 Ga0075365_10266720 Ga0075365_102667202 157
149 3300006163 Ga0070715_10000003 Ga0070715_10000003109 157
150 3300006173 Ga0070716_100182683 Ga0070716_1001826833 157
151 3300006175 Ga0070712_100019703 Ga0070712_1000197033 157
152 3300006175 Ga0070712_100544160 Ga0070712_1005441602 157
153 3300006237 Ga0097621_101284342 Ga0097621_1012843422 157
154 3300006852 Ga0075433_10000875 Ga0075433_100008757 157
155 3300006914 Ga0075436_100655048 Ga0075436_1006550481 157
156 3300009093 Ga0105240_10339563 Ga0105240_103395633 157
157 3300009093 Ga0105240_10852643 Ga0105240_108526432 157
158 3300009098 Ga0105245_10000012 Ga0105245_10000012170 157
159 3300009098 Ga0105245_10000067 Ga0105245_1000006797 157
160 3300009098 Ga0105245_10000246 Ga0105245_1000024638 157
161 3300009098 Ga0105245_10009989 Ga0105245_100099897 157
162 3300009098 Ga0105245_11798275 Ga0105245_117982751 157
163 3300009101 Ga0105247_10197438 Ga0105247_101974383 157
164 3300009148 Ga0105243_10009568 Ga0105243_100095683 157
165 3300009148 Ga0105243_10091763 Ga0105243_100917633 157
166 3300009174 Ga0105241_10248208 Ga0105241_102482082 157
167 3300009174 Ga0105241_10256321 Ga0105241_102563211 157
168 3300009176 Ga0105242_10000010 Ga0105242_1000001080 157
169 3300009176 Ga0105242_10149891 Ga0105242_101498912 157
170 3300009177 Ga0105248_10000307 Ga0105248_100003073 157
171 3300009177 Ga0105248_10260295 Ga0105248_102602953 157
172 3300009177 Ga0105248_12421266 Ga0105248_124212661 157
173 3300009545 Ga0105237_10169985 Ga0105237_101699853 157
174 3300009551 Ga0105238_10000014 Ga0105238_1000001453 157
175 3300009551 Ga0105238_11487729 Ga0105238_114877291 157
176 3300009553 Ga0105249_10000159 Ga0105249_1000015980 157
177 3300009553 Ga0105249_10070387 Ga0105249_100703873 157
178 3300010159 Ga0099796_10357347 Ga0099796_103573471 157
179 3300010375 Ga0105239_10232460 Ga0105239_102324603 157
180 3300013102 Ga0157371_10002341 Ga0157371_1000234117 157
181 3300013104 Ga0157370_10040358 Ga0157370_100403585 157
182 3300013104 Ga0157370_10316975 Ga0157370_103169753 157
183 3300013105 Ga0157369_10000222 Ga0157369_1000022237 157
184 3300013296 Ga0157374_10000281 Ga0157374_1000028134 157
185 3300013296 Ga0157374_11406981 Ga0157374_114069811 157
186 3300013297 Ga0157378_10009857 Ga0157378_100098573 157
187 3300013306 Ga0163162_10139140 Ga0163162_101391403 157
188 3300013306 Ga0163162_10641534 Ga0163162_106415341 157
189 3300013307 Ga0157372_10006714 Ga0157372_100067147 157
190 3300013308 Ga0157375_10000095 Ga0157375_100000953 157
191 3300013308 Ga0157375_10035586 Ga0157375_100355863 157
192 3300013308 Ga0157375_10071355 Ga0157375_100713553 157
193 3300013308 Ga0157375_11835863 Ga0157375_118358631 157
194 3300013308 Ga0157375_11902153 Ga0157375_119021532 157
195 3300014325 Ga0163163_10758016 Ga0163163_107580162 157
196 3300014325 Ga0163163_11356208 Ga0163163_113562081 157
197 3300014325 Ga0163163_11456178 Ga0163163_114561782 157
198 3300014326 Ga0157380_10000594 Ga0157380_1000059418 157
199 3300014326 Ga0157380_12078593 Ga0157380_120785932 157
200 3300014745 Ga0157377_10334854 Ga0157377_103348542 157
201 3300014968 Ga0157379_10013677 Ga0157379_100136773 157
202 3300014969 Ga0157376_10202790 Ga0157376_102027901 157
203 3300014969 Ga0157376_10259601 Ga0157376_102596013 157
204 3300014969 Ga0157376_10544287 Ga0157376_105442872 157
