F463375
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 276 | 557 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300054114|Ga0501084_1283715|Ga0501084_1283715_34_525 |
| Length | 163 |
| Sequence | MTEYSFLTTWCLAAHRERVWDAIWESERWPEWWRGMVGSRRLVDGDETGVGQVGRYTWRSRLPYTLDFEMTTTRVDKPHLLEGHAVGELDGTGRWRLFEEGAAAGDGPLTVVVYEWNVRTTKPWMNLLAPIARPAFEWNHDWVMRRGGEGIARLLGCRLLAID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 155 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 222 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 223 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 224 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 225 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 271 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 273 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 274 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0 |
| Rhizoplane | 11.85 |
| Rhizosphere | 82.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000380 | 3300001977 | Bacteria | 6533 |
| 2 | JGI24748J21848_1000396 | 3300002074 | Bacteria | 4941 |
| 3 | JGI24034J26672_10000160 | 3300002239 | Bacteria | 9507 |
| 4 | JGI24742J22300_10009641 | 3300002244 | Bacteria | 1594 |
| 5 | Ga0070683_100010098 | 3300005329 | Bacteria | 8100 |
| 6 | Ga0070683_100011494 | 3300005329 | Bacteria | 7656 |
| 7 | Ga0070683_100016073 | 3300005329 | Bacteria | 6587 |
| 8 | Ga0070683_100027424 | 3300005329 | Bacteria | 5137 |
| 9 | Ga0070683_100098772 | 3300005329 | Bacteria | 2747 |
| 10 | Ga0070683_100347727 | 3300005329 | Bacteria | 1412 |
| 11 | Ga0070670_100226127 | 3300005331 | Bacteria | 1628 |
| 12 | Ga0070677_10000075 | 3300005333 | Bacteria | 31359 |
| 13 | Ga0070682_100539397 | 3300005337 | Bacteria | 911 |
| 14 | Ga0068868_100003875 | 3300005338 | Bacteria | 10443 |
| 15 | Ga0070689_100305118 | 3300005340 | Bacteria | 1326 |
| 16 | Ga0070661_100000524 | 3300005344 | Bacteria | 29415 |
| 17 | Ga0070692_10117953 | 3300005345 | Bacteria | 1476 |
| 18 | Ga0070668_100042034 | 3300005347 | Bacteria | 3503 |
| 19 | Ga0070668_100305930 | 3300005347 | Bacteria | 1334 |
| 20 | Ga0070668_100455260 | 3300005347 | Bacteria | 1101 |
| 21 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 22 | Ga0070671_101256541 | 3300005355 | Unclassified | 652 |
| 23 | Ga0070674_100000047 | 3300005356 | Bacteria | 52597 |
| 24 | Ga0070674_100000105 | 3300005356 | Bacteria | 39263 |
| 25 | Ga0070673_100115152 | 3300005364 | Bacteria | 2235 |
| 26 | Ga0070688_100000151 | 3300005365 | Bacteria | 37674 |
| 27 | Ga0070688_100043464 | 3300005365 | Bacteria | 2768 |
| 28 | Ga0070659_100092521 | 3300005366 | Bacteria | 2425 |
| 29 | Ga0070659_100822131 | 3300005366 | Bacteria | 809 |
| 30 | Ga0070667_100002491 | 3300005367 | Bacteria | 16067 |
| 31 | Ga0070667_100022130 | 3300005367 | Bacteria | 5273 |
| 32 | Ga0070667_100459792 | 3300005367 | Bacteria | 1164 |
| 33 | Ga0070714_100025876 | 3300005435 | Bacteria | 4846 |
| 34 | Ga0070713_100001587 | 3300005436 | Bacteria | 14561 |
| 35 | Ga0070711_100010236 | 3300005439 | Bacteria | 5798 |
| 36 | Ga0070711_100035451 | 3300005439 | Bacteria | 3336 |
| 37 | Ga0070663_100009347 | 3300005455 | Bacteria | 6067 |
| 38 | Ga0070663_100846578 | 3300005455 | Bacteria | 787 |
| 39 | Ga0070678_100013711 | 3300005456 | Bacteria | 5092 |
| 40 | Ga0070678_100198218 | 3300005456 | Bacteria | 1655 |
| 41 | Ga0070681_10064130 | 3300005458 | Bacteria | 3645 |
| 42 | Ga0070685_10000092 | 3300005466 | Bacteria | 55484 |
| 43 | Ga0070685_10002231 | 3300005466 | Bacteria | 10002 |
| 44 | Ga0070679_100000804 | 3300005530 | Bacteria | 27213 |
| 45 | Ga0070679_100020824 | 3300005530 | Bacteria | 6397 |
| 46 | Ga0070684_100062642 | 3300005535 | Bacteria | 3258 |
| 47 | Ga0070684_100146206 | 3300005535 | Bacteria | 2140 |
| 48 | Ga0070684_100476029 | 3300005535 | Bacteria | 1155 |
| 49 | Ga0070684_101453701 | 3300005535 | Unclassified | 646 |
| 50 | Ga0068853_100014352 | 3300005539 | Bacteria | 6486 |
| 51 | Ga0068853_100232363 | 3300005539 | Bacteria | 1687 |
| 52 | Ga0068853_100376159 | 3300005539 | Bacteria | 1326 |
| 53 | Ga0070672_100001255 | 3300005543 | Bacteria | 15606 |
| 54 | Ga0070686_100296421 | 3300005544 | Bacteria | 1198 |
| 55 | Ga0070693_100002159 | 3300005547 | Bacteria | 9022 |
| 56 | Ga0070665_100000128 | 3300005548 | Bacteria | 142568 |
| 57 | Ga0070665_100002491 | 3300005548 | Bacteria | 20261 |
| 58 | Ga0070665_100157060 | 3300005548 | Bacteria | 2276 |
| 59 | Ga0070665_100225941 | 3300005548 | Bacteria | 1872 |
| 60 | Ga0070665_100420946 | 3300005548 | Bacteria | 1344 |
| 61 | Ga0070665_100603457 | 3300005548 | Bacteria | 1111 |
| 62 | Ga0070704_100368844 | 3300005549 | Bacteria | 1217 |
| 63 | Ga0070704_101014756 | 3300005549 | Bacteria | 751 |
| 64 | Ga0068855_100145972 | 3300005563 | Bacteria | 2693 |
| 65 | Ga0068855_100434410 | 3300005563 | Bacteria | 1435 |
| 66 | Ga0070664_100094706 | 3300005564 | Bacteria | 2590 |
| 67 | Ga0070664_100115747 | 3300005564 | Bacteria | 2344 |
| 68 | Ga0068854_100000123 | 3300005578 | Bacteria | 53446 |
| 69 | Ga0068856_100019149 | 3300005614 | Bacteria | 6644 |
| 70 | Ga0068856_100206002 | 3300005614 | Bacteria | 1981 |
| 71 | Ga0068856_100315286 | 3300005614 | Bacteria | 1581 |
| 72 | Ga0068856_100851730 | 3300005614 | Bacteria | 931 |
| 73 | Ga0068856_101621381 | 3300005614 | Bacteria | 660 |
| 74 | Ga0068852_100000050 | 3300005616 | Bacteria | 84306 |
| 75 | Ga0068852_100787226 | 3300005616 | Bacteria | 965 |
| 76 | Ga0068866_10000006 | 3300005718 | Bacteria | 176129 |
| 77 | Ga0068866_10000124 | 3300005718 | Bacteria | 33822 |
| 78 | Ga0068866_10361900 | 3300005718 | Bacteria | 925 |
| 79 | Ga0068851_10001237 | 3300005834 | Bacteria | 11090 |
| 80 | Ga0068863_100000039 | 3300005841 | Bacteria | 161450 |
| 81 | Ga0068863_100003181 | 3300005841 | Bacteria | 16230 |
| 82 | Ga0068858_100000354 | 3300005842 | Bacteria | 48397 |
| 83 | Ga0068858_100001452 | 3300005842 | Bacteria | 24367 |
| 84 | Ga0068858_100233866 | 3300005842 | Bacteria | 1742 |
| 85 | Ga0068858_100452807 | 3300005842 | Bacteria | 1237 |
| 86 | Ga0068858_101140294 | 3300005842 | Bacteria | 766 |
| 87 | Ga0068862_100013835 | 3300005844 | Bacteria | 6688 |
| 88 | Ga0081455_10052747 | 3300005937 | Bacteria | 3479 |
| 89 | Ga0075365_10266720 | 3300006038 | Bacteria | 1204 |
| 90 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 91 | Ga0070716_100182683 | 3300006173 | Bacteria | 1378 |
| 92 | Ga0070712_100019703 | 3300006175 | Bacteria | 4405 |
| 93 | Ga0070712_100544160 | 3300006175 | Bacteria | 978 |
| 94 | Ga0097621_101284342 | 3300006237 | Bacteria | 691 |
| 95 | Ga0075431_100011442 | 3300006847 | Bacteria | 8942 |
| 96 | Ga0075433_10000875 | 3300006852 | Bacteria | 21136 |
| 97 | Ga0075434_100024738 | 3300006871 | Bacteria | 5873 |
| 98 | Ga0075436_100560786 | 3300006914 | Bacteria | 839 |
| 99 | Ga0075436_100655048 | 3300006914 | Bacteria | 776 |
| 100 | Ga0075435_100202618 | 3300007076 | Bacteria | 1682 |
| 101 | Ga0105240_10339563 | 3300009093 | Bacteria | 1707 |
| 102 | Ga0105240_10852643 | 3300009093 | Bacteria | 983 |
| 103 | Ga0111539_10067976 | 3300009094 | Bacteria | 4207 |
| 104 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 105 | Ga0105245_10000067 | 3300009098 | Bacteria | 107929 |
| 106 | Ga0105245_10000246 | 3300009098 | Bacteria | 51410 |
| 107 | Ga0105245_10009989 | 3300009098 | Bacteria | 8264 |
| 108 | Ga0105245_11798275 | 3300009098 | Bacteria | 665 |
| 109 | Ga0105247_10197438 | 3300009101 | Bacteria | 1350 |
| 110 | Ga0114129_10059127 | 3300009147 | Bacteria | 5359 |
| 111 | Ga0105243_10009568 | 3300009148 | Bacteria | 7379 |
| 112 | Ga0105243_10091763 | 3300009148 | Bacteria | 2502 |
| 113 | Ga0105241_10248208 | 3300009174 | Bacteria | 1508 |
| 114 | Ga0105241_10256321 | 3300009174 | Bacteria | 1485 |
| 115 | Ga0105242_10000010 | 3300009176 | Bacteria | 151649 |
| 116 | Ga0105242_10149891 | 3300009176 | Bacteria | 2033 |
| 117 | Ga0105248_10000307 | 3300009177 | Bacteria | 58221 |
| 118 | Ga0105248_10260295 | 3300009177 | Bacteria | 1953 |
| 119 | Ga0105248_12421266 | 3300009177 | Unclassified | 598 |
| 120 | Ga0105237_10169985 | 3300009545 | Bacteria | 2179 |
| 121 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 122 | Ga0105238_11487729 | 3300009551 | Unclassified | 706 |
| 123 | Ga0105249_10000159 | 3300009553 | Bacteria | 82172 |
| 124 | Ga0105249_10070387 | 3300009553 | Bacteria | 3229 |
| 125 | Ga0099796_10357347 | 3300010159 | Bacteria | 631 |
| 126 | Ga0105239_10232460 | 3300010375 | Bacteria | 2068 |
| 127 | Ga0157371_10002341 | 3300013102 | Bacteria | 18157 |
| 128 | Ga0157370_10040358 | 3300013104 | Bacteria | 4506 |
| 129 | Ga0157370_10316975 | 3300013104 | Bacteria | 1439 |
| 130 | Ga0157369_10000222 | 3300013105 | Bacteria | 78413 |
| 131 | Ga0157374_10000281 | 3300013296 | Bacteria | 46977 |
| 132 | Ga0157374_11406981 | 3300013296 | Bacteria | 720 |
| 133 | Ga0157378_10009857 | 3300013297 | Bacteria | 8326 |
| 134 | Ga0163162_10139140 | 3300013306 | Bacteria | 2540 |
| 135 | Ga0163162_10641534 | 3300013306 | Bacteria | 1186 |
| 136 | Ga0157372_10006714 | 3300013307 | Bacteria | 12237 |
| 137 | Ga0157375_10000095 | 3300013308 | Bacteria | 88952 |
| 138 | Ga0157375_10035586 | 3300013308 | Bacteria | 4754 |
| 139 | Ga0157375_10071355 | 3300013308 | Bacteria | 3486 |
| 140 | Ga0157375_11835863 | 3300013308 | Bacteria | 719 |
| 141 | Ga0157375_11902153 | 3300013308 | Bacteria | 706 |
| 142 | Ga0163163_10758016 | 3300014325 | Bacteria | 1034 |
| 143 | Ga0163163_11356208 | 3300014325 | Unclassified | 773 |
| 144 | Ga0163163_11456178 | 3300014325 | Bacteria | 746 |