205 3300017792 Ga0163161_10000140 Ga0163161_1000014011 157
206 3300017792 Ga0163161_10072390 Ga0163161_100723903 157
207 3300020070 Ga0206356_11783605 Ga0206356_117836051 157
208 3300020082 Ga0206353_10708015 Ga0206353_107080153 157
209 3300025893 Ga0207682_10000217 Ga0207682_1000021720 157
210 3300025899 Ga0207642_10000001 Ga0207642_10000001144 157
211 3300025899 Ga0207642_10000003 Ga0207642_10000003144 157
212 3300025899 Ga0207642_10000004 Ga0207642_10000004144 157
213 3300025899 Ga0207642_10000152 Ga0207642_100001528 157
214 3300025899 Ga0207642_10262102 Ga0207642_102621022 157
215 3300025899 Ga0207642_10407673 Ga0207642_104076732 157
216 3300025903 Ga0207680_10055188 Ga0207680_100551884 157
217 3300025905 Ga0207685_10000003 Ga0207685_10000003109 157
218 3300025909 Ga0207705_10102922 Ga0207705_101029223 157
219 3300025911 Ga0207654_10106448 Ga0207654_101064482 157
220 3300025912 Ga0207707_10098235 Ga0207707_100982353 157
221 3300025915 Ga0207693_10023691 Ga0207693_100236914 157
222 3300025915 Ga0207693_10772702 Ga0207693_107727021 157
223 3300025916 Ga0207663_10005102 Ga0207663_100051023 157
224 3300025916 Ga0207663_10149444 Ga0207663_101494443 157
225 3300025919 Ga0207657_10875486 Ga0207657_108754861 157
226 3300025920 Ga0207649_10000610 Ga0207649_100006103 157
227 3300025921 Ga0207652_10000119 Ga0207652_1000011914 157
228 3300025921 Ga0207652_10000332 Ga0207652_1000033232 157
229 3300025924 Ga0207694_10000008 Ga0207694_10000008185 157
230 3300025925 Ga0207650_10448111 Ga0207650_104481112 157
231 3300025926 Ga0207659_10000049 Ga0207659_1000004924 157
232 3300025927 Ga0207687_10000011 Ga0207687_10000011223 157
233 3300025927 Ga0207687_10000012 Ga0207687_10000012259 157
234 3300025927 Ga0207687_10000503 Ga0207687_1000050323 157
235 3300025927 Ga0207687_10004483 Ga0207687_100044834 157
236 3300025928 Ga0207700_10000016 Ga0207700_10000016199 157
237 3300025929 Ga0207664_10012655 Ga0207664_100126553 157
238 3300025932 Ga0207690_10002643 Ga0207690_100026434 157
239 3300025932 Ga0207690_10062808 Ga0207690_100628083 157
240 3300025932 Ga0207690_10561362 Ga0207690_105613622 157
241 3300025934 Ga0207686_10000227 Ga0207686_1000022714 157
242 3300025934 Ga0207686_10043634 Ga0207686_100436343 157
243 3300025935 Ga0207709_10030724 Ga0207709_100307243 157
244 3300025935 Ga0207709_10078365 Ga0207709_100783652 157
245 3300025936 Ga0207670_10490313 Ga0207670_104903132 157
246 3300025936 Ga0207670_10969441 Ga0207670_109694411 157
247 3300025937 Ga0207669_10000002 Ga0207669_10000002354 157
248 3300025937 Ga0207669_10000765 Ga0207669_100007653 157
249 3300025939 Ga0207665_10116043 Ga0207665_101160433 157
250 3300025940 Ga0207691_10001495 Ga0207691_100014957 157
251 3300025941 Ga0207711_10000024 Ga0207711_1000002443 157
252 3300025944 Ga0207661_10001860 Ga0207661_100018608 157
253 3300025944 Ga0207661_10009394 Ga0207661_100093946 157
254 3300025944 Ga0207661_10037300 Ga0207661_100373003 157
255 3300025944 Ga0207661_10082420 Ga0207661_100824203 157
256 3300025944 Ga0207661_10230695 Ga0207661_102306953 157
257 3300025944 Ga0207661_10772679 Ga0207661_107726792 157
258 3300025945 Ga0207679_10078469 Ga0207679_100784693 157
259 3300025945 Ga0207679_10134505 Ga0207679_101345053 157
260 3300025961 Ga0207712_10000003 Ga0207712_10000003202 157
261 3300025961 Ga0207712_10003211 Ga0207712_100032113 157