| 145 | Ga0157380_10000594 | 3300014326 | Bacteria | 22281 |
| 146 | Ga0157380_12078593 | 3300014326 | Unclassified | 631 |
| 147 | Ga0157377_10334854 | 3300014745 | Bacteria | 1010 |
| 148 | Ga0157379_10013677 | 3300014968 | Bacteria | 7111 |
| 149 | Ga0157379_10165185 | 3300014968 | Bacteria | 1998 |
| 150 | Ga0157376_10202790 | 3300014969 | Bacteria | 1826 |
| 151 | Ga0157376_10259601 | 3300014969 | Bacteria | 1627 |
| 152 | Ga0157376_10544287 | 3300014969 | Bacteria | 1148 |
| 153 | Ga0163161_10000140 | 3300017792 | Bacteria | 66684 |
| 154 | Ga0163161_10072390 | 3300017792 | Bacteria | 2523 |
| 155 | Ga0206356_11783605 | 3300020070 | Bacteria | 1631 |
| 156 | Ga0206353_10708015 | 3300020082 | Bacteria | 1610 |
| 157 | Ga0207682_10000217 | 3300025893 | Bacteria | 25947 |
| 158 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 159 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 160 | Ga0207642_10000004 | 3300025899 | Bacteria | 407822 |
| 161 | Ga0207642_10000152 | 3300025899 | Bacteria | 19609 |
| 162 | Ga0207642_10262102 | 3300025899 | Bacteria | 986 |
| 163 | Ga0207642_10407673 | 3300025899 | Bacteria | 815 |
| 164 | Ga0207710_10181282 | 3300025900 | Bacteria | 1033 |
| 165 | Ga0207680_10055188 | 3300025903 | Bacteria | 2393 |
| 166 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 167 | Ga0207705_10102922 | 3300025909 | Bacteria | 2103 |
| 168 | Ga0207654_10106448 | 3300025911 | Bacteria | 1737 |
| 169 | Ga0207707_10098235 | 3300025912 | Bacteria | 2559 |
| 170 | Ga0207693_10023691 | 3300025915 | Bacteria | 4871 |
| 171 | Ga0207693_10772702 | 3300025915 | Bacteria | 741 |
| 172 | Ga0207663_10005102 | 3300025916 | Bacteria | 6597 |
| 173 | Ga0207663_10149444 | 3300025916 | Bacteria | 1637 |
| 174 | Ga0207657_10875486 | 3300025919 | Bacteria | 692 |
| 175 | Ga0207649_10000610 | 3300025920 | Bacteria | 24162 |
| 176 | Ga0207652_10000119 | 3300025921 | Bacteria | 86757 |
| 177 | Ga0207652_10000332 | 3300025921 | Bacteria | 49012 |
| 178 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 179 | Ga0207650_10448111 | 3300025925 | Bacteria | 1074 |
| 180 | Ga0207659_10000049 | 3300025926 | Bacteria | 82923 |
| 181 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 182 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 183 | Ga0207687_10000503 | 3300025927 | Bacteria | 26341 |
| 184 | Ga0207687_10004483 | 3300025927 | Bacteria | 9293 |
| 185 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 186 | Ga0207664_10012655 | 3300025929 | Bacteria | 6036 |
| 187 | Ga0207690_10002643 | 3300025932 | Bacteria | 10792 |
| 188 | Ga0207690_10062808 | 3300025932 | Bacteria | 2530 |
| 189 | Ga0207690_10561362 | 3300025932 | Bacteria | 929 |
| 190 | Ga0207686_10000227 | 3300025934 | Bacteria | 42647 |
| 191 | Ga0207686_10043634 | 3300025934 | Bacteria | 2749 |
| 192 | Ga0207709_10030724 | 3300025935 | Bacteria | 3128 |
| 193 | Ga0207709_10078365 | 3300025935 | Bacteria | 2121 |
| 194 | Ga0207670_10490313 | 3300025936 | Bacteria | 996 |
| 195 | Ga0207670_10969441 | 3300025936 | Bacteria | 714 |
| 196 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 197 | Ga0207669_10000765 | 3300025937 | Bacteria | 13768 |
| 198 | Ga0207665_10116043 | 3300025939 | Bacteria | 1887 |
| 199 | Ga0207691_10001495 | 3300025940 | Bacteria | 23287 |
| 200 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 201 | Ga0207661_10001860 | 3300025944 | Bacteria | 14445 |
| 202 | Ga0207661_10009394 | 3300025944 | Bacteria | 7012 |
| 203 | Ga0207661_10037300 | 3300025944 | Bacteria | 3800 |
| 204 | Ga0207661_10082420 | 3300025944 | Bacteria | 2659 |
| 205 | Ga0207661_10230695 | 3300025944 | Bacteria | 1639 |
| 206 | Ga0207661_10772679 | 3300025944 | Bacteria | 884 |
| 207 | Ga0207679_10078469 | 3300025945 | Bacteria | 2515 |
| 208 | Ga0207679_10134505 | 3300025945 | Bacteria | 1989 |
| 209 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 210 | Ga0207712_10003211 | 3300025961 | Bacteria | 10389 |
| 211 | Ga0207712_10402858 | 3300025961 | Bacteria | 1150 |
| 212 | Ga0207668_10007500 | 3300025972 | Bacteria | 6489 |
| 213 | Ga0207668_10143184 | 3300025972 | Bacteria | 1841 |
| 214 | Ga0207668_10278908 | 3300025972 | Bacteria | 1370 |
| 215 | Ga0207668_10503023 | 3300025972 | Bacteria | 1043 |
| 216 | Ga0207640_10000040 | 3300025981 | Bacteria | 106134 |
| 217 | Ga0207640_10045984 | 3300025981 | Bacteria | 2806 |
| 218 | Ga0207658_10000871 | 3300025986 | Bacteria | 25155 |
| 219 | Ga0207658_10014542 | 3300025986 | Bacteria | 5389 |
| 220 | Ga0207658_10724983 | 3300025986 | Bacteria | 899 |
| 221 | Ga0207677_10000787 | 3300026023 | Bacteria | 18192 |
| 222 | Ga0207677_10002766 | 3300026023 | Bacteria | 9266 |
| 223 | Ga0207703_10000028 | 3300026035 | Bacteria | 208682 |
| 224 | Ga0207703_10000185 | 3300026035 | Bacteria | 72988 |
| 225 | Ga0207703_10438661 | 3300026035 | Bacteria | 1218 |
| 226 | Ga0207639_10009852 | 3300026041 | Bacteria | 6599 |
| 227 | Ga0207639_10265008 | 3300026041 | Bacteria | 1505 |
| 228 | Ga0207639_10351258 | 3300026041 | Bacteria | 1317 |
| 229 | Ga0207639_10361023 | 3300026041 | Bacteria | 1300 |
| 230 | Ga0207678_10000953 | 3300026067 | Bacteria | 26430 |
| 231 | Ga0207678_10848147 | 3300026067 | Bacteria | 807 |
| 232 | Ga0207708_10765206 | 3300026075 | Bacteria | 829 |
| 233 | Ga0207708_10960104 | 3300026075 | Bacteria | 742 |
| 234 | Ga0207702_10001168 | 3300026078 | Bacteria | 26815 |
| 235 | Ga0207702_10008030 | 3300026078 | Bacteria | 8929 |
| 236 | Ga0207702_10040826 | 3300026078 | Bacteria | 3890 |
| 237 | Ga0207702_10722281 | 3300026078 | Bacteria | 982 |
| 238 | Ga0207702_11632617 | 3300026078 | Bacteria | 638 |
| 239 | Ga0207641_10000072 | 3300026088 | Bacteria | 151067 |
| 240 | Ga0207674_10162179 | 3300026116 | Bacteria | 2190 |
| 241 | Ga0207683_10155832 | 3300026121 | Bacteria | 2063 |
| 242 | Ga0207683_10348842 | 3300026121 | Bacteria | 1358 |
| 243 | Ga0207683_10370228 | 3300026121 | Bacteria | 1316 |
| 244 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 245 | Ga0207698_10608688 | 3300026142 | Bacteria | 1078 |
| 246 | Ga0207428_10062230 | 3300027907 | Bacteria | 2952 |
| 247 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 248 | Ga0268266_10001616 | 3300028379 | Bacteria | 26283 |
| 249 | Ga0268266_10001763 | 3300028379 | Bacteria | 24641 |
| 250 | Ga0268266_10225668 | 3300028379 | Bacteria | 1723 |
| 251 | Ga0268266_10439078 | 3300028379 | Bacteria | 1239 |
| 252 | Ga0268265_10008225 | 3300028380 | Bacteria | 7046 |
| 253 | Ga0268264_10264461 | 3300028381 | Bacteria | 1604 |
| 254 | Ga0265337_1000041 | 3300028556 | Bacteria | 56264 |
| 255 | Ga0265326_10000015 | 3300028558 | Bacteria | 159279 |
| 256 | Ga0265319_1063361 | 3300028563 | Bacteria | 1196 |
| 257 | Ga0265323_10079655 | 3300028653 | Bacteria | 1108 |
| 258 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 259 | Ga0265336_10005910 | 3300028666 | Bacteria | 4465 |
| 260 | Ga0265324_10000907 | 3300029957 | Bacteria | 18733 |
| 261 | Ga0265332_10126602 | 3300031238 | Bacteria | 1072 |
| 262 | Ga0265328_10001369 | 3300031239 | Bacteria | 11243 |
| 263 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 264 | Ga0265339_10017679 | 3300031249 | Bacteria | 4218 |
| 265 | Ga0265331_10009641 | 3300031250 | Bacteria | 5405 |
| 266 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 267 | Ga0265316_10024452 | 3300031344 | Bacteria | 5062 |
| 268 | Ga0265314_10020220 | 3300031711 | Bacteria | 5141 |
| 269 | Ga0307415_100093025 | 3300032126 | Bacteria | 2188 |
| 270 | Ga0373937_0023647 | 3300036401 | Bacteria | 5537 |
| 271 | Ga0373937_0070670 | 3300036401 | Bacteria | 3220 |
| 272 | Ga0395901_0848828 | 3300038443 | Bacteria | 899 |
| 273 | Ga0395901_1919451 | 3300038443 | Unclassified | 539 |
| 274 | Ga0451802_0438050 | 3300041460 | Bacteria | 984 |
| 275 | Ga0451807_1796160 | 3300041486 | Bacteria | 596 |
| 276 | Ga0451807_2307049 | 3300041486 | Unclassified | 1140 |
| 277 | Ga0451833_0634948 | 3300041491 | Bacteria | 1724 |
| 278 | Ga0451839_0844376 | 3300041496 | Bacteria | 957 |
| 279 | Ga0451853_3731523 | 3300041512 | Bacteria | 4069 |
| 280 | Ga0466963_0000002 | 3300044694 | Bacteria | 108477 |
| 281 | Ga0466957_0016522 | 3300044842 | Bacteria | 4316 |
| 282 | Ga0466957_0155944 | 3300044842 | Bacteria | 1480 |
| 283 | Ga0466958_0021909 | 3300045836 | Bacteria | 3737 |
| 284 | Ga0466967_0000020 | 3300045976 | Bacteria | 78851 |
| 285 | Ga0495592_0000999 | 3300046454 | Bacteria | 19653 |
| 286 | Ga0495592_0387725 | 3300046454 | Bacteria | 888 |
| 287 | Ga0495603_0000057 | 3300046455 | Bacteria | 48728 |
| 288 | Ga0495603_0002491 | 3300046455 | Bacteria | 10836 |
| 289 | Ga0495603_0003192 | 3300046455 | Bacteria | 9755 |
| 290 | Ga0495629_0000028 | 3300046459 | Bacteria | 127409 |
| 291 | Ga0495629_0004331 | 3300046459 | Bacteria | 10642 |
| 292 | Ga0495629_0389110 | 3300046459 | Bacteria | 948 |
| 293 | Ga0495629_0463522 | 3300046459 | Bacteria | 857 |
| 294 | Ga0495641_0001934 | 3300046461 | Bacteria | 16875 |
| 295 | Ga0495641_0067435 | 3300046461 | Bacteria | 1609 |
| 296 | Ga0495651_0146464 | 3300046462 | Bacteria | 1707 |
| 297 | Ga0495653_0096141 | 3300046463 | Bacteria | 2154 |
| 298 | Ga0495653_0186428 | 3300046463 | Bacteria | 1419 |
| 299 | Ga0495653_0223183 | 3300046463 | Bacteria | 1266 |
| 300 | Ga0495582_0000048 | 3300046473 | Bacteria | 60887 |
| 301 | Ga0495662_0000659 | 3300046476 | Bacteria | 16224 |
| 302 | Ga0495662_0018027 | 3300046476 | Bacteria | 3415 |
| 303 | Ga0495662_0053835 | 3300046476 | Bacteria | 1943 |
| 304 | Ga0495664_0343379 | 3300046477 | Bacteria | 899 |
| 305 | Ga0495606_0000294 | 3300046507 | Bacteria | 85998 |
| 306 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 307 | Ga0495608_0004024 | 3300046511 | Bacteria | 10551 |
| 308 | Ga0495608_0119306 | 3300046511 | Bacteria | 1692 |
| 309 | Ga0495628_0001728 | 3300046516 | Bacteria | 19872 |
| 310 | Ga0495628_0011273 | 3300046516 | Bacteria | 7562 |
| 311 | Ga0495628_0011510 | 3300046516 | Bacteria | 7479 |
| 312 | Ga0495628_0232549 | 3300046516 | Bacteria | 1381 |
| 313 | Ga0495628_0673367 | 3300046516 | Unclassified | 733 |
| 314 | Ga0495630_0000165 | 3300046517 | Bacteria | 51355 |
| 315 | Ga0495630_0037128 | 3300046517 | Bacteria | 3642 |
| 316 | Ga0495630_0485403 | 3300046517 | Bacteria | 947 |
| 317 | Ga0495637_0262121 | 3300046520 | Unclassified | 620 |
| 318 | Ga0495644_0001304 | 3300046523 | Bacteria | 10235 |
| 319 | Ga0495652_0047825 | 3300046529 | Bacteria | 3668 |
| 320 | Ga0495652_0131103 | 3300046529 | Bacteria | 1984 |
| 321 | Ga0495640_0040475 | 3300046533 | Bacteria | 3264 |
| 322 | Ga0495640_0050074 | 3300046533 | Bacteria | 2879 |
| 323 | Ga0495586_0032837 | 3300046535 | Bacteria | 2783 |
| 324 | Ga0495587_0003143 | 3300046536 | Bacteria | 11040 |
| 325 | Ga0495645_0001401 | 3300046543 | Bacteria | 16267 |
| 326 | Ga0495645_0017457 | 3300046543 | Bacteria | 5141 |
| 327 | Ga0495667_0000057 | 3300046559 | Bacteria | 100656 |
| 328 | Ga0495667_0289804 | 3300046559 | Bacteria | 1038 |
| 329 | Ga0495668_0277651 | 3300046616 | Bacteria | 918 |
| 330 | Ga0495634_0000555 | 3300046642 | Bacteria | 36577 |
| 331 | Ga0495634_0013405 | 3300046642 | Bacteria | 5922 |
| 332 | Ga0495634_0055729 | 3300046642 | Bacteria | 2643 |
| 333 | Ga0495588_0000195 | 3300046674 | Bacteria | 64337 |
| 334 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 335 | Ga0495657_0079405 | 3300046675 | Bacteria | 2125 |
| 336 | Ga0495657_0096415 | 3300046675 | Bacteria | 1890 |
| 337 | Ga0495599_0008656 | 3300046678 | Bacteria | 6192 |
| 338 | Ga0495623_0208494 | 3300046679 | Bacteria | 1120 |
| 339 | Ga0495623_0528165 | 3300046679 | Unclassified | 620 |
| 340 | Ga0495623_0570039 | 3300046679 | Unclassified | 591 |
| 341 | Ga0495647_0000020 | 3300046681 | Bacteria | 77355 |
| 342 | Ga0495647_0002424 | 3300046681 | Bacteria | 5870 |
| 343 | Ga0495647_0003249 | 3300046681 | Bacteria | 5202 |
| 344 | Ga0495658_0000031 | 3300046683 | Bacteria | 71165 |
| 345 | Ga0495669_0000064 | 3300046684 | Bacteria | 70549 |
| 346 | Ga0495669_0186990 | 3300046684 | Bacteria | 988 |
| 347 | Ga0495669_0210253 | 3300046684 | Bacteria | 931 |
| 348 | Ga0495613_0000003 | 3300046689 | Bacteria | 248826 |
| 349 | Ga0495613_0000500 | 3300046689 | Bacteria | 33170 |
| 350 | Ga0495613_0185425 | 3300046689 | Bacteria | 1472 |
| 351 | Ga0495624_0000087 | 3300046690 | Bacteria | 61504 |
| 352 | Ga0495624_0000652 | 3300046690 | Bacteria | 27147 |
| 353 | Ga0495671_0251249 | 3300046692 | Bacteria | 853 |
| 354 | Ga0495649_0008654 | 3300046694 | Bacteria | 6111 |
| 355 | Ga0495600_0020410 | 3300046809 | Bacteria | 4238 |
| 356 | Ga0495600_0036363 | 3300046809 | Bacteria | 3200 |
| 357 | Ga0495600_0067052 | 3300046809 | Bacteria | 2346 |
| 358 | Ga0495600_0150174 | 3300046809 | Bacteria | 1509 |
| 359 | Ga0495604_0001970 | 3300047317 | Bacteria | 16586 |
| 360 | Ga0495604_0002487 | 3300047317 | Bacteria | 14713 |
| 361 | Ga0495604_0148075 | 3300047317 | Bacteria | 1671 |
| 362 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 363 | Ga0495672_0024890 | 3300047320 | Bacteria | 3846 |
| 364 | Ga0495676_0000263 | 3300047321 | Bacteria | 42431 |
| 365 | Ga0495676_0005813 | 3300047321 | Bacteria | 11317 |
| 366 | Ga0495676_0067438 | 3300047321 | Bacteria | 2768 |
| 367 | Ga0495676_0121108 | 3300047321 | Bacteria | 1903 |
| 368 | Ga0495676_0240941 | 3300047321 | Bacteria | 1238 |
| 369 | Ga0495680_0005894 | 3300047322 | Bacteria | 11462 |
| 370 | Ga0495680_0017444 | 3300047322 | Bacteria | 6131 |
| 371 | Ga0495680_0017984 | 3300047322 | Bacteria | 6014 |
| 372 | Ga0495680_0363471 | 3300047322 | Bacteria | 1005 |
| 373 | Ga0495675_0000696 | 3300047444 | Bacteria | 21058 |
| 374 | Ga0495686_0059362 | 3300047472 | Bacteria | 2381 |
| 375 | Ga0495593_0374673 | 3300047673 | Unclassified | 711 |
| 376 | Ga0495602_0002467 | 3300048088 | Bacteria | 18845 |
| 377 | Ga0495602_0007803 | 3300048088 | Bacteria | 11187 |
| 378 | Ga0495602_0057467 | 3300048088 | Bacteria | 3412 |
| 379 | Ga0495602_0166800 | 3300048088 | Bacteria | 1713 |
| 380 | Ga0495602_0541469 | 3300048088 | Bacteria | 808 |
| 381 | Ga0495602_0878383 | 3300048088 | Unclassified | 598 |
| 382 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 383 | Ga0496100_0000032 | 3300048903 | Bacteria | 99877 |
| 384 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 385 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 386 | Ga0496101_0851716 | 3300048904 | Bacteria | 718 |
| 387 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 388 | Ga0496102_0182497 | 3300048905 | Bacteria | 1977 |
| 389 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 390 | Ga0496103_0276652 | 3300048906 | Bacteria | 1080 |
| 391 | Ga0496103_0422725 | 3300048906 | Archaea | 855 |
| 392 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 393 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 394 | Ga0496104_0002073 | 3300048907 | Bacteria | 17411 |
| 395 | Ga0496104_0038835 | 3300048907 | Bacteria | 4456 |
| 396 | Ga0496104_0092123 | 3300048907 | Bacteria | 2898 |
| 397 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 398 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 399 | Ga0496105_0009688 | 3300048908 | Bacteria | 7541 |
| 400 | Ga0496105_0066404 | 3300048908 | Bacteria | 2978 |
| 401 | Ga0496105_0098035 | 3300048908 | Bacteria | 2421 |
| 402 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 403 | Ga0496106_0000096 | 3300048909 | Bacteria | 67122 |
| 404 | Ga0496106_0000470 | 3300048909 | Bacteria | 28737 |
| 405 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 406 | Ga0496107_0000031 | 3300048910 | Bacteria | 100522 |
| 407 | Ga0496107_0854378 | 3300048910 | Unclassified | 665 |
| 408 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 409 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 410 | Ga0496108_0004840 | 3300048911 | Bacteria | 10866 |
| 411 | Ga0496108_0014174 | 3300048911 | Bacteria | 6504 |
| 412 | Ga0496108_0353449 | 3300048911 | Bacteria | 1282 |
| 413 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 414 | Ga0496109_0000106 | 3300048912 | Bacteria | 86550 |
| 415 | Ga0496109_0003327 | 3300048912 | Bacteria | 13446 |
| 416 | Ga0496109_0321988 | 3300048912 | Bacteria | 1459 |
| 417 | Ga0496109_0359242 | 3300048912 | Bacteria | 1376 |
| 418 | Ga0496109_0804154 | 3300048912 | Bacteria | 878 |
| 419 | Ga0496109_1010087 | 3300048912 | Bacteria | 769 |
| 420 | Ga0496110_0014901 | 3300048913 | Bacteria | 6461 |
| 421 | Ga0496110_0029771 | 3300048913 | Bacteria | 4703 |
| 422 | Ga0496110_0103834 | 3300048913 | Bacteria | 2549 |
| 423 | Ga0496110_0112254 | 3300048913 | Bacteria | 2450 |
| 424 | Ga0496110_1434511 | 3300048913 | Bacteria | 600 |
| 425 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 426 | Ga0496111_0036458 | 3300048914 | Bacteria | 3516 |
| 427 | Ga0496111_0683239 | 3300048914 | Bacteria | 747 |
| 428 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 429 | Ga0496112_0000762 | 3300048915 | Bacteria | 22616 |
| 430 | Ga0496112_0157492 | 3300048915 | Bacteria | 2238 |
| 431 | Ga0496112_1316127 | 3300048915 | Bacteria | 638 |
| 432 | Ga0496113_0000317 | 3300048916 | Bacteria | 22880 |
| 433 | Ga0496113_0032061 | 3300048916 | Bacteria | 3817 |
| 434 | Ga0496113_0170718 | 3300048916 | Bacteria | 1722 |
| 435 | Ga0496113_0430122 | 3300048916 | Bacteria | 1060 |
| 436 | Ga0496113_0727332 | 3300048916 | Bacteria | 791 |
| 437 | Ga0496114_0000080 | 3300048917 | Bacteria | 68701 |
| 438 | Ga0496114_0074984 | 3300048917 | Bacteria | 2849 |
| 439 | Ga0496114_0267643 | 3300048917 | Bacteria | 1505 |
| 440 | Ga0496114_0593221 | 3300048917 | Bacteria | 977 |
| 441 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 442 | Ga0496115_0000104 | 3300048918 | Bacteria | 79824 |
| 443 | Ga0496115_0108391 | 3300048918 | Bacteria | 2280 |
| 444 | Ga0496115_0491423 | 3300048918 | Bacteria | 987 |
| 445 | Ga0496116_0000500 | 3300048919 | Bacteria | 53809 |
| 446 | Ga0496117_0058517 | 3300048920 | Bacteria | 2668 |
| 447 | Ga0496117_0454479 | 3300048920 | Unclassified | 632 |
| 448 | Ga0496118_0018764 | 3300048921 | Bacteria | 6215 |
| 449 | Ga0496118_0125217 | 3300048921 | Bacteria | 1665 |
| 450 | Ga0496118_0371483 | 3300048921 | Unclassified | 754 |
| 451 | Ga0496119_0002689 | 3300048922 | Bacteria | 19205 |
| 452 | Ga0496119_0036838 | 3300048922 | Bacteria | 3186 |
| 453 | Ga0496119_0040316 | 3300048922 | Bacteria | 2988 |
| 454 | Ga0496120_0008224 | 3300048923 | Bacteria | 7634 |
| 455 | Ga0496121_0021758 | 3300048924 | Bacteria | 6265 |
| 456 | Ga0496121_0145946 | 3300048924 | Bacteria | 1748 |
| 457 | Ga0496121_0259346 | 3300048924 | Unclassified | 1201 |
| 458 | Ga0496121_0405538 | 3300048924 | Unclassified | 891 |
| 459 | Ga0496124_0019847 | 3300048927 | Bacteria | 6236 |
| 460 | Ga0496125_0038506 | 3300048928 | Bacteria | 4137 |
| 461 | Ga0496125_0100923 | 3300048928 | Bacteria | 2126 |
| 462 | Ga0496125_0122629 | 3300048928 | Bacteria | 1850 |
| 463 | Ga0496125_0150150 | 3300048928 | Bacteria | 1602 |
| 464 | Ga0496126_0045261 | 3300048929 | Bacteria | 4046 |
| 465 | Ga0496126_0329647 | 3300048929 | Bacteria | 1253 |
| 466 | Ga0496126_0380782 | 3300048929 | Bacteria | 1148 |
| 467 | Ga0496126_0486175 | 3300048929 | Bacteria | 988 |