262 3300025972 Ga0207668_10007500 Ga0207668_100075006 157
263 3300025972 Ga0207668_10143184 Ga0207668_101431842 157
264 3300025972 Ga0207668_10278908 Ga0207668_102789082 157
265 3300025972 Ga0207668_10503023 Ga0207668_105030233 157
266 3300025981 Ga0207640_10000040 Ga0207640_1000004094 157
267 3300025981 Ga0207640_10045984 Ga0207640_100459843 157
268 3300025986 Ga0207658_10000871 Ga0207658_1000087127 157
269 3300025986 Ga0207658_10014542 Ga0207658_100145426 157
270 3300025986 Ga0207658_10724983 Ga0207658_107249832 157
271 3300026023 Ga0207677_10000787 Ga0207677_1000078715 157
272 3300026023 Ga0207677_10002766 Ga0207677_100027665 157
273 3300026035 Ga0207703_10000028 Ga0207703_1000002859 157
274 3300026035 Ga0207703_10000185 Ga0207703_1000018552 157
275 3300026035 Ga0207703_10438661 Ga0207703_104386612 157
276 3300026041 Ga0207639_10009852 Ga0207639_100098522 157
277 3300026041 Ga0207639_10265008 Ga0207639_102650082 157
278 3300026041 Ga0207639_10351258 Ga0207639_103512581 157
279 3300026041 Ga0207639_10361023 Ga0207639_103610233 157
280 3300026067 Ga0207678_10000953 Ga0207678_1000095317 157
281 3300026067 Ga0207678_10848147 Ga0207678_108481472 157
282 3300026075 Ga0207708_10765206 Ga0207708_107652062 157
283 3300026075 Ga0207708_10960104 Ga0207708_109601042 157
284 3300026078 Ga0207702_10001168 Ga0207702_100011688 157
285 3300026078 Ga0207702_10008030 Ga0207702_100080302 157
286 3300026078 Ga0207702_10040826 Ga0207702_100408263 157
287 3300026078 Ga0207702_10722281 Ga0207702_107222812 157
288 3300026078 Ga0207702_11632617 Ga0207702_116326171 157
289 3300026088 Ga0207641_10000072 Ga0207641_1000007237 157
290 3300026116 Ga0207674_10162179 Ga0207674_101621792 157
291 3300026121 Ga0207683_10155832 Ga0207683_101558323 157
292 3300026121 Ga0207683_10348842 Ga0207683_103488421 157
293 3300026121 Ga0207683_10370228 Ga0207683_103702283 157
294 3300026142 Ga0207698_10000009 Ga0207698_10000009119 157
295 3300026142 Ga0207698_10608688 Ga0207698_106086881 157
296 3300028379 Ga0268266_10000023 Ga0268266_1000002390 157
297 3300028379 Ga0268266_10001616 Ga0268266_100016165 157
298 3300028379 Ga0268266_10001763 Ga0268266_100017635 157
299 3300028379 Ga0268266_10225668 Ga0268266_102256683 157
300 3300028379 Ga0268266_10439078 Ga0268266_104390782 157
301 3300028380 Ga0268265_10008225 Ga0268265_100082256 157
302 3300028381 Ga0268264_10264461 Ga0268264_102644613 157
303 3300028556 Ga0265337_1000041 Ga0265337_100004149 157
304 3300028558 Ga0265326_10000015 Ga0265326_10000015122 157
305 3300028563 Ga0265319_1063361 Ga0265319_10633612 157
306 3300028653 Ga0265323_10079655 Ga0265323_100796552 157
307 3300028654 Ga0265322_10000003 Ga0265322_1000000357 157
308 3300028666 Ga0265336_10005910 Ga0265336_100059104 157
309 3300029957 Ga0265324_10000907 Ga0265324_100009078 157
310 3300031238 Ga0265332_10126602 Ga0265332_101266021 157
311 3300031239 Ga0265328_10001369 Ga0265328_100013696 157
312 3300031240 Ga0265320_10000001 Ga0265320_1000000157 157
313 3300031249 Ga0265339_10017679 Ga0265339_100176793 157
314 3300031250 Ga0265331_10009641 Ga0265331_100096414 157
315 3300031251 Ga0265327_10000003 Ga0265327_1000000357 157
316 3300031344 Ga0265316_10024452 Ga0265316_100244523 157
317 3300031711 Ga0265314_10020220 Ga0265314_100202205 157
318 3300032126 Ga0307415_100093025 Ga0307415_1000930253 157