| 468 | Ga0501031_0001419 | 3300049568 | Bacteria | 14839 |
| 469 | Ga0501031_0628606 | 3300049568 | Bacteria | 690 |
| 470 | Ga0501032_0007104 | 3300049569 | Bacteria | 8198 |
| 471 | Ga0501032_0286475 | 3300049569 | Bacteria | 1066 |
| 472 | Ga0501033_0001230 | 3300049570 | Bacteria | 22966 |
| 473 | Ga0501034_0142713 | 3300049571 | Bacteria | 2373 |
| 474 | Ga0501034_1002042 | 3300049571 | Bacteria | 719 |
| 475 | Ga0501036_0002324 | 3300049572 | Bacteria | 14869 |
| 476 | Ga0501037_0009222 | 3300049573 | Bacteria | 7233 |
| 477 | Ga0501038_0003498 | 3300049574 | Bacteria | 14625 |
| 478 | Ga0501039_0117898 | 3300049575 | Bacteria | 2079 |
| 479 | Ga0501039_0225757 | 3300049575 | Bacteria | 1472 |
| 480 | Ga0501040_0088651 | 3300049576 | Bacteria | 2149 |
| 481 | Ga0501040_0282803 | 3300049576 | Bacteria | 1185 |
| 482 | Ga0501041_0464774 | 3300049577 | Bacteria | 804 |
| 483 | Ga0501042_0085688 | 3300049578 | Bacteria | 2259 |
| 484 | Ga0501043_0008013 | 3300049579 | Bacteria | 8338 |
| 485 | Ga0501046_0013436 | 3300049580 | Bacteria | 6931 |
| 486 | Ga0501047_0003396 | 3300049581 | Bacteria | 15073 |
| 487 | Ga0501047_0050207 | 3300049581 | Bacteria | 4028 |
| 488 | Ga0501047_0087996 | 3300049581 | Bacteria | 2983 |
| 489 | Ga0501047_0104712 | 3300049581 | Bacteria | 2709 |
| 490 | Ga0501048_0006756 | 3300049582 | Bacteria | 8716 |
| 491 | Ga0501048_0096970 | 3300049582 | Bacteria | 2080 |
| 492 | Ga0501067_0128593 | 3300049583 | Bacteria | 1409 |
| 493 | Ga0501068_0188838 | 3300049584 | Bacteria | 1304 |
| 494 | Ga0501069_0226497 | 3300049585 | Bacteria | 1087 |
| 495 | Ga0501069_0299059 | 3300049585 | Bacteria | 943 |
| 496 | Ga0501069_0372968 | 3300049585 | Bacteria | 842 |
| 497 | Ga0501070_0008745 | 3300049586 | Bacteria | 8563 |
| 498 | Ga0501070_0034838 | 3300049586 | Bacteria | 4207 |
| 499 | Ga0501070_0369112 | 3300049586 | Bacteria | 1163 |
| 500 | Ga0501070_0407342 | 3300049586 | Bacteria | 1099 |
| 501 | Ga0501070_1444887 | 3300049586 | Unclassified | 521 |
| 502 | Ga0501071_0139456 | 3300049587 | Bacteria | 1805 |
| 503 | Ga0501071_0387094 | 3300049587 | Bacteria | 1067 |
| 504 | Ga0501072_0070995 | 3300049588 | Bacteria | 2751 |
| 505 | Ga0501072_0091493 | 3300049588 | Bacteria | 2415 |
| 506 | Ga0501073_0036554 | 3300049589 | Bacteria | 3489 |
| 507 | Ga0501074_0024156 | 3300049590 | Bacteria | 4417 |
| 508 | Ga0501074_0072580 | 3300049590 | Bacteria | 2472 |
| 509 | Ga0501074_0219286 | 3300049590 | Bacteria | 1354 |
| 510 | Ga0501075_0004075 | 3300049591 | Bacteria | 9867 |
| 511 | Ga0501079_0091109 | 3300049741 | Bacteria | 2362 |
| 512 | Ga0501079_0208730 | 3300049741 | Bacteria | 1525 |
| 513 | Ga0501080_0102745 | 3300049742 | Bacteria | 2651 |
| 514 | Ga0501080_0265644 | 3300049742 | Bacteria | 1562 |
| 515 | Ga0501083_0009230 | 3300049744 | Bacteria | 6964 |
| 516 | Ga0501083_0147141 | 3300049744 | Bacteria | 1542 |
| 517 | Ga0501035_0001056 | 3300049822 | Bacteria | 28872 |
| 518 | Ga0501044_0004552 | 3300049823 | Bacteria | 15505 |
| 519 | Ga0501044_0049531 | 3300049823 | Bacteria | 4336 |
| 520 | Ga0501044_0319919 | 3300049823 | Bacteria | 1476 |
| 521 | nmdc:mga05p37_55968_c1 | 3300050507 | Bacteria | 4855 |
| 522 | nmdc:mga06r32_8550_c1 | 3300050510 | Bacteria | 9228 |
| 523 | nmdc:mga08y16_21284_c2 | 3300050511 | Bacteria | 2951 |
| 524 | nmdc:mga0n895_11734_c1 | 3300050512 | Bacteria | 7831 |
| 525 | nmdc:mga0rr50_87665_c1 | 3300050513 | Bacteria | 2416 |
| 526 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 527 | nmdc:mga0a205_43692_c1 | 3300050515 | Bacteria | 4319 |
| 528 | Ga0495601_0000041 | 3300053077 | Bacteria | 79353 |
| 529 | Ga0495601_0000246 | 3300053077 | Bacteria | 28887 |
| 530 | Ga0495601_0011564 | 3300053077 | Bacteria | 5287 |
| 531 | Ga0495601_0102767 | 3300053077 | Bacteria | 1847 |
| 532 | Ga0495601_0387691 | 3300053077 | Bacteria | 906 |
| 533 | Ga0495612_0000149 | 3300053078 | Bacteria | 29381 |
| 534 | Ga0495612_0004092 | 3300053078 | Bacteria | 6043 |
| 535 | Ga0495612_0028033 | 3300053078 | Bacteria | 2266 |
| 536 | Ga0495612_0200826 | 3300053078 | Bacteria | 880 |
| 537 | Ga0495655_0000012 | 3300053083 | Bacteria | 92485 |
| 538 | Ga0495655_0041556 | 3300053083 | Bacteria | 1176 |
| 539 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 540 | Ga0495595_0000652 | 3300053084 | Bacteria | 13194 |
| 541 | Ga0495595_0015879 | 3300053084 | Bacteria | 3215 |
| 542 | Ga0495595_0329613 | 3300053084 | Bacteria | 769 |
| 543 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 544 | Ga0495619_0000041 | 3300053085 | Bacteria | 112824 |
| 545 | Ga0495619_0000143 | 3300053085 | Bacteria | 53216 |
| 546 | Ga0495619_0009926 | 3300053085 | Bacteria | 5996 |
| 547 | Ga0495619_0331783 | 3300053085 | Bacteria | 1053 |
| 548 | Ga0500583_0147121 | 3300053092 | Bacteria | 1172 |
| 549 | Ga0500595_087041 | 3300053119 | Bacteria | 908 |
| 550 | Ga0500614_000125 | 3300053123 | Bacteria | 18595 |
| 551 | Ga0500628_000014 | 3300053129 | Bacteria | 102838 |
| 552 | Ga0500658_0147680 | 3300053134 | Bacteria | 1058 |
| 553 | Ga0501084_0612395 | 3300054114 | Bacteria | 920 |
| 554 | Ga0501084_1283715 | 3300054114 | Unclassified | 614 |
| 555 | Ga0501082_0015708 | 3300060353 | Bacteria | 6513 |
| 556 | Ga0501082_0581555 | 3300060353 | Bacteria | 980 |
| 557 | Ga0501082_0881069 | 3300060353 | Bacteria | 783 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_1919451 | Ga0395901_1919451_70_498 | 129 |
| 2 | 3300006847 | Ga0075431_100011442 | Ga0075431_1000114426 | 147 |
| 3 | 3300006871 | Ga0075434_100024738 | Ga0075434_1000247386 | 147 |
| 4 | 3300006914 | Ga0075436_100560786 | Ga0075436_1005607862 | 147 |
| 5 | 3300007076 | Ga0075435_100202618 | Ga0075435_1002026183 | 147 |
| 6 | 3300009094 | Ga0111539_10067976 | Ga0111539_100679763 | 147 |
| 7 | 3300009147 | Ga0114129_10059127 | Ga0114129_100591276 | 147 |
| 8 | 3300027907 | Ga0207428_10062230 | Ga0207428_100622302 | 147 |
| 9 | 3300050507 | nmdc:mga05p37_55968_c1 | nmdc:mga05p37_55968_c1_3327_3809 | 147 |
| 10 | 3300050510 | nmdc:mga06r32_8550_c1 | nmdc:mga06r32_8550_c1_6412_6894 | 147 |
| 11 | 3300050511 | nmdc:mga08y16_21284_c2 | nmdc:mga08y16_21284_c2_527_1009 | 147 |
| 12 | 3300050512 | nmdc:mga0n895_11734_c1 | nmdc:mga0n895_11734_c1_1054_1536 | 147 |
| 13 | 3300050513 | nmdc:mga0rr50_87665_c1 | nmdc:mga0rr50_87665_c1_79_561 | 147 |
| 14 | 3300050515 | nmdc:mga0a205_43692_c1 | nmdc:mga0a205_43692_c1_656_1138 | 147 |
| 15 | 3300005337 | Ga0070682_100539397 | Ga0070682_1005393971 | 155 |
| 16 | 3300049586 | Ga0501070_0034838 | Ga0501070_0034838_401_874 | 155 |
| 17 | 3300005365 | Ga0070688_100043464 | Ga0070688_1000434643 | 156 |
| 18 | 3300005466 | Ga0070685_10000092 | Ga0070685_100000923 | 156 |
| 19 | 3300005548 | Ga0070665_100603457 | Ga0070665_1006034571 | 156 |
| 20 | 3300005937 | Ga0081455_10052747 | Ga0081455_100527473 | 156 |
| 21 | 3300014968 | Ga0157379_10165185 | Ga0157379_101651852 | 156 |
| 22 | 3300025900 | Ga0207710_10181282 | Ga0207710_101812822 | 156 |
| 23 | 3300025961 | Ga0207712_10402858 | Ga0207712_104028581 | 156 |
| 24 | 3300046536 | Ga0495587_0003143 | Ga0495587_0003143_5735_6208 | 156 |
| 25 | 3300046642 | Ga0495634_0013405 | Ga0495634_0013405_4376_4846 | 156 |
| 26 | 3300046692 | Ga0495671_0251249 | Ga0495671_0251249_359_829 | 156 |
| 27 | 3300047321 | Ga0495676_0005813 | Ga0495676_0005813_5415_5888 | 156 |
| 28 | 3300048903 | Ga0496100_0000032 | Ga0496100_0000032_5444_5917 | 156 |
| 29 | 3300048904 | Ga0496101_0000012 | Ga0496101_0000012_94124_94597 | 156 |
| 30 | 3300048905 | Ga0496102_0182497 | Ga0496102_0182497_389_859 | 156 |
| 31 | 3300048906 | Ga0496103_0276652 | Ga0496103_0276652_257_727 | 156 |
| 32 | 3300048906 | Ga0496103_0422725 | Ga0496103_0422725_202_672 | 156 |
| 33 | 3300048909 | Ga0496106_0000470 | Ga0496106_0000470_22332_22805 | 156 |
| 34 | 3300048910 | Ga0496107_0000031 | Ga0496107_0000031_5954_6427 | 156 |
| 35 | 3300048910 | Ga0496107_0854378 | Ga0496107_0854378_99_569 | 156 |
| 36 | 3300048916 | Ga0496113_0727332 | Ga0496113_0727332_71_544 | 156 |
| 37 | 3300048917 | Ga0496114_0000080 | Ga0496114_0000080_36385_36858 | 156 |
| 38 | 3300048917 | Ga0496114_0267643 | Ga0496114_0267643_426_899 | 156 |
| 39 | 3300048918 | Ga0496115_0000004 | Ga0496115_0000004_93232_93705 | 156 |
| 40 | 3300048918 | Ga0496115_0000104 | Ga0496115_0000104_78608_79081 | 156 |
| 41 | 3300048918 | Ga0496115_0491423 | Ga0496115_0491423_229_699 | 156 |
| 42 | 3300048919 | Ga0496116_0000500 | Ga0496116_0000500_43514_43984 | 156 |
| 43 | 3300048920 | Ga0496117_0058517 | Ga0496117_0058517_1891_2361 | 156 |
| 44 | 3300048920 | Ga0496117_0454479 | Ga0496117_0454479_78_548 | 156 |
| 45 | 3300048921 | Ga0496118_0018764 | Ga0496118_0018764_5351_5821 | 156 |
| 46 | 3300048921 | Ga0496118_0125217 | Ga0496118_0125217_902_1372 | 156 |
| 47 | 3300048921 | Ga0496118_0371483 | Ga0496118_0371483_162_632 | 156 |
| 48 | 3300048922 | Ga0496119_0036838 | Ga0496119_0036838_1590_2060 | 156 |
| 49 | 3300048922 | Ga0496119_0040316 | Ga0496119_0040316_882_1352 | 156 |
| 50 | 3300048923 | Ga0496120_0008224 | Ga0496120_0008224_2336_2806 | 156 |
| 51 | 3300048924 | Ga0496121_0021758 | Ga0496121_0021758_3932_4402 | 156 |
| 52 | 3300048924 | Ga0496121_0259346 | Ga0496121_0259346_602_1072 | 156 |
| 53 | 3300048924 | Ga0496121_0405538 | Ga0496121_0405538_277_747 | 156 |
| 54 | 3300048928 | Ga0496125_0038506 | Ga0496125_0038506_2465_2935 | 156 |
| 55 | 3300048929 | Ga0496126_0329647 | Ga0496126_0329647_692_1162 | 156 |
| 56 | 3300048929 | Ga0496126_0380782 | Ga0496126_0380782_269_739 | 156 |
| 57 | 3300049569 | Ga0501032_0286475 | Ga0501032_0286475_306_776 | 156 |
| 58 | 3300049581 | Ga0501047_0087996 | Ga0501047_0087996_563_1033 | 156 |
| 59 | 3300049586 | Ga0501070_0369112 | Ga0501070_0369112_48_518 | 156 |
| 60 | 3300049823 | Ga0501044_0319919 | Ga0501044_0319919_367_837 | 156 |
| 61 | 3300053078 | Ga0495612_0028033 | Ga0495612_0028033_1037_1510 | 156 |
| 62 | 3300053092 | Ga0500583_0147121 | Ga0500583_0147121_101_571 | 156 |
| 63 | 3300053119 | Ga0500595_087041 | Ga0500595_087041_178_648 | 156 |
| 64 | 3300053134 | Ga0500658_0147680 | Ga0500658_0147680_113_583 | 156 |
| 65 | 3300001977 | JGI24746J21847_1000380 | JGI24746J21847_10003805 | 157 |
| 66 | 3300002074 | JGI24748J21848_1000396 | JGI24748J21848_10003965 | 157 |
| 67 | 3300002239 | JGI24034J26672_10000160 | JGI24034J26672_100001605 | 157 |
| 68 | 3300002244 | JGI24742J22300_10009641 | JGI24742J22300_100096411 | 157 |
| 69 | 3300005329 | Ga0070683_100010098 | Ga0070683_1000100988 | 157 |
| 70 | 3300005329 | Ga0070683_100011494 | Ga0070683_1000114943 | 157 |
| 71 | 3300005329 | Ga0070683_100016073 | Ga0070683_1000160732 | 157 |
| 72 | 3300005329 | Ga0070683_100027424 | Ga0070683_1000274245 | 157 |
| 73 | 3300005329 | Ga0070683_100098772 | Ga0070683_1000987723 | 157 |
| 74 | 3300005329 | Ga0070683_100347727 | Ga0070683_1003477273 | 157 |
| 75 | 3300005331 | Ga0070670_100226127 | Ga0070670_1002261271 | 157 |
| 76 | 3300005333 | Ga0070677_10000075 | Ga0070677_100000755 | 157 |
| 77 | 3300005338 | Ga0068868_100003875 | Ga0068868_1000038755 | 157 |
| 78 | 3300005340 | Ga0070689_100305118 | Ga0070689_1003051182 | 157 |
| 79 | 3300005344 | Ga0070661_100000524 | Ga0070661_1000005249 | 157 |
| 80 | 3300005345 | Ga0070692_10117953 | Ga0070692_101179531 | 157 |
| 81 | 3300005347 | Ga0070668_100042034 | Ga0070668_1000420342 | 157 |
| 82 | 3300005347 | Ga0070668_100305930 | Ga0070668_1003059302 | 157 |
| 83 | 3300005347 | Ga0070668_100455260 | Ga0070668_1004552602 | 157 |
| 84 | 3300005354 | Ga0070675_100000008 | Ga0070675_10000000876 | 157 |
| 85 | 3300005355 | Ga0070671_101256541 | Ga0070671_1012565411 | 157 |
| 86 | 3300005356 | Ga0070674_100000047 | Ga0070674_10000004758 | 157 |
| 87 | 3300005356 | Ga0070674_100000105 | Ga0070674_10000010534 | 157 |
| 88 | 3300005364 | Ga0070673_100115152 | Ga0070673_1001151523 | 157 |
| 89 | 3300005365 | Ga0070688_100000151 | Ga0070688_1000001513 | 157 |
| 90 | 3300005366 | Ga0070659_100092521 | Ga0070659_1000925213 | 157 |
| 91 | 3300005366 | Ga0070659_100822131 | Ga0070659_1008221311 | 157 |
| 92 | 3300005367 | Ga0070667_100002491 | Ga0070667_1000024916 | 157 |
| 93 | 3300005367 | Ga0070667_100022130 | Ga0070667_1000221307 | 157 |
| 94 | 3300005367 | Ga0070667_100459792 | Ga0070667_1004597922 | 157 |
| 95 | 3300005435 | Ga0070714_100025876 | Ga0070714_1000258765 | 157 |
| 96 | 3300005436 | Ga0070713_100001587 | Ga0070713_1000015872 | 157 |
| 97 | 3300005439 | Ga0070711_100010236 | Ga0070711_1000102363 | 157 |
| 98 | 3300005439 | Ga0070711_100035451 | Ga0070711_1000354514 | 157 |
| 99 | 3300005455 | Ga0070663_100009347 | Ga0070663_1000093471 | 157 |
| 100 | 3300005455 | Ga0070663_100846578 | Ga0070663_1008465781 | 157 |
| 101 | 3300005456 | Ga0070678_100013711 | Ga0070678_1000137113 | 157 |
| 102 | 3300005456 | Ga0070678_100198218 | Ga0070678_1001982182 | 157 |
| 103 | 3300005458 | Ga0070681_10064130 | Ga0070681_100641301 | 157 |
| 104 | 3300005466 | Ga0070685_10002231 | Ga0070685_100022313 | 157 |
| 105 | 3300005530 | Ga0070679_100000804 | Ga0070679_10000080420 | 157 |
| 106 | 3300005530 | Ga0070679_100020824 | Ga0070679_1000208247 | 157 |
| 107 | 3300005535 | Ga0070684_100062642 | Ga0070684_1000626423 | 157 |
| 108 | 3300005535 | Ga0070684_100146206 | Ga0070684_1001462063 | 157 |
| 109 | 3300005535 | Ga0070684_100476029 | Ga0070684_1004760292 | 157 |
| 110 | 3300005535 | Ga0070684_101453701 | Ga0070684_1014537011 | 157 |
| 111 | 3300005539 | Ga0068853_100014352 | Ga0068853_1000143521 | 157 |
| 112 | 3300005539 | Ga0068853_100232363 | Ga0068853_1002323633 | 157 |
| 113 | 3300005539 | Ga0068853_100376159 | Ga0068853_1003761592 | 157 |
| 114 | 3300005543 | Ga0070672_100001255 | Ga0070672_10000125518 | 157 |
| 115 | 3300005544 | Ga0070686_100296421 | Ga0070686_1002964211 | 157 |
| 116 | 3300005547 | Ga0070693_100002159 | Ga0070693_1000021596 | 157 |
| 117 | 3300005548 | Ga0070665_100000128 | Ga0070665_10000012810 | 157 |
| 118 | 3300005548 | Ga0070665_100002491 | Ga0070665_1000024913 | 157 |
| 119 | 3300005548 | Ga0070665_100157060 | Ga0070665_1001570602 | 157 |
| 120 | 3300005548 | Ga0070665_100225941 | Ga0070665_1002259412 | 157 |
| 121 | 3300005548 | Ga0070665_100420946 | Ga0070665_1004209462 | 157 |
| 122 | 3300005549 | Ga0070704_100368844 | Ga0070704_1003688441 | 157 |
| 123 | 3300005549 | Ga0070704_101014756 | Ga0070704_1010147561 | 157 |
| 124 | 3300005563 | Ga0068855_100145972 | Ga0068855_1001459723 | 157 |
| 125 | 3300005563 | Ga0068855_100434410 | Ga0068855_1004344103 | 157 |
| 126 | 3300005564 | Ga0070664_100094706 | Ga0070664_1000947063 | 157 |
| 127 | 3300005564 | Ga0070664_100115747 | Ga0070664_1001157473 | 157 |
| 128 | 3300005578 | Ga0068854_100000123 | Ga0068854_1000001237 | 157 |
| 129 | 3300005614 | Ga0068856_100019149 | Ga0068856_1000191498 | 157 |
| 130 | 3300005614 | Ga0068856_100206002 | Ga0068856_1002060023 | 157 |
| 131 | 3300005614 | Ga0068856_100315286 | Ga0068856_1003152862 | 157 |
| 132 | 3300005614 | Ga0068856_100851730 | Ga0068856_1008517301 | 157 |
| 133 | 3300005614 | Ga0068856_101621381 | Ga0068856_1016213812 | 157 |
| 134 | 3300005616 | Ga0068852_100000050 | Ga0068852_1000000508 | 157 |
| 135 | 3300005616 | Ga0068852_100787226 | Ga0068852_1007872262 | 157 |
| 136 | 3300005718 | Ga0068866_10000006 | Ga0068866_1000000659 | 157 |
| 137 | 3300005718 | Ga0068866_10000124 | Ga0068866_1000012431 | 157 |
| 138 | 3300005718 | Ga0068866_10361900 | Ga0068866_103619002 | 157 |
| 139 | 3300005834 | Ga0068851_10001237 | Ga0068851_100012373 | 157 |
| 140 | 3300005841 | Ga0068863_100000039 | Ga0068863_10000003949 | 157 |
| 141 | 3300005841 | Ga0068863_100003181 | Ga0068863_10000318112 | 157 |
| 142 | 3300005842 | Ga0068858_100000354 | Ga0068858_10000035413 | 157 |
| 143 | 3300005842 | Ga0068858_100001452 | Ga0068858_1000014526 | 157 |
| 144 | 3300005842 | Ga0068858_100233866 | Ga0068858_1002338663 | 157 |
| 145 | 3300005842 | Ga0068858_100452807 | Ga0068858_1004528073 | 157 |
| 146 | 3300005842 | Ga0068858_101140294 | Ga0068858_1011402941 | 157 |
| 147 | 3300005844 | Ga0068862_100013835 | Ga0068862_1000138356 | 157 |
| 148 | 3300006038 | Ga0075365_10266720 | Ga0075365_102667202 | 157 |
| 149 | 3300006163 | Ga0070715_10000003 | Ga0070715_10000003109 | 157 |
| 150 | 3300006173 | Ga0070716_100182683 | Ga0070716_1001826833 | 157 |
| 151 | 3300006175 | Ga0070712_100019703 | Ga0070712_1000197033 | 157 |
| 152 | 3300006175 | Ga0070712_100544160 | Ga0070712_1005441602 | 157 |
| 153 | 3300006237 | Ga0097621_101284342 | Ga0097621_1012843422 | 157 |
| 154 | 3300006852 | Ga0075433_10000875 | Ga0075433_100008757 | 157 |
| 155 | 3300006914 | Ga0075436_100655048 | Ga0075436_1006550481 | 157 |
| 156 | 3300009093 | Ga0105240_10339563 | Ga0105240_103395633 | 157 |
| 157 | 3300009093 | Ga0105240_10852643 | Ga0105240_108526432 | 157 |
| 158 | 3300009098 | Ga0105245_10000012 | Ga0105245_10000012170 | 157 |
| 159 | 3300009098 | Ga0105245_10000067 | Ga0105245_1000006797 | 157 |
| 160 | 3300009098 | Ga0105245_10000246 | Ga0105245_1000024638 | 157 |
| 161 | 3300009098 | Ga0105245_10009989 | Ga0105245_100099897 | 157 |
| 162 | 3300009098 | Ga0105245_11798275 | Ga0105245_117982751 | 157 |
| 163 | 3300009101 | Ga0105247_10197438 | Ga0105247_101974383 | 157 |
| 164 | 3300009148 | Ga0105243_10009568 | Ga0105243_100095683 | 157 |
| 165 | 3300009148 | Ga0105243_10091763 | Ga0105243_100917633 | 157 |
| 166 | 3300009174 | Ga0105241_10248208 | Ga0105241_102482082 | 157 |
| 167 | 3300009174 | Ga0105241_10256321 | Ga0105241_102563211 | 157 |
| 168 | 3300009176 | Ga0105242_10000010 | Ga0105242_1000001080 | 157 |
| 169 | 3300009176 | Ga0105242_10149891 | Ga0105242_101498912 | 157 |
| 170 | 3300009177 | Ga0105248_10000307 | Ga0105248_100003073 | 157 |
| 171 | 3300009177 | Ga0105248_10260295 | Ga0105248_102602953 | 157 |
| 172 | 3300009177 | Ga0105248_12421266 | Ga0105248_124212661 | 157 |
| 173 | 3300009545 | Ga0105237_10169985 | Ga0105237_101699853 | 157 |
| 174 | 3300009551 | Ga0105238_10000014 | Ga0105238_1000001453 | 157 |
| 175 | 3300009551 | Ga0105238_11487729 | Ga0105238_114877291 | 157 |
| 176 | 3300009553 | Ga0105249_10000159 | Ga0105249_1000015980 | 157 |
| 177 | 3300009553 | Ga0105249_10070387 | Ga0105249_100703873 | 157 |
| 178 | 3300010159 | Ga0099796_10357347 | Ga0099796_103573471 | 157 |
| 179 | 3300010375 | Ga0105239_10232460 | Ga0105239_102324603 | 157 |
| 180 | 3300013102 | Ga0157371_10002341 | Ga0157371_1000234117 | 157 |
| 181 | 3300013104 | Ga0157370_10040358 | Ga0157370_100403585 | 157 |
| 182 | 3300013104 | Ga0157370_10316975 | Ga0157370_103169753 | 157 |
| 183 | 3300013105 | Ga0157369_10000222 | Ga0157369_1000022237 | 157 |
| 184 | 3300013296 | Ga0157374_10000281 | Ga0157374_1000028134 | 157 |
| 185 | 3300013296 | Ga0157374_11406981 | Ga0157374_114069811 | 157 |
| 186 | 3300013297 | Ga0157378_10009857 | Ga0157378_100098573 | 157 |
| 187 | 3300013306 | Ga0163162_10139140 | Ga0163162_101391403 | 157 |
| 188 | 3300013306 | Ga0163162_10641534 | Ga0163162_106415341 | 157 |
| 189 | 3300013307 | Ga0157372_10006714 | Ga0157372_100067147 | 157 |
| 190 | 3300013308 | Ga0157375_10000095 | Ga0157375_100000953 | 157 |
| 191 | 3300013308 | Ga0157375_10035586 | Ga0157375_100355863 | 157 |
| 192 | 3300013308 | Ga0157375_10071355 | Ga0157375_100713553 | 157 |