319 3300036401 Ga0373937_0023647 Ga0373937_0023647_3091_3564 157
320 3300036401 Ga0373937_0070670 Ga0373937_0070670_1424_1897 157
321 3300038443 Ga0395901_0848828 Ga0395901_0848828_16_489 157
322 3300041460 Ga0451802_0438050 Ga0451802_0438050_155_631 157
323 3300041486 Ga0451807_1796160 Ga0451807_1796160_70_543 157
324 3300041486 Ga0451807_2307049 Ga0451807_2307049_154_630 157
325 3300041491 Ga0451833_0634948 Ga0451833_0634948_985_1461 157
326 3300041496 Ga0451839_0844376 Ga0451839_0844376_296_772 157
327 3300041512 Ga0451853_3731523 Ga0451853_3731523_166_639 157
328 3300044694 Ga0466963_0000002 Ga0466963_0000002_54976_55449 157
329 3300044842 Ga0466957_0016522 Ga0466957_0016522_1793_2269 157
330 3300044842 Ga0466957_0155944 Ga0466957_0155944_821_1294 157
331 3300045836 Ga0466958_0021909 Ga0466958_0021909_1097_1570 157
332 3300045976 Ga0466967_0000020 Ga0466967_0000020_24340_24813 157
333 3300046454 Ga0495592_0000999 Ga0495592_0000999_11995_12468 157
334 3300046454 Ga0495592_0387725 Ga0495592_0387725_217_690 157
335 3300046455 Ga0495603_0000057 Ga0495603_0000057_40446_40919 157
336 3300046455 Ga0495603_0002491 Ga0495603_0002491_946_1419 157
337 3300046455 Ga0495603_0003192 Ga0495603_0003192_7137_7610 157
338 3300046459 Ga0495629_0000028 Ga0495629_0000028_111556_112029 157
339 3300046459 Ga0495629_0004331 Ga0495629_0004331_2400_2876 157
340 3300046459 Ga0495629_0389110 Ga0495629_0389110_108_581 157
341 3300046459 Ga0495629_0463522 Ga0495629_0463522_338_811 157
342 3300046461 Ga0495641_0001934 Ga0495641_0001934_566_1039 157
343 3300046461 Ga0495641_0067435 Ga0495641_0067435_1086_1559 157
344 3300046462 Ga0495651_0146464 Ga0495651_0146464_550_1023 157
345 3300046463 Ga0495653_0096141 Ga0495653_0096141_481_954 157
346 3300046463 Ga0495653_0186428 Ga0495653_0186428_496_969 157
347 3300046463 Ga0495653_0223183 Ga0495653_0223183_188_661 157
348 3300046473 Ga0495582_0000048 Ga0495582_0000048_58255_58728 157
349 3300046476 Ga0495662_0000659 Ga0495662_0000659_7537_8010 157
350 3300046476 Ga0495662_0018027 Ga0495662_0018027_2882_3355 157
351 3300046476 Ga0495662_0053835 Ga0495662_0053835_1010_1483 157
352 3300046477 Ga0495664_0343379 Ga0495664_0343379_159_632 157
353 3300046507 Ga0495606_0000294 Ga0495606_0000294_73975_74448 157
354 3300046511 Ga0495608_0000001 Ga0495608_0000001_366036_366509 157
355 3300046511 Ga0495608_0004024 Ga0495608_0004024_2356_2829 157
356 3300046511 Ga0495608_0119306 Ga0495608_0119306_483_956 157
357 3300046516 Ga0495628_0001728 Ga0495628_0001728_17069_17545 157
358 3300046516 Ga0495628_0011273 Ga0495628_0011273_6793_7266 157
359 3300046516 Ga0495628_0011510 Ga0495628_0011510_2742_3215 157
360 3300046516 Ga0495628_0232549 Ga0495628_0232549_712_1185 157
361 3300046516 Ga0495628_0673367 Ga0495628_0673367_70_543 157
362 3300046517 Ga0495630_0000165 Ga0495630_0000165_43144_43617 157
363 3300046517 Ga0495630_0037128 Ga0495630_0037128_2477_2950 157
364 3300046517 Ga0495630_0485403 Ga0495630_0485403_422_895 157
365 3300046520 Ga0495637_0262121 Ga0495637_0262121_59_532 157
366 3300046523 Ga0495644_0001304 Ga0495644_0001304_9560_10036 157
367 3300046529 Ga0495652_0047825 Ga0495652_0047825_402_875 157
368 3300046529 Ga0495652_0131103 Ga0495652_0131103_94_567 157
369 3300046533 Ga0495640_0040475 Ga0495640_0040475_694_1167 157
370 3300046533 Ga0495640_0050074 Ga0495640_0050074_1398_1871 157
371 3300046535 Ga0495586_0032837 Ga0495586_0032837_2234_2707 157
372 3300046543 Ga0495645_0001401 Ga0495645_0001401_6942_7415 157
373 3300046543 Ga0495645_0017457 Ga0495645_0017457_2083_2556 157
374 3300046559 Ga0495667_0000057 Ga0495667_0000057_16307_16780 157
375 3300046559 Ga0495667_0289804 Ga0495667_0289804_272_745 157
376 3300046616 Ga0495668_0277651 Ga0495668_0277651_101_574 157
377 3300046642 Ga0495634_0000555 Ga0495634_0000555_14915_15388 157
378 3300046642 Ga0495634_0055729 Ga0495634_0055729_1869_2342 157
379 3300046674 Ga0495588_0000195 Ga0495588_0000195_5745_6218 157
380 3300046675 Ga0495657_0000002 Ga0495657_0000002_366716_367189 157
381 3300046675 Ga0495657_0079405 Ga0495657_0079405_944_1417 157
382 3300046675 Ga0495657_0096415 Ga0495657_0096415_849_1322 157
383 3300046678 Ga0495599_0008656 Ga0495599_0008656_1206_1679 157
384 3300046679 Ga0495623_0208494 Ga0495623_0208494_80_553 157
385 3300046679 Ga0495623_0528165 Ga0495623_0528165_29_505 157
386 3300046679 Ga0495623_0570039 Ga0495623_0570039_85_558 157
387 3300046681 Ga0495647_0000020 Ga0495647_0000020_69569_70042 157
388 3300046681 Ga0495647_0002424 Ga0495647_0002424_3943_4416 157
389 3300046681 Ga0495647_0003249 Ga0495647_0003249_4304_4777 157
390 3300046683 Ga0495658_0000031 Ga0495658_0000031_58218_58691 157
391 3300046684 Ga0495669_0000064 Ga0495669_0000064_49621_50094 157
392 3300046684 Ga0495669_0186990 Ga0495669_0186990_25_498 157
393 3300046684 Ga0495669_0210253 Ga0495669_0210253_10_486 157
394 3300046689 Ga0495613_0000003 Ga0495613_0000003_248319_248792 157
395 3300046689 Ga0495613_0000500 Ga0495613_0000500_10623_11096 157
396 3300046689 Ga0495613_0185425 Ga0495613_0185425_201_674 157
397 3300046690 Ga0495624_0000087 Ga0495624_0000087_7293_7766 157
398 3300046690 Ga0495624_0000652 Ga0495624_0000652_18312_18785 157
399 3300046694 Ga0495649_0008654 Ga0495649_0008654_3895_4368 157
400 3300046809 Ga0495600_0020410 Ga0495600_0020410_1212_1685 157
401 3300046809 Ga0495600_0036363 Ga0495600_0036363_782_1255 157
402 3300046809 Ga0495600_0067052 Ga0495600_0067052_17_490 157
403 3300046809 Ga0495600_0150174 Ga0495600_0150174_239_712 157
404 3300047317 Ga0495604_0001970 Ga0495604_0001970_14976_15449 157
405 3300047317 Ga0495604_0002487 Ga0495604_0002487_11727_12200 157
406 3300047317 Ga0495604_0148075 Ga0495604_0148075_833_1306 157
407 3300047319 Ga0495674_0000007 Ga0495674_0000007_248017_248490 157
408 3300047320 Ga0495672_0024890 Ga0495672_0024890_2836_3312 157
409 3300047321 Ga0495676_0000263 Ga0495676_0000263_16801_17274 157
410 3300047321 Ga0495676_0067438 Ga0495676_0067438_1199_1675 157
411 3300047321 Ga0495676_0121108 Ga0495676_0121108_692_1165 157
412 3300047321 Ga0495676_0240941 Ga0495676_0240941_638_1111 157
413 3300047322 Ga0495680_0005894 Ga0495680_0005894_7754_8227 157
414 3300047322 Ga0495680_0017444 Ga0495680_0017444_2079_2552 157
415 3300047322 Ga0495680_0017984 Ga0495680_0017984_4694_5170 157
416 3300047322 Ga0495680_0363471 Ga0495680_0363471_242_715 157
417 3300047444 Ga0495675_0000696 Ga0495675_0000696_14817_15290 157
418 3300047472 Ga0495686_0059362 Ga0495686_0059362_1062_1535 157
419 3300047673 Ga0495593_0374673 Ga0495593_0374673_82_555 157
420 3300048088 Ga0495602_0002467 Ga0495602_0002467_17227_17703 157
421 3300048088 Ga0495602_0007803 Ga0495602_0007803_1097_1570 157