| 193 | 3300013308 | Ga0157375_11835863 | Ga0157375_118358631 | 157 |
| 194 | 3300013308 | Ga0157375_11902153 | Ga0157375_119021532 | 157 |
| 195 | 3300014325 | Ga0163163_10758016 | Ga0163163_107580162 | 157 |
| 196 | 3300014325 | Ga0163163_11356208 | Ga0163163_113562081 | 157 |
| 197 | 3300014325 | Ga0163163_11456178 | Ga0163163_114561782 | 157 |
| 198 | 3300014326 | Ga0157380_10000594 | Ga0157380_1000059418 | 157 |
| 199 | 3300014326 | Ga0157380_12078593 | Ga0157380_120785932 | 157 |
| 200 | 3300014745 | Ga0157377_10334854 | Ga0157377_103348542 | 157 |
| 201 | 3300014968 | Ga0157379_10013677 | Ga0157379_100136773 | 157 |
| 202 | 3300014969 | Ga0157376_10202790 | Ga0157376_102027901 | 157 |
| 203 | 3300014969 | Ga0157376_10259601 | Ga0157376_102596013 | 157 |
| 204 | 3300014969 | Ga0157376_10544287 | Ga0157376_105442872 | 157 |
| 205 | 3300017792 | Ga0163161_10000140 | Ga0163161_1000014011 | 157 |
| 206 | 3300017792 | Ga0163161_10072390 | Ga0163161_100723903 | 157 |
| 207 | 3300020070 | Ga0206356_11783605 | Ga0206356_117836051 | 157 |
| 208 | 3300020082 | Ga0206353_10708015 | Ga0206353_107080153 | 157 |
| 209 | 3300025893 | Ga0207682_10000217 | Ga0207682_1000021720 | 157 |
| 210 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001144 | 157 |
| 211 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003144 | 157 |
| 212 | 3300025899 | Ga0207642_10000004 | Ga0207642_10000004144 | 157 |
| 213 | 3300025899 | Ga0207642_10000152 | Ga0207642_100001528 | 157 |
| 214 | 3300025899 | Ga0207642_10262102 | Ga0207642_102621022 | 157 |
| 215 | 3300025899 | Ga0207642_10407673 | Ga0207642_104076732 | 157 |
| 216 | 3300025903 | Ga0207680_10055188 | Ga0207680_100551884 | 157 |
| 217 | 3300025905 | Ga0207685_10000003 | Ga0207685_10000003109 | 157 |
| 218 | 3300025909 | Ga0207705_10102922 | Ga0207705_101029223 | 157 |
| 219 | 3300025911 | Ga0207654_10106448 | Ga0207654_101064482 | 157 |
| 220 | 3300025912 | Ga0207707_10098235 | Ga0207707_100982353 | 157 |
| 221 | 3300025915 | Ga0207693_10023691 | Ga0207693_100236914 | 157 |
| 222 | 3300025915 | Ga0207693_10772702 | Ga0207693_107727021 | 157 |
| 223 | 3300025916 | Ga0207663_10005102 | Ga0207663_100051023 | 157 |
| 224 | 3300025916 | Ga0207663_10149444 | Ga0207663_101494443 | 157 |
| 225 | 3300025919 | Ga0207657_10875486 | Ga0207657_108754861 | 157 |
| 226 | 3300025920 | Ga0207649_10000610 | Ga0207649_100006103 | 157 |
| 227 | 3300025921 | Ga0207652_10000119 | Ga0207652_1000011914 | 157 |
| 228 | 3300025921 | Ga0207652_10000332 | Ga0207652_1000033232 | 157 |
| 229 | 3300025924 | Ga0207694_10000008 | Ga0207694_10000008185 | 157 |
| 230 | 3300025925 | Ga0207650_10448111 | Ga0207650_104481112 | 157 |
| 231 | 3300025926 | Ga0207659_10000049 | Ga0207659_1000004924 | 157 |
| 232 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011223 | 157 |
| 233 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012259 | 157 |
| 234 | 3300025927 | Ga0207687_10000503 | Ga0207687_1000050323 | 157 |
| 235 | 3300025927 | Ga0207687_10004483 | Ga0207687_100044834 | 157 |
| 236 | 3300025928 | Ga0207700_10000016 | Ga0207700_10000016199 | 157 |
| 237 | 3300025929 | Ga0207664_10012655 | Ga0207664_100126553 | 157 |
| 238 | 3300025932 | Ga0207690_10002643 | Ga0207690_100026434 | 157 |
| 239 | 3300025932 | Ga0207690_10062808 | Ga0207690_100628083 | 157 |
| 240 | 3300025932 | Ga0207690_10561362 | Ga0207690_105613622 | 157 |
| 241 | 3300025934 | Ga0207686_10000227 | Ga0207686_1000022714 | 157 |
| 242 | 3300025934 | Ga0207686_10043634 | Ga0207686_100436343 | 157 |
| 243 | 3300025935 | Ga0207709_10030724 | Ga0207709_100307243 | 157 |
| 244 | 3300025935 | Ga0207709_10078365 | Ga0207709_100783652 | 157 |
| 245 | 3300025936 | Ga0207670_10490313 | Ga0207670_104903132 | 157 |
| 246 | 3300025936 | Ga0207670_10969441 | Ga0207670_109694411 | 157 |
| 247 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002354 | 157 |
| 248 | 3300025937 | Ga0207669_10000765 | Ga0207669_100007653 | 157 |
| 249 | 3300025939 | Ga0207665_10116043 | Ga0207665_101160433 | 157 |
| 250 | 3300025940 | Ga0207691_10001495 | Ga0207691_100014957 | 157 |
| 251 | 3300025941 | Ga0207711_10000024 | Ga0207711_1000002443 | 157 |
| 252 | 3300025944 | Ga0207661_10001860 | Ga0207661_100018608 | 157 |
| 253 | 3300025944 | Ga0207661_10009394 | Ga0207661_100093946 | 157 |
| 254 | 3300025944 | Ga0207661_10037300 | Ga0207661_100373003 | 157 |
| 255 | 3300025944 | Ga0207661_10082420 | Ga0207661_100824203 | 157 |
| 256 | 3300025944 | Ga0207661_10230695 | Ga0207661_102306953 | 157 |
| 257 | 3300025944 | Ga0207661_10772679 | Ga0207661_107726792 | 157 |
| 258 | 3300025945 | Ga0207679_10078469 | Ga0207679_100784693 | 157 |
| 259 | 3300025945 | Ga0207679_10134505 | Ga0207679_101345053 | 157 |
| 260 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003202 | 157 |
| 261 | 3300025961 | Ga0207712_10003211 | Ga0207712_100032113 | 157 |
| 262 | 3300025972 | Ga0207668_10007500 | Ga0207668_100075006 | 157 |
| 263 | 3300025972 | Ga0207668_10143184 | Ga0207668_101431842 | 157 |
| 264 | 3300025972 | Ga0207668_10278908 | Ga0207668_102789082 | 157 |
| 265 | 3300025972 | Ga0207668_10503023 | Ga0207668_105030233 | 157 |
| 266 | 3300025981 | Ga0207640_10000040 | Ga0207640_1000004094 | 157 |
| 267 | 3300025981 | Ga0207640_10045984 | Ga0207640_100459843 | 157 |
| 268 | 3300025986 | Ga0207658_10000871 | Ga0207658_1000087127 | 157 |
| 269 | 3300025986 | Ga0207658_10014542 | Ga0207658_100145426 | 157 |
| 270 | 3300025986 | Ga0207658_10724983 | Ga0207658_107249832 | 157 |
| 271 | 3300026023 | Ga0207677_10000787 | Ga0207677_1000078715 | 157 |
| 272 | 3300026023 | Ga0207677_10002766 | Ga0207677_100027665 | 157 |
| 273 | 3300026035 | Ga0207703_10000028 | Ga0207703_1000002859 | 157 |
| 274 | 3300026035 | Ga0207703_10000185 | Ga0207703_1000018552 | 157 |
| 275 | 3300026035 | Ga0207703_10438661 | Ga0207703_104386612 | 157 |
| 276 | 3300026041 | Ga0207639_10009852 | Ga0207639_100098522 | 157 |
| 277 | 3300026041 | Ga0207639_10265008 | Ga0207639_102650082 | 157 |
| 278 | 3300026041 | Ga0207639_10351258 | Ga0207639_103512581 | 157 |
| 279 | 3300026041 | Ga0207639_10361023 | Ga0207639_103610233 | 157 |
| 280 | 3300026067 | Ga0207678_10000953 | Ga0207678_1000095317 | 157 |
| 281 | 3300026067 | Ga0207678_10848147 | Ga0207678_108481472 | 157 |
| 282 | 3300026075 | Ga0207708_10765206 | Ga0207708_107652062 | 157 |
| 283 | 3300026075 | Ga0207708_10960104 | Ga0207708_109601042 | 157 |
| 284 | 3300026078 | Ga0207702_10001168 | Ga0207702_100011688 | 157 |
| 285 | 3300026078 | Ga0207702_10008030 | Ga0207702_100080302 | 157 |
| 286 | 3300026078 | Ga0207702_10040826 | Ga0207702_100408263 | 157 |
| 287 | 3300026078 | Ga0207702_10722281 | Ga0207702_107222812 | 157 |
| 288 | 3300026078 | Ga0207702_11632617 | Ga0207702_116326171 | 157 |
| 289 | 3300026088 | Ga0207641_10000072 | Ga0207641_1000007237 | 157 |
| 290 | 3300026116 | Ga0207674_10162179 | Ga0207674_101621792 | 157 |
| 291 | 3300026121 | Ga0207683_10155832 | Ga0207683_101558323 | 157 |
| 292 | 3300026121 | Ga0207683_10348842 | Ga0207683_103488421 | 157 |
| 293 | 3300026121 | Ga0207683_10370228 | Ga0207683_103702283 | 157 |
| 294 | 3300026142 | Ga0207698_10000009 | Ga0207698_10000009119 | 157 |
| 295 | 3300026142 | Ga0207698_10608688 | Ga0207698_106086881 | 157 |
| 296 | 3300028379 | Ga0268266_10000023 | Ga0268266_1000002390 | 157 |
| 297 | 3300028379 | Ga0268266_10001616 | Ga0268266_100016165 | 157 |
| 298 | 3300028379 | Ga0268266_10001763 | Ga0268266_100017635 | 157 |
| 299 | 3300028379 | Ga0268266_10225668 | Ga0268266_102256683 | 157 |
| 300 | 3300028379 | Ga0268266_10439078 | Ga0268266_104390782 | 157 |
| 301 | 3300028380 | Ga0268265_10008225 | Ga0268265_100082256 | 157 |
| 302 | 3300028381 | Ga0268264_10264461 | Ga0268264_102644613 | 157 |
| 303 | 3300028556 | Ga0265337_1000041 | Ga0265337_100004149 | 157 |
| 304 | 3300028558 | Ga0265326_10000015 | Ga0265326_10000015122 | 157 |
| 305 | 3300028563 | Ga0265319_1063361 | Ga0265319_10633612 | 157 |
| 306 | 3300028653 | Ga0265323_10079655 | Ga0265323_100796552 | 157 |
| 307 | 3300028654 | Ga0265322_10000003 | Ga0265322_1000000357 | 157 |
| 308 | 3300028666 | Ga0265336_10005910 | Ga0265336_100059104 | 157 |
| 309 | 3300029957 | Ga0265324_10000907 | Ga0265324_100009078 | 157 |
| 310 | 3300031238 | Ga0265332_10126602 | Ga0265332_101266021 | 157 |
| 311 | 3300031239 | Ga0265328_10001369 | Ga0265328_100013696 | 157 |
| 312 | 3300031240 | Ga0265320_10000001 | Ga0265320_1000000157 | 157 |
| 313 | 3300031249 | Ga0265339_10017679 | Ga0265339_100176793 | 157 |
| 314 | 3300031250 | Ga0265331_10009641 | Ga0265331_100096414 | 157 |
| 315 | 3300031251 | Ga0265327_10000003 | Ga0265327_1000000357 | 157 |
| 316 | 3300031344 | Ga0265316_10024452 | Ga0265316_100244523 | 157 |
| 317 | 3300031711 | Ga0265314_10020220 | Ga0265314_100202205 | 157 |
| 318 | 3300032126 | Ga0307415_100093025 | Ga0307415_1000930253 | 157 |
| 319 | 3300036401 | Ga0373937_0023647 | Ga0373937_0023647_3091_3564 | 157 |
| 320 | 3300036401 | Ga0373937_0070670 | Ga0373937_0070670_1424_1897 | 157 |
| 321 | 3300038443 | Ga0395901_0848828 | Ga0395901_0848828_16_489 | 157 |
| 322 | 3300041460 | Ga0451802_0438050 | Ga0451802_0438050_155_631 | 157 |
| 323 | 3300041486 | Ga0451807_1796160 | Ga0451807_1796160_70_543 | 157 |
| 324 | 3300041486 | Ga0451807_2307049 | Ga0451807_2307049_154_630 | 157 |
| 325 | 3300041491 | Ga0451833_0634948 | Ga0451833_0634948_985_1461 | 157 |
| 326 | 3300041496 | Ga0451839_0844376 | Ga0451839_0844376_296_772 | 157 |
| 327 | 3300041512 | Ga0451853_3731523 | Ga0451853_3731523_166_639 | 157 |