422 3300048088 Ga0495602_0057467 Ga0495602_0057467_739_1212 157
423 3300048088 Ga0495602_0166800 Ga0495602_0166800_191_664 157
424 3300048088 Ga0495602_0541469 Ga0495602_0541469_62_535 157
425 3300048088 Ga0495602_0878383 Ga0495602_0878383_39_512 157
426 3300048903 Ga0496100_0000004 Ga0496100_0000004_129037_129510 157
427 3300048904 Ga0496101_0000007 Ga0496101_0000007_129037_129510 157
428 3300048904 Ga0496101_0851716 Ga0496101_0851716_25_507 157
429 3300048905 Ga0496102_0000021 Ga0496102_0000021_239158_239634 157
430 3300048906 Ga0496103_0000001 Ga0496103_0000001_356273_356749 157
431 3300048907 Ga0496104_0000002 Ga0496104_0000002_302527_303003 157
432 3300048907 Ga0496104_0000003 Ga0496104_0000003_482853_483326 157
433 3300048907 Ga0496104_0002073 Ga0496104_0002073_11332_11805 157
434 3300048907 Ga0496104_0038835 Ga0496104_0038835_1986_2468 157
435 3300048907 Ga0496104_0092123 Ga0496104_0092123_475_948 157
436 3300048908 Ga0496105_0000001 Ga0496105_0000001_1025176_1025652 157
437 3300048908 Ga0496105_0000003 Ga0496105_0000003_702795_703268 157
438 3300048908 Ga0496105_0009688 Ga0496105_0009688_5050_5523 157
439 3300048908 Ga0496105_0066404 Ga0496105_0066404_1502_1984 157
440 3300048908 Ga0496105_0098035 Ga0496105_0098035_894_1367 157
441 3300048909 Ga0496106_0000004 Ga0496106_0000004_90451_90924 157
442 3300048909 Ga0496106_0000096 Ga0496106_0000096_14993_15466 157
443 3300048910 Ga0496107_0000001 Ga0496107_0000001_129037_129510 157
444 3300048911 Ga0496108_0000002 Ga0496108_0000002_549932_550405 157
445 3300048911 Ga0496108_0000012 Ga0496108_0000012_97470_97946 157
446 3300048911 Ga0496108_0004840 Ga0496108_0004840_7321_7794 157
447 3300048911 Ga0496108_0014174 Ga0496108_0014174_5279_5752 157
448 3300048911 Ga0496108_0353449 Ga0496108_0353449_796_1269 157
449 3300048912 Ga0496109_0000001 Ga0496109_0000001_549894_550367 157
450 3300048912 Ga0496109_0000106 Ga0496109_0000106_6949_7422 157
451 3300048912 Ga0496109_0003327 Ga0496109_0003327_4588_5064 157
452 3300048912 Ga0496109_0321988 Ga0496109_0321988_335_808 157
453 3300048912 Ga0496109_0359242 Ga0496109_0359242_434_907 157
454 3300048912 Ga0496109_0804154 Ga0496109_0804154_71_553 157
455 3300048912 Ga0496109_1010087 Ga0496109_1010087_195_668 157
456 3300048913 Ga0496110_0014901 Ga0496110_0014901_5336_5809 157
457 3300048913 Ga0496110_0029771 Ga0496110_0029771_671_1144 157
458 3300048913 Ga0496110_0103834 Ga0496110_0103834_846_1319 157
459 3300048913 Ga0496110_0112254 Ga0496110_0112254_1562_2035 157
460 3300048913 Ga0496110_1434511 Ga0496110_1434511_23_496 157
461 3300048914 Ga0496111_0000001 Ga0496111_0000001_88224_88697 157
462 3300048914 Ga0496111_0036458 Ga0496111_0036458_1163_1636 157
463 3300048914 Ga0496111_0683239 Ga0496111_0683239_231_704 157
464 3300048915 Ga0496112_0000002 Ga0496112_0000002_386498_386983 157
465 3300048915 Ga0496112_0000762 Ga0496112_0000762_860_1333 157
466 3300048915 Ga0496112_0157492 Ga0496112_0157492_1015_1488 157
467 3300048915 Ga0496112_1316127 Ga0496112_1316127_47_520 157
468 3300048916 Ga0496113_0000317 Ga0496113_0000317_16726_17199 157
469 3300048916 Ga0496113_0032061 Ga0496113_0032061_198_674 157
470 3300048916 Ga0496113_0170718 Ga0496113_0170718_339_812 157
471 3300048916 Ga0496113_0430122 Ga0496113_0430122_347_820 157
472 3300048917 Ga0496114_0074984 Ga0496114_0074984_61_534 157