| 328 | 3300044694 | Ga0466963_0000002 | Ga0466963_0000002_54976_55449 | 157 |
| 329 | 3300044842 | Ga0466957_0016522 | Ga0466957_0016522_1793_2269 | 157 |
| 330 | 3300044842 | Ga0466957_0155944 | Ga0466957_0155944_821_1294 | 157 |
| 331 | 3300045836 | Ga0466958_0021909 | Ga0466958_0021909_1097_1570 | 157 |
| 332 | 3300045976 | Ga0466967_0000020 | Ga0466967_0000020_24340_24813 | 157 |
| 333 | 3300046454 | Ga0495592_0000999 | Ga0495592_0000999_11995_12468 | 157 |
| 334 | 3300046454 | Ga0495592_0387725 | Ga0495592_0387725_217_690 | 157 |
| 335 | 3300046455 | Ga0495603_0000057 | Ga0495603_0000057_40446_40919 | 157 |
| 336 | 3300046455 | Ga0495603_0002491 | Ga0495603_0002491_946_1419 | 157 |
| 337 | 3300046455 | Ga0495603_0003192 | Ga0495603_0003192_7137_7610 | 157 |
| 338 | 3300046459 | Ga0495629_0000028 | Ga0495629_0000028_111556_112029 | 157 |
| 339 | 3300046459 | Ga0495629_0004331 | Ga0495629_0004331_2400_2876 | 157 |
| 340 | 3300046459 | Ga0495629_0389110 | Ga0495629_0389110_108_581 | 157 |
| 341 | 3300046459 | Ga0495629_0463522 | Ga0495629_0463522_338_811 | 157 |
| 342 | 3300046461 | Ga0495641_0001934 | Ga0495641_0001934_566_1039 | 157 |
| 343 | 3300046461 | Ga0495641_0067435 | Ga0495641_0067435_1086_1559 | 157 |
| 344 | 3300046462 | Ga0495651_0146464 | Ga0495651_0146464_550_1023 | 157 |
| 345 | 3300046463 | Ga0495653_0096141 | Ga0495653_0096141_481_954 | 157 |
| 346 | 3300046463 | Ga0495653_0186428 | Ga0495653_0186428_496_969 | 157 |
| 347 | 3300046463 | Ga0495653_0223183 | Ga0495653_0223183_188_661 | 157 |
| 348 | 3300046473 | Ga0495582_0000048 | Ga0495582_0000048_58255_58728 | 157 |
| 349 | 3300046476 | Ga0495662_0000659 | Ga0495662_0000659_7537_8010 | 157 |
| 350 | 3300046476 | Ga0495662_0018027 | Ga0495662_0018027_2882_3355 | 157 |
| 351 | 3300046476 | Ga0495662_0053835 | Ga0495662_0053835_1010_1483 | 157 |
| 352 | 3300046477 | Ga0495664_0343379 | Ga0495664_0343379_159_632 | 157 |
| 353 | 3300046507 | Ga0495606_0000294 | Ga0495606_0000294_73975_74448 | 157 |
| 354 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_366036_366509 | 157 |
| 355 | 3300046511 | Ga0495608_0004024 | Ga0495608_0004024_2356_2829 | 157 |
| 356 | 3300046511 | Ga0495608_0119306 | Ga0495608_0119306_483_956 | 157 |
| 357 | 3300046516 | Ga0495628_0001728 | Ga0495628_0001728_17069_17545 | 157 |
| 358 | 3300046516 | Ga0495628_0011273 | Ga0495628_0011273_6793_7266 | 157 |
| 359 | 3300046516 | Ga0495628_0011510 | Ga0495628_0011510_2742_3215 | 157 |
| 360 | 3300046516 | Ga0495628_0232549 | Ga0495628_0232549_712_1185 | 157 |
| 361 | 3300046516 | Ga0495628_0673367 | Ga0495628_0673367_70_543 | 157 |
| 362 | 3300046517 | Ga0495630_0000165 | Ga0495630_0000165_43144_43617 | 157 |
| 363 | 3300046517 | Ga0495630_0037128 | Ga0495630_0037128_2477_2950 | 157 |
| 364 | 3300046517 | Ga0495630_0485403 | Ga0495630_0485403_422_895 | 157 |
| 365 | 3300046520 | Ga0495637_0262121 | Ga0495637_0262121_59_532 | 157 |
| 366 | 3300046523 | Ga0495644_0001304 | Ga0495644_0001304_9560_10036 | 157 |
| 367 | 3300046529 | Ga0495652_0047825 | Ga0495652_0047825_402_875 | 157 |
| 368 | 3300046529 | Ga0495652_0131103 | Ga0495652_0131103_94_567 | 157 |
| 369 | 3300046533 | Ga0495640_0040475 | Ga0495640_0040475_694_1167 | 157 |
| 370 | 3300046533 | Ga0495640_0050074 | Ga0495640_0050074_1398_1871 | 157 |
| 371 | 3300046535 | Ga0495586_0032837 | Ga0495586_0032837_2234_2707 | 157 |
| 372 | 3300046543 | Ga0495645_0001401 | Ga0495645_0001401_6942_7415 | 157 |
| 373 | 3300046543 | Ga0495645_0017457 | Ga0495645_0017457_2083_2556 | 157 |
| 374 | 3300046559 | Ga0495667_0000057 | Ga0495667_0000057_16307_16780 | 157 |
| 375 | 3300046559 | Ga0495667_0289804 | Ga0495667_0289804_272_745 | 157 |
| 376 | 3300046616 | Ga0495668_0277651 | Ga0495668_0277651_101_574 | 157 |
| 377 | 3300046642 | Ga0495634_0000555 | Ga0495634_0000555_14915_15388 | 157 |
| 378 | 3300046642 | Ga0495634_0055729 | Ga0495634_0055729_1869_2342 | 157 |
| 379 | 3300046674 | Ga0495588_0000195 | Ga0495588_0000195_5745_6218 | 157 |
| 380 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_366716_367189 | 157 |
| 381 | 3300046675 | Ga0495657_0079405 | Ga0495657_0079405_944_1417 | 157 |
| 382 | 3300046675 | Ga0495657_0096415 | Ga0495657_0096415_849_1322 | 157 |
| 383 | 3300046678 | Ga0495599_0008656 | Ga0495599_0008656_1206_1679 | 157 |
| 384 | 3300046679 | Ga0495623_0208494 | Ga0495623_0208494_80_553 | 157 |
| 385 | 3300046679 | Ga0495623_0528165 | Ga0495623_0528165_29_505 | 157 |
| 386 | 3300046679 | Ga0495623_0570039 | Ga0495623_0570039_85_558 | 157 |
| 387 | 3300046681 | Ga0495647_0000020 | Ga0495647_0000020_69569_70042 | 157 |
| 388 | 3300046681 | Ga0495647_0002424 | Ga0495647_0002424_3943_4416 | 157 |
| 389 | 3300046681 | Ga0495647_0003249 | Ga0495647_0003249_4304_4777 | 157 |
| 390 | 3300046683 | Ga0495658_0000031 | Ga0495658_0000031_58218_58691 | 157 |
| 391 | 3300046684 | Ga0495669_0000064 | Ga0495669_0000064_49621_50094 | 157 |
| 392 | 3300046684 | Ga0495669_0186990 | Ga0495669_0186990_25_498 | 157 |
| 393 | 3300046684 | Ga0495669_0210253 | Ga0495669_0210253_10_486 | 157 |
| 394 | 3300046689 | Ga0495613_0000003 | Ga0495613_0000003_248319_248792 | 157 |
| 395 | 3300046689 | Ga0495613_0000500 | Ga0495613_0000500_10623_11096 | 157 |
| 396 | 3300046689 | Ga0495613_0185425 | Ga0495613_0185425_201_674 | 157 |
| 397 | 3300046690 | Ga0495624_0000087 | Ga0495624_0000087_7293_7766 | 157 |
| 398 | 3300046690 | Ga0495624_0000652 | Ga0495624_0000652_18312_18785 | 157 |
| 399 | 3300046694 | Ga0495649_0008654 | Ga0495649_0008654_3895_4368 | 157 |
| 400 | 3300046809 | Ga0495600_0020410 | Ga0495600_0020410_1212_1685 | 157 |
| 401 | 3300046809 | Ga0495600_0036363 | Ga0495600_0036363_782_1255 | 157 |
| 402 | 3300046809 | Ga0495600_0067052 | Ga0495600_0067052_17_490 | 157 |
| 403 | 3300046809 | Ga0495600_0150174 | Ga0495600_0150174_239_712 | 157 |
| 404 | 3300047317 | Ga0495604_0001970 | Ga0495604_0001970_14976_15449 | 157 |
| 405 | 3300047317 | Ga0495604_0002487 | Ga0495604_0002487_11727_12200 | 157 |
| 406 | 3300047317 | Ga0495604_0148075 | Ga0495604_0148075_833_1306 | 157 |
| 407 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_248017_248490 | 157 |
| 408 | 3300047320 | Ga0495672_0024890 | Ga0495672_0024890_2836_3312 | 157 |
| 409 | 3300047321 | Ga0495676_0000263 | Ga0495676_0000263_16801_17274 | 157 |
| 410 | 3300047321 | Ga0495676_0067438 | Ga0495676_0067438_1199_1675 | 157 |
| 411 | 3300047321 | Ga0495676_0121108 | Ga0495676_0121108_692_1165 | 157 |
| 412 | 3300047321 | Ga0495676_0240941 | Ga0495676_0240941_638_1111 | 157 |
| 413 | 3300047322 | Ga0495680_0005894 | Ga0495680_0005894_7754_8227 | 157 |
| 414 | 3300047322 | Ga0495680_0017444 | Ga0495680_0017444_2079_2552 | 157 |
| 415 | 3300047322 | Ga0495680_0017984 | Ga0495680_0017984_4694_5170 | 157 |
| 416 | 3300047322 | Ga0495680_0363471 | Ga0495680_0363471_242_715 | 157 |
| 417 | 3300047444 | Ga0495675_0000696 | Ga0495675_0000696_14817_15290 | 157 |
| 418 | 3300047472 | Ga0495686_0059362 | Ga0495686_0059362_1062_1535 | 157 |
| 419 | 3300047673 | Ga0495593_0374673 | Ga0495593_0374673_82_555 | 157 |
| 420 | 3300048088 | Ga0495602_0002467 | Ga0495602_0002467_17227_17703 | 157 |
| 421 | 3300048088 | Ga0495602_0007803 | Ga0495602_0007803_1097_1570 | 157 |
| 422 | 3300048088 | Ga0495602_0057467 | Ga0495602_0057467_739_1212 | 157 |
| 423 | 3300048088 | Ga0495602_0166800 | Ga0495602_0166800_191_664 | 157 |
| 424 | 3300048088 | Ga0495602_0541469 | Ga0495602_0541469_62_535 | 157 |
| 425 | 3300048088 | Ga0495602_0878383 | Ga0495602_0878383_39_512 | 157 |
| 426 | 3300048903 | Ga0496100_0000004 | Ga0496100_0000004_129037_129510 | 157 |
| 427 | 3300048904 | Ga0496101_0000007 | Ga0496101_0000007_129037_129510 | 157 |
| 428 | 3300048904 | Ga0496101_0851716 | Ga0496101_0851716_25_507 | 157 |
| 429 | 3300048905 | Ga0496102_0000021 | Ga0496102_0000021_239158_239634 | 157 |
| 430 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_356273_356749 | 157 |
| 431 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_302527_303003 | 157 |
| 432 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_482853_483326 | 157 |
| 433 | 3300048907 | Ga0496104_0002073 | Ga0496104_0002073_11332_11805 | 157 |
| 434 | 3300048907 | Ga0496104_0038835 | Ga0496104_0038835_1986_2468 | 157 |
| 435 | 3300048907 | Ga0496104_0092123 | Ga0496104_0092123_475_948 | 157 |
| 436 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_1025176_1025652 | 157 |
| 437 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_702795_703268 | 157 |
| 438 | 3300048908 | Ga0496105_0009688 | Ga0496105_0009688_5050_5523 | 157 |
| 439 | 3300048908 | Ga0496105_0066404 | Ga0496105_0066404_1502_1984 | 157 |
| 440 | 3300048908 | Ga0496105_0098035 | Ga0496105_0098035_894_1367 | 157 |
| 441 | 3300048909 | Ga0496106_0000004 | Ga0496106_0000004_90451_90924 | 157 |
| 442 | 3300048909 | Ga0496106_0000096 | Ga0496106_0000096_14993_15466 | 157 |
| 443 | 3300048910 | Ga0496107_0000001 | Ga0496107_0000001_129037_129510 | 157 |
| 444 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_549932_550405 | 157 |
| 445 | 3300048911 | Ga0496108_0000012 | Ga0496108_0000012_97470_97946 | 157 |
| 446 | 3300048911 | Ga0496108_0004840 | Ga0496108_0004840_7321_7794 | 157 |
| 447 | 3300048911 | Ga0496108_0014174 | Ga0496108_0014174_5279_5752 | 157 |
| 448 | 3300048911 | Ga0496108_0353449 | Ga0496108_0353449_796_1269 | 157 |
| 449 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_549894_550367 | 157 |
| 450 | 3300048912 | Ga0496109_0000106 | Ga0496109_0000106_6949_7422 | 157 |
| 451 | 3300048912 | Ga0496109_0003327 | Ga0496109_0003327_4588_5064 | 157 |
| 452 | 3300048912 | Ga0496109_0321988 | Ga0496109_0321988_335_808 | 157 |