473 3300048917 Ga0496114_0593221 Ga0496114_0593221_210_683 157
474 3300048918 Ga0496115_0108391 Ga0496115_0108391_788_1261 157
475 3300048922 Ga0496119_0002689 Ga0496119_0002689_1133_1615 157
476 3300048924 Ga0496121_0145946 Ga0496121_0145946_952_1434 157
477 3300048927 Ga0496124_0019847 Ga0496124_0019847_2335_2817 157
478 3300048928 Ga0496125_0100923 Ga0496125_0100923_1502_1975 157
479 3300048928 Ga0496125_0122629 Ga0496125_0122629_1117_1599 157
480 3300048928 Ga0496125_0150150 Ga0496125_0150150_733_1215 157
481 3300048929 Ga0496126_0045261 Ga0496126_0045261_727_1209 157
482 3300048929 Ga0496126_0486175 Ga0496126_0486175_226_720 157
483 3300049568 Ga0501031_0001419 Ga0501031_0001419_5969_6451 157
484 3300049568 Ga0501031_0628606 Ga0501031_0628606_201_674 157
485 3300049569 Ga0501032_0007104 Ga0501032_0007104_1776_2258 157
486 3300049570 Ga0501033_0001230 Ga0501033_0001230_822_1304 157
487 3300049571 Ga0501034_0142713 Ga0501034_0142713_198_680 157
488 3300049571 Ga0501034_1002042 Ga0501034_1002042_130_612 157
489 3300049572 Ga0501036_0002324 Ga0501036_0002324_6010_6492 157
490 3300049573 Ga0501037_0009222 Ga0501037_0009222_6290_6772 157
491 3300049574 Ga0501038_0003498 Ga0501038_0003498_5746_6228 157
492 3300049575 Ga0501039_0117898 Ga0501039_0117898_1082_1564 157
493 3300049575 Ga0501039_0225757 Ga0501039_0225757_989_1462 157
494 3300049576 Ga0501040_0088651 Ga0501040_0088651_1343_1825 157
495 3300049576 Ga0501040_0282803 Ga0501040_0282803_52_525 157
496 3300049577 Ga0501041_0464774 Ga0501041_0464774_275_748 157
497 3300049578 Ga0501042_0085688 Ga0501042_0085688_519_1001 157
498 3300049579 Ga0501043_0008013 Ga0501043_0008013_1635_2117 157
499 3300049580 Ga0501046_0013436 Ga0501046_0013436_5808_6290 157
500 3300049581 Ga0501047_0003396 Ga0501047_0003396_5985_6467 157
501 3300049581 Ga0501047_0050207 Ga0501047_0050207_1150_1632 157
502 3300049581 Ga0501047_0104712 Ga0501047_0104712_1470_1964 157
503 3300049582 Ga0501048_0006756 Ga0501048_0006756_6596_7078 157
504 3300049582 Ga0501048_0096970 Ga0501048_0096970_1298_1792 157
505 3300049583 Ga0501067_0128593 Ga0501067_0128593_783_1265 157
506 3300049584 Ga0501068_0188838 Ga0501068_0188838_529_1011 157
507 3300049585 Ga0501069_0226497 Ga0501069_0226497_320_814 157
508 3300049585 Ga0501069_0299059 Ga0501069_0299059_33_515 157
509 3300049585 Ga0501069_0372968 Ga0501069_0372968_117_611 157
510 3300049586 Ga0501070_0008745 Ga0501070_0008745_6429_6911 157
511 3300049586 Ga0501070_0407342 Ga0501070_0407342_421_903 157
512 3300049586 Ga0501070_1444887 Ga0501070_1444887_14_508 157
513 3300049587 Ga0501071_0139456 Ga0501071_0139456_564_1058 157
514 3300049587 Ga0501071_0387094 Ga0501071_0387094_191_676 157
515 3300049588 Ga0501072_0070995 Ga0501072_0070995_912_1394 157
516 3300049588 Ga0501072_0091493 Ga0501072_0091493_1789_2262 157
517 3300049589 Ga0501073_0036554 Ga0501073_0036554_2508_2990 157
518 3300049590 Ga0501074_0024156 Ga0501074_0024156_3680_4162 157
519 3300049590 Ga0501074_0072580 Ga0501074_0072580_1533_2015 157
520 3300049590 Ga0501074_0219286 Ga0501074_0219286_714_1208 157
521 3300049591 Ga0501075_0004075 Ga0501075_0004075_3284_3760 157
522 3300049741 Ga0501079_0091109 Ga0501079_0091109_1346_1828 157
523 3300049741 Ga0501079_0208730 Ga0501079_0208730_958_1452 157
524 3300049742 Ga0501080_0102745 Ga0501080_0102745_539_1021 157
525 3300049742 Ga0501080_0265644 Ga0501080_0265644_511_1005 157
526 3300049744 Ga0501083_0009230 Ga0501083_0009230_526_1008 157
527 3300049744 Ga0501083_0147141 Ga0501083_0147141_306_800 157
528 3300049822 Ga0501035_0001056 Ga0501035_0001056_6485_6967 157
529 3300049823 Ga0501044_0004552 Ga0501044_0004552_6556_7038 157
530 3300049823 Ga0501044_0049531 Ga0501044_0049531_1486_1980 157
531 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_53807_54280 157
532 3300053077 Ga0495601_0000041 Ga0495601_0000041_25352_25825 157
533 3300053077 Ga0495601_0000246 Ga0495601_0000246_106_579 157
534 3300053077 Ga0495601_0011564 Ga0495601_0011564_4674_5147 157
535 3300053077 Ga0495601_0102767 Ga0495601_0102767_1013_1486 157
536 3300053077 Ga0495601_0387691 Ga0495601_0387691_181_654 157
537 3300053078 Ga0495612_0000149 Ga0495612_0000149_7926_8399 157
538 3300053078 Ga0495612_0004092 Ga0495612_0004092_2246_2719 157
539 3300053078 Ga0495612_0200826 Ga0495612_0200826_87_560 157
540 3300053083 Ga0495655_0000012 Ga0495655_0000012_41317_41793 157
541 3300053083 Ga0495655_0041556 Ga0495655_0041556_318_791 157
542 3300053084 Ga0495595_0000001 Ga0495595_0000001_44770_45243 157
543 3300053084 Ga0495595_0000652 Ga0495595_0000652_10552_11025 157
544 3300053084 Ga0495595_0015879 Ga0495595_0015879_805_1278 157
545 3300053084 Ga0495595_0329613 Ga0495595_0329613_65_538 157
546 3300053085 Ga0495619_0000018 Ga0495619_0000018_3448_3921 157
547 3300053085 Ga0495619_0000041 Ga0495619_0000041_93523_93996 157
548 3300053085 Ga0495619_0000143 Ga0495619_0000143_7974_8447 157
549 3300053085 Ga0495619_0009926 Ga0495619_0009926_3143_3616 157
550 3300053085 Ga0495619_0331783 Ga0495619_0331783_329_802 157
551 3300053123 Ga0500614_000125 Ga0500614_000125_4183_4656 157
552 3300053129 Ga0500628_000014 Ga0500628_000014_61981_62457 157
553 3300054114 Ga0501084_0612395 Ga0501084_0612395_237_719 157
554 3300054114 Ga0501084_1283715 Ga0501084_1283715_34_525 157
555 3300060353 Ga0501082_0015708 Ga0501082_0015708_499_981 157
556 3300060353 Ga0501082_0581555 Ga0501082_0581555_162_635 157
557 3300060353 Ga0501082_0881069 Ga0501082_0881069_263_736 157

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8209 5 148
3tfz-assembly1.cif.gz_B crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 0.8128 2 145
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.802 4 148
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8007 5 148
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7872 4 148
ID Description Score Start End Superfamily
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8585 6 147 3.30.530.20
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8147 6 147 3.30.530.20
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8112 2 150 3.30.530.20
af_Q54GT2_2_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8071 35 69 3.50.50.60
2d4rA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8057 4 148 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7W1BDU2-F1-model_v4 SRPBCC family protein 0.9944 1 157
AF-A0A4R5KE91-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9944 1 157
AF-A0A1Q7VI15-F1-model_v4 Polyketide cyclase 0.9941 1 157
AF-A0A7U6H0Y6-F1-model_v4 deleted 0.9932 2 148
AF-A0A7W0WDM0-F1-model_v4 SRPBCC family protein 0.9925 1 157

Feature Viewer

pLDDT pTM Quality
93.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map