| 453 | 3300048912 | Ga0496109_0359242 | Ga0496109_0359242_434_907 | 157 |
| 454 | 3300048912 | Ga0496109_0804154 | Ga0496109_0804154_71_553 | 157 |
| 455 | 3300048912 | Ga0496109_1010087 | Ga0496109_1010087_195_668 | 157 |
| 456 | 3300048913 | Ga0496110_0014901 | Ga0496110_0014901_5336_5809 | 157 |
| 457 | 3300048913 | Ga0496110_0029771 | Ga0496110_0029771_671_1144 | 157 |
| 458 | 3300048913 | Ga0496110_0103834 | Ga0496110_0103834_846_1319 | 157 |
| 459 | 3300048913 | Ga0496110_0112254 | Ga0496110_0112254_1562_2035 | 157 |
| 460 | 3300048913 | Ga0496110_1434511 | Ga0496110_1434511_23_496 | 157 |
| 461 | 3300048914 | Ga0496111_0000001 | Ga0496111_0000001_88224_88697 | 157 |
| 462 | 3300048914 | Ga0496111_0036458 | Ga0496111_0036458_1163_1636 | 157 |
| 463 | 3300048914 | Ga0496111_0683239 | Ga0496111_0683239_231_704 | 157 |
| 464 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_386498_386983 | 157 |
| 465 | 3300048915 | Ga0496112_0000762 | Ga0496112_0000762_860_1333 | 157 |
| 466 | 3300048915 | Ga0496112_0157492 | Ga0496112_0157492_1015_1488 | 157 |
| 467 | 3300048915 | Ga0496112_1316127 | Ga0496112_1316127_47_520 | 157 |
| 468 | 3300048916 | Ga0496113_0000317 | Ga0496113_0000317_16726_17199 | 157 |
| 469 | 3300048916 | Ga0496113_0032061 | Ga0496113_0032061_198_674 | 157 |
| 470 | 3300048916 | Ga0496113_0170718 | Ga0496113_0170718_339_812 | 157 |
| 471 | 3300048916 | Ga0496113_0430122 | Ga0496113_0430122_347_820 | 157 |
| 472 | 3300048917 | Ga0496114_0074984 | Ga0496114_0074984_61_534 | 157 |
| 473 | 3300048917 | Ga0496114_0593221 | Ga0496114_0593221_210_683 | 157 |
| 474 | 3300048918 | Ga0496115_0108391 | Ga0496115_0108391_788_1261 | 157 |
| 475 | 3300048922 | Ga0496119_0002689 | Ga0496119_0002689_1133_1615 | 157 |
| 476 | 3300048924 | Ga0496121_0145946 | Ga0496121_0145946_952_1434 | 157 |
| 477 | 3300048927 | Ga0496124_0019847 | Ga0496124_0019847_2335_2817 | 157 |
| 478 | 3300048928 | Ga0496125_0100923 | Ga0496125_0100923_1502_1975 | 157 |
| 479 | 3300048928 | Ga0496125_0122629 | Ga0496125_0122629_1117_1599 | 157 |
| 480 | 3300048928 | Ga0496125_0150150 | Ga0496125_0150150_733_1215 | 157 |
| 481 | 3300048929 | Ga0496126_0045261 | Ga0496126_0045261_727_1209 | 157 |
| 482 | 3300048929 | Ga0496126_0486175 | Ga0496126_0486175_226_720 | 157 |
| 483 | 3300049568 | Ga0501031_0001419 | Ga0501031_0001419_5969_6451 | 157 |
| 484 | 3300049568 | Ga0501031_0628606 | Ga0501031_0628606_201_674 | 157 |
| 485 | 3300049569 | Ga0501032_0007104 | Ga0501032_0007104_1776_2258 | 157 |
| 486 | 3300049570 | Ga0501033_0001230 | Ga0501033_0001230_822_1304 | 157 |
| 487 | 3300049571 | Ga0501034_0142713 | Ga0501034_0142713_198_680 | 157 |
| 488 | 3300049571 | Ga0501034_1002042 | Ga0501034_1002042_130_612 | 157 |
| 489 | 3300049572 | Ga0501036_0002324 | Ga0501036_0002324_6010_6492 | 157 |
| 490 | 3300049573 | Ga0501037_0009222 | Ga0501037_0009222_6290_6772 | 157 |
| 491 | 3300049574 | Ga0501038_0003498 | Ga0501038_0003498_5746_6228 | 157 |
| 492 | 3300049575 | Ga0501039_0117898 | Ga0501039_0117898_1082_1564 | 157 |
| 493 | 3300049575 | Ga0501039_0225757 | Ga0501039_0225757_989_1462 | 157 |
| 494 | 3300049576 | Ga0501040_0088651 | Ga0501040_0088651_1343_1825 | 157 |
| 495 | 3300049576 | Ga0501040_0282803 | Ga0501040_0282803_52_525 | 157 |
| 496 | 3300049577 | Ga0501041_0464774 | Ga0501041_0464774_275_748 | 157 |
| 497 | 3300049578 | Ga0501042_0085688 | Ga0501042_0085688_519_1001 | 157 |
| 498 | 3300049579 | Ga0501043_0008013 | Ga0501043_0008013_1635_2117 | 157 |
| 499 | 3300049580 | Ga0501046_0013436 | Ga0501046_0013436_5808_6290 | 157 |
| 500 | 3300049581 | Ga0501047_0003396 | Ga0501047_0003396_5985_6467 | 157 |
| 501 | 3300049581 | Ga0501047_0050207 | Ga0501047_0050207_1150_1632 | 157 |
| 502 | 3300049581 | Ga0501047_0104712 | Ga0501047_0104712_1470_1964 | 157 |
| 503 | 3300049582 | Ga0501048_0006756 | Ga0501048_0006756_6596_7078 | 157 |
| 504 | 3300049582 | Ga0501048_0096970 | Ga0501048_0096970_1298_1792 | 157 |
| 505 | 3300049583 | Ga0501067_0128593 | Ga0501067_0128593_783_1265 | 157 |
| 506 | 3300049584 | Ga0501068_0188838 | Ga0501068_0188838_529_1011 | 157 |
| 507 | 3300049585 | Ga0501069_0226497 | Ga0501069_0226497_320_814 | 157 |
| 508 | 3300049585 | Ga0501069_0299059 | Ga0501069_0299059_33_515 | 157 |
| 509 | 3300049585 | Ga0501069_0372968 | Ga0501069_0372968_117_611 | 157 |
| 510 | 3300049586 | Ga0501070_0008745 | Ga0501070_0008745_6429_6911 | 157 |
| 511 | 3300049586 | Ga0501070_0407342 | Ga0501070_0407342_421_903 | 157 |
| 512 | 3300049586 | Ga0501070_1444887 | Ga0501070_1444887_14_508 | 157 |
| 513 | 3300049587 | Ga0501071_0139456 | Ga0501071_0139456_564_1058 | 157 |
| 514 | 3300049587 | Ga0501071_0387094 | Ga0501071_0387094_191_676 | 157 |
| 515 | 3300049588 | Ga0501072_0070995 | Ga0501072_0070995_912_1394 | 157 |
| 516 | 3300049588 | Ga0501072_0091493 | Ga0501072_0091493_1789_2262 | 157 |
| 517 | 3300049589 | Ga0501073_0036554 | Ga0501073_0036554_2508_2990 | 157 |
| 518 | 3300049590 | Ga0501074_0024156 | Ga0501074_0024156_3680_4162 | 157 |
| 519 | 3300049590 | Ga0501074_0072580 | Ga0501074_0072580_1533_2015 | 157 |
| 520 | 3300049590 | Ga0501074_0219286 | Ga0501074_0219286_714_1208 | 157 |
| 521 | 3300049591 | Ga0501075_0004075 | Ga0501075_0004075_3284_3760 | 157 |
| 522 | 3300049741 | Ga0501079_0091109 | Ga0501079_0091109_1346_1828 | 157 |
| 523 | 3300049741 | Ga0501079_0208730 | Ga0501079_0208730_958_1452 | 157 |
| 524 | 3300049742 | Ga0501080_0102745 | Ga0501080_0102745_539_1021 | 157 |
| 525 | 3300049742 | Ga0501080_0265644 | Ga0501080_0265644_511_1005 | 157 |
| 526 | 3300049744 | Ga0501083_0009230 | Ga0501083_0009230_526_1008 | 157 |
| 527 | 3300049744 | Ga0501083_0147141 | Ga0501083_0147141_306_800 | 157 |
| 528 | 3300049822 | Ga0501035_0001056 | Ga0501035_0001056_6485_6967 | 157 |
| 529 | 3300049823 | Ga0501044_0004552 | Ga0501044_0004552_6556_7038 | 157 |
| 530 | 3300049823 | Ga0501044_0049531 | Ga0501044_0049531_1486_1980 | 157 |
| 531 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_53807_54280 | 157 |
| 532 | 3300053077 | Ga0495601_0000041 | Ga0495601_0000041_25352_25825 | 157 |
| 533 | 3300053077 | Ga0495601_0000246 | Ga0495601_0000246_106_579 | 157 |
| 534 | 3300053077 | Ga0495601_0011564 | Ga0495601_0011564_4674_5147 | 157 |
| 535 | 3300053077 | Ga0495601_0102767 | Ga0495601_0102767_1013_1486 | 157 |
| 536 | 3300053077 | Ga0495601_0387691 | Ga0495601_0387691_181_654 | 157 |
| 537 | 3300053078 | Ga0495612_0000149 | Ga0495612_0000149_7926_8399 | 157 |
| 538 | 3300053078 | Ga0495612_0004092 | Ga0495612_0004092_2246_2719 | 157 |
| 539 | 3300053078 | Ga0495612_0200826 | Ga0495612_0200826_87_560 | 157 |
| 540 | 3300053083 | Ga0495655_0000012 | Ga0495655_0000012_41317_41793 | 157 |
| 541 | 3300053083 | Ga0495655_0041556 | Ga0495655_0041556_318_791 | 157 |
| 542 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_44770_45243 | 157 |
| 543 | 3300053084 | Ga0495595_0000652 | Ga0495595_0000652_10552_11025 | 157 |
| 544 | 3300053084 | Ga0495595_0015879 | Ga0495595_0015879_805_1278 | 157 |
| 545 | 3300053084 | Ga0495595_0329613 | Ga0495595_0329613_65_538 | 157 |
| 546 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_3448_3921 | 157 |
| 547 | 3300053085 | Ga0495619_0000041 | Ga0495619_0000041_93523_93996 | 157 |
| 548 | 3300053085 | Ga0495619_0000143 | Ga0495619_0000143_7974_8447 | 157 |
| 549 | 3300053085 | Ga0495619_0009926 | Ga0495619_0009926_3143_3616 | 157 |
| 550 | 3300053085 | Ga0495619_0331783 | Ga0495619_0331783_329_802 | 157 |
| 551 | 3300053123 | Ga0500614_000125 | Ga0500614_000125_4183_4656 | 157 |
| 552 | 3300053129 | Ga0500628_000014 | Ga0500628_000014_61981_62457 | 157 |
| 553 | 3300054114 | Ga0501084_0612395 | Ga0501084_0612395_237_719 | 157 |
| 554 | 3300054114 | Ga0501084_1283715 | Ga0501084_1283715_34_525 | 157 |
| 555 | 3300060353 | Ga0501082_0015708 | Ga0501082_0015708_499_981 | 157 |
| 556 | 3300060353 | Ga0501082_0581555 | Ga0501082_0581555_162_635 | 157 |
| 557 | 3300060353 | Ga0501082_0881069 | Ga0501082_0881069_263_736 | 157 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z8o-assembly1.cif.gz_A | structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis | 0.8209 | 5 | 148 |
| 3tfz-assembly1.cif.gz_B | crystal structure of zhui aromatase/cyclase from streptomcyes sp. r1128 | 0.8128 | 2 | 145 |
| 2d4r-assembly1.cif.gz_A | crystal structure of ttha0849 from thermus thermophilus hb8 | 0.802 | 4 | 148 |
| 5z8o-assembly1.cif.gz_A | structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis | 0.8007 | 5 | 148 |
| 2d4r-assembly1.cif.gz_A | crystal structure of ttha0849 from thermus thermophilus hb8 | 0.7872 | 4 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N657_19_160_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8585 | 6 | 147 | 3.30.530.20 |
| af_L7N657_19_160_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8147 | 6 | 147 | 3.30.530.20 |
| af_I6X9Y7_1_146_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8112 | 2 | 150 | 3.30.530.20 |
| af_Q54GT2_2_271_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8071 | 35 | 69 | 3.50.50.60 |
| 2d4rA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8057 | 4 | 148 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1BDU2-F1-model_v4 | SRPBCC family protein | 0.9944 | 1 | 157 |
|
| AF-A0A4R5KE91-F1-model_v4 | Polyketide cyclase / dehydrase and lipid transport | 0.9944 | 1 | 157 |
|
| AF-A0A1Q7VI15-F1-model_v4 | Polyketide cyclase | 0.9941 | 1 | 157 |
|
| AF-A0A7U6H0Y6-F1-model_v4 | deleted | 0.9932 | 2 | 148 |
|
| AF-A0A7W0WDM0-F1-model_v4 | SRPBCC family protein | 0.9925 | 1 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar