F463326

General Info

Members Datasets Scaffolds Average Seq Length
557 180 557 79

Family's Representative Sequence

Representative Sequence 3300027614|Ga0209970_1049136|Ga0209970_10491361
Length 91
Sequence MSDLKFEDCLARLEQIVTALEAGNLPLEESLKVFEEGVILARQCSRYLDDAERRIEILVKDEAGAVADITIYDVLQSNGVIHSVDKVLLPK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
106 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10023963 3300003203 Bacteria 2401
2 Ga0065707_10139934 3300005295 Bacteria 1787
3 Ga0070676_10287960 3300005328 Bacteria 1109
4 Ga0070690_100434967 3300005330 Bacteria 970
5 Ga0068869_100198283 3300005334 Bacteria 1582
6 Ga0070680_100121332 3300005336 Bacteria 2182
7 Ga0070660_101035249 3300005339 Bacteria 694
8 Ga0070691_10518037 3300005341 Unclassified 692
9 Ga0070692_10183980 3300005345 Bacteria 1213
10 Ga0070692_10441180 3300005345 Bacteria 831
11 Ga0070692_10894770 3300005345 Unclassified 613
12 Ga0070668_100827292 3300005347 Unclassified 824
13 Ga0070669_100007768 3300005353 Bacteria 7662
14 Ga0070669_100538717 3300005353 Bacteria 972
15 Ga0070671_100370537 3300005355 Bacteria 1223
16 Ga0070703_10436886 3300005406 Bacteria 577
17 Ga0070705_100275989 3300005440 Bacteria 1193
18 Ga0070705_101595583 3300005440 Bacteria 549
19 Ga0070694_101827014 3300005444 Unclassified 518
20 Ga0070708_100003398 3300005445 Bacteria 12470
21 Ga0070708_100004741 3300005445 Bacteria 10710
22 Ga0070708_100018511 3300005445 Bacteria 5830
23 Ga0070708_100049634 3300005445 Bacteria 3713
24 Ga0070708_100112455 3300005445 Bacteria 2504
25 Ga0070708_100649277 3300005445 Bacteria 994
26 Ga0070663_101579865 3300005455 Bacteria 584
27 Ga0070662_100047924 3300005457 Bacteria 3076
28 Ga0070681_10709742 3300005458 Bacteria 922
29 Ga0068867_100423924 3300005459 Bacteria 1128
30 Ga0070706_100026814 3300005467 Bacteria 5301
31 Ga0070706_100128449 3300005467 Bacteria 2364
32 Ga0070706_100441595 3300005467 Bacteria 1211
33 Ga0070706_100515636 3300005467 Bacteria 1112
34 Ga0070706_100534070 3300005467 Unclassified 1091
35 Ga0070706_101059902 3300005467 Bacteria 747
36 Ga0070707_100005143 3300005468 Bacteria 12255
37 Ga0070707_100141571 3300005468 Bacteria 2341
38 Ga0070707_100337481 3300005468 Bacteria 1464
39 Ga0070707_100342669 3300005468 Bacteria 1452
40 Ga0070707_100451905 3300005468 Bacteria 1245
41 Ga0070698_100012089 3300005471 Bacteria 9150
42 Ga0070699_100001887 3300005518 Bacteria 18920
43 Ga0070699_100044579 3300005518 Bacteria 3839
44 Ga0070699_100117381 3300005518 Bacteria 2338
45 Ga0070699_100971502 3300005518 Bacteria 779
46 Ga0070699_101101832 3300005518 Bacteria 728
47 Ga0070699_101599621 3300005518 Unclassified 597
48 Ga0070697_100504109 3300005536 Bacteria 1058
49 Ga0070697_101532754 3300005536 Unclassified 596
50 Ga0070672_100206066 3300005543 Bacteria 1646
51 Ga0070695_100016418 3300005545 Bacteria 4480
52 Ga0070695_100290511 3300005545 Bacteria 1205
53 Ga0070695_100374508 3300005545 Bacteria 1073
54 Ga0070695_100550863 3300005545 Bacteria 899
55 Ga0070695_101905822 3300005545 Bacteria 500
56 Ga0070696_100010846 3300005546 Bacteria 6107
57 Ga0070696_100168560 3300005546 Bacteria 1617
58 Ga0070696_100278710 3300005546 Bacteria 1274
59 Ga0070696_100424180 3300005546 Bacteria 1045
60 Ga0070696_101950150 3300005546 Bacteria 509
61 Ga0070693_101409316 3300005547 Bacteria 542
62 Ga0070704_100037842 3300005549 Bacteria 3300
63 Ga0070704_100307683 3300005549 Bacteria 1323
64 Ga0070704_100341454 3300005549 Bacteria 1261
65 Ga0070704_100921267 3300005549 Bacteria 787
66 Ga0068857_100336068 3300005577 Bacteria 1397
67 Ga0068866_10500962 3300005718 Unclassified 804
68 Ga0068866_10793699 3300005718 Bacteria 658
69 Ga0068861_100088444 3300005719 Bacteria 2440
70 Ga0068861_102029130 3300005719 Unclassified 574
71 Ga0068863_100179556 3300005841 Bacteria 2032
72 Ga0068858_100493001 3300005842 Bacteria 1183
73 Ga0068860_100040860 3300005843 Bacteria 4431
74 Ga0068860_100214402 3300005843 Bacteria 1868
75 Ga0068860_100626821 3300005843 Bacteria 1082
76 Ga0068862_100137191 3300005844 Bacteria 2169
77 Ga0068862_100238024 3300005844 Bacteria 1654
78 Ga0068862_100655470 3300005844 Bacteria 1013
79 Ga0068862_102014326 3300005844 Unclassified 588
80 Ga0081455_10602442 3300005937 Bacteria 716
81 Ga0081539_10000590 3300005985 Bacteria 74293
82 Ga0075432_10029671 3300006058 Bacteria 1889
83 Ga0075432_10263730 3300006058 Bacteria 703
84 Ga0075432_10323891 3300006058 Bacteria 646
85 Ga0070716_100831971 3300006173 Bacteria 717
86 Ga0075428_100000730 3300006844 Bacteria 34154
87 Ga0075428_100002131 3300006844 Bacteria 21363
88 Ga0075428_100004460 3300006844 Bacteria 15448
89 Ga0075428_100008047 3300006844 Bacteria 11701
90 Ga0075428_100078195 3300006844 Bacteria 3611
91 Ga0075428_100096687 3300006844 Bacteria 3219
92 Ga0075428_100414213 3300006844 Bacteria 1444
93 Ga0075428_101285534 3300006844 Bacteria 770
94 Ga0075428_102312976 3300006844 Bacteria 553
95 Ga0075430_100000231 3300006846 Bacteria 38649
96 Ga0075430_100002031 3300006846 Bacteria 16705
97 Ga0075430_100014328 3300006846 Bacteria 6757
98 Ga0075430_100145930 3300006846 Bacteria 1971
99 Ga0075430_100464135 3300006846 Bacteria 1045
100 Ga0075430_100518911 3300006846 Bacteria 983
101 Ga0075430_100582619 3300006846 Bacteria 923
102 Ga0075430_101248249 3300006846 Bacteria 611
103 Ga0075431_100002752 3300006847 Bacteria 17054
104 Ga0075431_100003918 3300006847 Bacteria 14489
105 Ga0075431_100015118 3300006847 Bacteria 7817
106 Ga0075431_100022070 3300006847 Bacteria 6510
107 Ga0075431_100022758 3300006847 Bacteria 6405
108 Ga0075431_100029323 3300006847 Bacteria 5663
109 Ga0075431_100102507 3300006847 Bacteria 2954
110 Ga0075431_100204072 3300006847 Bacteria 2021
111 Ga0075431_100253927 3300006847 Bacteria 1786
112 Ga0075431_100434852 3300006847 Bacteria 1310
113 Ga0075431_100581765 3300006847 Bacteria 1105
114 Ga0075431_101222792 3300006847 Bacteria 714
115 Ga0075433_10011771 3300006852 Bacteria 7046
116 Ga0075433_10074726 3300006852 Bacteria 2982
117 Ga0075433_10091142 3300006852 Bacteria 2694
118 Ga0075433_10118719 3300006852 Bacteria 2347
119 Ga0075433_10161033 3300006852 Bacteria 1997
120 Ga0075433_10210560 3300006852 Bacteria 1727
121 Ga0075433_10220432 3300006852 Bacteria 1685
122 Ga0075433_10324497 3300006852 Bacteria 1362
123 Ga0075433_10394673 3300006852 Bacteria 1221
124 Ga0075433_10912699 3300006852 Bacteria 766
125 Ga0075433_11724673 3300006852 Unclassified 539
126 Ga0075434_100030799 3300006871 Bacteria 5286
127 Ga0075434_100106945 3300006871 Bacteria 2807
128 Ga0075434_100331049 3300006871 Bacteria 1543
129 Ga0075434_100338657 3300006871 Bacteria 1525
130 Ga0075434_100414122 3300006871 Bacteria 1369
131 Ga0075434_101414029 3300006871 Bacteria 705
132 Ga0075434_102564424 3300006871 Bacteria 510
133 Ga0075434_102616127 3300006871 Archaea 505
134 Ga0075429_100002010 3300006880 Bacteria 16905
135 Ga0075429_100002286 3300006880 Bacteria 16075
136 Ga0075429_100002758 3300006880 Bacteria 14851
137 Ga0075429_100003688 3300006880 Bacteria 13047
138 Ga0075429_100023521 3300006880 Bacteria 5347
139 Ga0075429_100043759 3300006880 Bacteria 3896
140 Ga0075429_100079948 3300006880 Bacteria 2850
141 Ga0075429_100106147 3300006880 Bacteria 2454
142 Ga0075429_100197142 3300006880 Bacteria 1764
143 Ga0075429_100253745 3300006880 Bacteria 1540
144 Ga0075429_100884616 3300006880 Bacteria 782
145 Ga0068865_100056328 3300006881 Bacteria 2738
146 Ga0075436_100038531 3300006914 Bacteria 3299
147 Ga0075436_100060960 3300006914 Bacteria 2606
148 Ga0075436_100162499 3300006914 Bacteria 1574
149 Ga0075436_100342526 3300006914 Bacteria 1076
150 Ga0075436_100683031 3300006914 Bacteria 760
151 Ga0075436_101000859 3300006914 Unclassified 627
152 Ga0075435_100038595 3300007076 Bacteria 3807
153 Ga0075435_100040907 3300007076 Bacteria 3703
154 Ga0075435_100268651 3300007076 Bacteria 1454
155 Ga0075435_100395649 3300007076 Bacteria 1188
156 Ga0075435_100500341 3300007076 Bacteria 1051
157 Ga0075435_101145914 3300007076 Unclassified 680
158 Ga0099794_10004846 3300007265 Bacteria 5343
159 Ga0099794_10119176 3300007265 Bacteria 1327
160 Ga0099794_10352066 3300007265 Bacteria 766
161 Ga0111539_10005374 3300009094 Bacteria 16564
162 Ga0111539_10007166 3300009094 Bacteria 14293
163 Ga0111539_10287683 3300009094 Bacteria 1913
164 Ga0111539_10410888 3300009094 Bacteria 1576
165 Ga0111539_10591047 3300009094 Bacteria 1293
166 Ga0114129_10000409 3300009147 Bacteria 50603
167 Ga0114129_10005405 3300009147 Bacteria 18037
168 Ga0114129_10012846 3300009147 Bacteria 11917
169 Ga0114129_10027218 3300009147 Bacteria 8095
170 Ga0114129_10041382 3300009147 Bacteria 6494
171 Ga0114129_10048567 3300009147 Bacteria 5963
172 Ga0114129_10096520 3300009147 Bacteria 4092
173 Ga0114129_10103915 3300009147 Bacteria 3927
174 Ga0114129_10117540 3300009147 Bacteria 3664
175 Ga0114129_10133111 3300009147 Bacteria 3413
176 Ga0114129_10189267 3300009147 Bacteria 2795
177 Ga0114129_10380707 3300009147 Bacteria 1864
178 Ga0114129_10383604 3300009147 Bacteria 1855
179 Ga0114129_10476342 3300009147 Bacteria 1634
180 Ga0114129_10740093 3300009147 Bacteria 1260
181 Ga0114129_11019406 3300009147 Bacteria 1041
182 Ga0114129_11115046 3300009147 Bacteria 987
183 Ga0114129_11386082 3300009147 Bacteria 868
184 Ga0105243_11030689 3300009148 Unclassified 827
185 Ga0105243_11115427 3300009148 Unclassified 798
186 Ga0105243_12481902 3300009148 Bacteria 557
187 Ga0105241_11162049 3300009174 Bacteria 729
188 Ga0105242_10274760 3300009176 Bacteria 1528
189 Ga0105242_10436934 3300009176 Bacteria 1230
190 Ga0105248_11493127 3300009177 Unclassified 765
191 Ga0105249_10107891 3300009553 Bacteria 2628
192 Ga0105249_10629519 3300009553 Bacteria 1129
193 Ga0105249_13579693 3300009553 Unclassified 501
194 Ga0157378_10186060 3300013297 Bacteria 1956
195 Ga0157378_10206834 3300013297 Bacteria 1859
196 Ga0163162_10035530 3300013306 Bacteria 4964
197 Ga0163162_10636790 3300013306 Bacteria 1191
198 Ga0157375_10107120 3300013308 Bacteria 2888
199 Ga0163163_10738351 3300014325 Bacteria 1048
200 Ga0157377_11361195 3300014745 Bacteria 558
201 Ga0163161_10773749 3300017792 Bacteria 805
202 Ga0207653_10336897 3300025885 Bacteria 588
203 Ga0207642_10362368 3300025899 Unclassified 858
204 Ga0207684_10001569 3300025910 Bacteria 24376
205 Ga0207684_10152518 3300025910 Bacteria 1988
206 Ga0207684_10345744 3300025910 Bacteria 1281
207 Ga0207684_10902145 3300025910 Unclassified 743
208 Ga0207684_11557825 3300025910 Unclassified 536
209 Ga0207660_10095536 3300025917 Bacteria 2211
210 Ga0207646_10003627 3300025922 Bacteria 17272
211 Ga0207646_10011305 3300025922 Bacteria 8663
212 Ga0207646_10202214 3300025922 Bacteria 1794
213 Ga0207646_10329778 3300025922 Bacteria 1379
214 Ga0207681_10005950 3300025923 Bacteria 7480
215 Ga0207681_10167891 3300025923 Bacteria 1661
216 Ga0207681_10434216 3300025923 Bacteria 1066
217 Ga0207644_10365136 3300025931 Bacteria 1175
218 Ga0207706_10040039 3300025933 Bacteria 4154
219 Ga0207686_10277975 3300025934 Bacteria 1235
220 Ga0207709_10327298 3300025935 Bacteria 1149
221 Ga0207704_10213861 3300025938 Bacteria 1421
222 Ga0207691_10059467 3300025940 Bacteria 3474
223 Ga0207711_10500895 3300025941 Bacteria 1132
224 Ga0207711_10738642 3300025941 Bacteria 918
225 Ga0207689_10155863 3300025942 Bacteria 1883
226 Ga0207712_10353524 3300025961 Bacteria 1222
227 Ga0207712_10515628 3300025961 Bacteria 1024
228 Ga0207668_10029590 3300025972 Bacteria 3591
229 Ga0207703_10263243 3300026035 Bacteria 1559
230 Ga0207678_11212226 3300026067 Unclassified 668
231 Ga0207708_10174889 3300026075 Bacteria 1702
232 Ga0207708_10544340 3300026075 Bacteria 978
233 Ga0207641_10121042 3300026088 Bacteria 2336
234 Ga0207648_10515399 3300026089 Bacteria 1095
235 Ga0207675_100055837 3300026118 Bacteria 3685
236 Ga0207675_101058813 3300026118 Bacteria 830
237 Ga0207675_101302643 3300026118 Bacteria 747
238 Ga0209970_1049136 3300027614 Bacteria 761
239 Ga0209588_1002075 3300027671 Bacteria 5407
240 Ga0209971_1011959 3300027682 Bacteria 2054
241 Ga0207428_10006460 3300027907 Bacteria 10825
242 Ga0207428_10148830 3300027907 Bacteria 1783
243 Ga0207428_10246787 3300027907 Bacteria 1332
244 Ga0207428_10952429 3300027907 Bacteria 605
245 Ga0268265_10294783 3300028380 Bacteria 1458
246 Ga0268265_10611385 3300028380 Bacteria 1043
247 Ga0268265_11036301 3300028380 Bacteria 812
248 Ga0268265_12306337 3300028380 Bacteria 545
249 Ga0268264_10205469 3300028381 Bacteria 1804
250 Ga0268264_10686782 3300028381 Bacteria 1016
251 Ga0268264_11634390 3300028381 Bacteria 655
252 Ga0307408_100059036 3300031548 Bacteria 2791
253 Ga0307408_100068760 3300031548 Bacteria 2609
254 Ga0307408_100303093 3300031548 Bacteria 1339
255 Ga0307408_101519340 3300031548 Unclassified 634
256 Ga0307408_101961701 3300031548 Bacteria 562
257 Ga0307405_10098255 3300031731 Bacteria 1957
258 Ga0307405_10101740 3300031731 Bacteria 1929
259 Ga0307405_10548613 3300031731 Bacteria 935
260 Ga0307413_10540045 3300031824 Unclassified 944
261 Ga0307413_10873023 3300031824 Bacteria 762
262 Ga0307410_11034351 3300031852 Bacteria 709
263 Ga0307406_10157534 3300031901 Bacteria 1628
264 Ga0307406_10363032 3300031901 Bacteria 1136
265 Ga0307406_10376845 3300031901 Bacteria 1117
266 Ga0307407_10149190 3300031903 Bacteria 1517
267 Ga0307407_10548544 3300031903 Bacteria 854
268 Ga0307407_10590002 3300031903 Bacteria 826
269 Ga0307407_10703671 3300031903 Bacteria 761
270 Ga0307412_10050009 3300031911 Bacteria 2757
271 Ga0307412_10708459 3300031911 Bacteria 865
272 Ga0307412_11947274 3300031911 Bacteria 543
273 Ga0307409_100855928 3300031995 Bacteria 920
274 Ga0307409_101366801 3300031995 Bacteria 734
275 Ga0307416_100001116 3300032002 Bacteria 14425
276 Ga0307416_100019198 3300032002 Bacteria 4841
277 Ga0307416_100296974 3300032002 Bacteria 1603
278 Ga0307416_100483445 3300032002 Bacteria 1299
279 Ga0307414_10853757 3300032004 Bacteria 833
280 Ga0307411_10253089 3300032005 Bacteria 1386
281 Ga0307415_100825805 3300032126 Bacteria 848
282 Ga0373930_0013823 3300034816 Bacteria 1494
283 Ga0373948_0099203 3300034817 Bacteria 684
284 Ga0373959_0029697 3300034820 Bacteria 1098
285 Ga0373938_0237789 3300034957 Bacteria 517
286 Ga0373949_0220497 3300035090 Bacteria 576
287 Ga0373941_0017800 3300035115 Bacteria 1953
288 Ga0373941_0186816 3300035115 Unclassified 781
289 Ga0373960_0032047 3300035121 Bacteria 1474
290 Ga0373931_0005687 3300035691 Bacteria 5791
291 Ga0395899_0108149 3300037312 Bacteria 2001
292 Ga0395900_0005301 3300037418 Bacteria 13516
293 Ga0395900_0157056 3300037418 Bacteria 2323
294 Ga0395900_1604043 3300037418 Bacteria 562
295 Ga0395898_0920375 3300037466 Bacteria 812
296 Ga0395905_0488956 3300037471 Bacteria 1130
297 Ga0395901_0006655 3300038443 Bacteria 11679
298 Ga0395901_0288985 3300038443 Bacteria 1702
299 Ga0395901_1364015 3300038443 Bacteria 669
300 Ga0450923_084503 3300042125 Bacteria 718
301 Ga0439460_0325467 3300042461 Unclassified 540
302 Ga0451577_0133090 3300042876 Bacteria 2232
303 Ga0451577_1964739 3300042876 Unclassified 512
304 Ga0453683_0049752 3300044673 Bacteria 2627
305 Ga0451576_0927356 3300045051 Bacteria 913
306 Ga0451576_1030787 3300045051 Bacteria 862
307 Ga0451576_1358889 3300045051 Bacteria 740
308 Ga0495594_0145992 3300046499 Bacteria 1342
309 Ga0495607_0240936 3300046501 Bacteria 875
310 Ga0495642_0046221 3300046528 Bacteria 1781
311 Ga0495621_0042337 3300046539 Bacteria 1603
312 Ga0495621_0498851 3300046539 Bacteria 525
313 Ga0495622_0286852 3300046557 Bacteria 719
314 Ga0495656_0168259 3300046615 Bacteria 1070
315 Ga0495659_0038870 3300046664 Bacteria 1691
316 Ga0495659_0252966 3300046664 Bacteria 735
317 Ga0495669_0127823 3300046684 Bacteria 1195
318 Ga0495669_0245689 3300046684 Bacteria 859
319 Ga0495636_0008556 3300047318 Bacteria 4039
320 Ga0496102_0020793 3300048905 Bacteria 5801
321 Ga0496106_0353466 3300048909 Bacteria 1180
322 Ga0496106_0661919 3300048909 Bacteria 834
323 Ga0496106_0843949 3300048909 Bacteria 725
324 Ga0496107_0392864 3300048910 Bacteria 1032
325 Ga0496107_0647534 3300048910 Unclassified 779
326 Ga0501299_052786 3300049522 Bacteria 844
327 Ga0501031_0073696 3300049568 Bacteria 2223
328 Ga0501031_0544019 3300049568 Bacteria 748
329 Ga0501032_0491778 3300049569 Unclassified 784
330 Ga0501033_0592062 3300049570 Unclassified 761
331 Ga0501033_1047399 3300049570 Bacteria 544
332 Ga0501036_0128413 3300049572 Bacteria 2140
333 Ga0501036_0769670 3300049572 Bacteria 794
334 Ga0501036_0870226 3300049572 Bacteria 740
335 Ga0501036_0892787 3300049572 Bacteria 730
336 Ga0501038_0151067 3300049574 Bacteria 1893
337 Ga0501038_0233255 3300049574 Bacteria 1464
338 Ga0501038_0560416 3300049574 Bacteria 868
339 Ga0501038_0791671 3300049574 Bacteria 705
340 Ga0501039_0123427 3300049575 Bacteria 2030
341 Ga0501039_0456659 3300049575 Bacteria 1003
342 Ga0501039_0551161 3300049575 Bacteria 905
343 Ga0501039_1090793 3300049575 Bacteria 619
344 Ga0501039_1296195 3300049575 Bacteria 562
345 Ga0501040_0023620 3300049576 Bacteria 4123
346 Ga0501040_0039674 3300049576 Bacteria 3202
347 Ga0501040_0196215 3300049576 Bacteria 1433
348 Ga0501040_0303194 3300049576 Bacteria 1142
349 Ga0501040_0309652 3300049576 Bacteria 1129
350 Ga0501040_0352427 3300049576 Bacteria 1054
351 Ga0501040_0386110 3300049576 Bacteria 1005
352 Ga0501040_0562558 3300049576 Bacteria 823
353 Ga0501041_0015767 3300049577 Bacteria 4489
354 Ga0501041_0107730 3300049577 Bacteria 1728
355 Ga0501041_0361252 3300049577 Bacteria 918
356 Ga0501041_0546713 3300049577 Bacteria 738
357 Ga0501042_0007494 3300049578 Bacteria 7152
358 Ga0501042_0088395 3300049578 Bacteria 2223
359 Ga0501042_0093054 3300049578 Bacteria 2165
360 Ga0501042_0153670 3300049578 Bacteria 1660
361 Ga0501042_0597807 3300049578 Bacteria 802
362 Ga0501042_1196682 3300049578 Unclassified 554
363 Ga0501043_0135906 3300049579 Bacteria 1926
364 Ga0501043_0985152 3300049579 Bacteria 601
365 Ga0501046_0103769 3300049580 Bacteria 2179
366 Ga0501046_0486464 3300049580 Bacteria 885
367 Ga0501046_0750187 3300049580 Unclassified 686
368 Ga0501046_0787235 3300049580 Bacteria 667
369 Ga0501048_0227392 3300049582 Bacteria 1324
370 Ga0501048_0378600 3300049582 Bacteria 1011
371 Ga0501048_0552500 3300049582 Bacteria 826
372 Ga0501048_0573271 3300049582 Bacteria 810
373 Ga0501048_0623214 3300049582 Bacteria 774
374 Ga0501048_1243973 3300049582 Unclassified 535
375 Ga0501067_0017887 3300049583 Bacteria 3924
376 Ga0501067_0607223 3300049583 Bacteria 614
377 Ga0501068_0085412 3300049584 Bacteria 1942
378 Ga0501068_0270257 3300049584 Bacteria 1085
379 Ga0501068_0395711 3300049584 Unclassified 890
380 Ga0501069_0095988 3300049585 Bacteria 1679
381 Ga0501070_0422118 3300049586 Bacteria 1077
382 Ga0501071_0020373 3300049587 Bacteria 4607
383 Ga0501071_0523232 3300049587 Bacteria 910
384 Ga0501071_0556971 3300049587 Bacteria 881
385 Ga0501071_0705729 3300049587 Bacteria 777
386 Ga0501071_0841096 3300049587 Bacteria 708
387 Ga0501072_0088028 3300049588 Bacteria 2464
388 Ga0501072_0102912 3300049588 Bacteria 2270
389 Ga0501072_0111527 3300049588 Bacteria 2177
390 Ga0501072_0201827 3300049588 Bacteria 1585
391 Ga0501072_0219998 3300049588 Bacteria 1513
392 Ga0501072_0245050 3300049588 Bacteria 1428
393 Ga0501072_0455531 3300049588 Bacteria 1013
394 Ga0501073_0270167 3300049589 Bacteria 1173
395 Ga0501074_0060028 3300049590 Bacteria 2739
396 Ga0501074_0126708 3300049590 Bacteria 1827
397 Ga0501074_0251959 3300049590 Bacteria 1256
398 Ga0501074_0392568 3300049590 Bacteria 984
399 Ga0501075_0011352 3300049591 Bacteria 6305
400 Ga0501075_0047410 3300049591 Bacteria 3229
401 Ga0501075_0085383 3300049591 Bacteria 2391
402 Ga0501075_0092149 3300049591 Bacteria 2300
403 Ga0501075_0100916 3300049591 Bacteria 2192
404 Ga0501075_0475362 3300049591 Bacteria 953
405 Ga0501075_0494730 3300049591 Bacteria 933
406 Ga0501075_0815885 3300049591 Bacteria 710
407 Ga0501076_0012196 3300049592 Bacteria 6426
408 Ga0501076_0184330 3300049592 Bacteria 1702
409 Ga0501076_0203696 3300049592 Bacteria 1616
410 Ga0501076_0284026 3300049592 Bacteria 1356
411 Ga0501076_0534857 3300049592 Bacteria 966
412 Ga0501076_0997226 3300049592 Bacteria 690
413 Ga0501076_1168476 3300049592 Bacteria 633
414 Ga0501077_0003874 3300049593 Bacteria 9016
415 Ga0501077_0064014 3300049593 Bacteria 2333
416 Ga0501077_0077607 3300049593 Bacteria 2104
417 Ga0501077_0458025 3300049593 Bacteria 817
418 Ga0501077_0461225 3300049593 Bacteria 814
419 Ga0501077_0495399 3300049593 Bacteria 783
420 Ga0501079_0103802 3300049741 Bacteria 2205
421 Ga0501079_0116363 3300049741 Bacteria 2078
422 Ga0501079_0119718 3300049741 Bacteria 2047
423 Ga0501079_0319650 3300049741 Bacteria 1215
424 Ga0501079_0379917 3300049741 Bacteria 1108
425 Ga0501079_0950581 3300049741 Bacteria 677
426 Ga0501080_0270605 3300049742 Bacteria 1546
427 Ga0501080_0588415 3300049742 Bacteria 989
428 Ga0501080_0590249 3300049742 Bacteria 987
429 Ga0501081_0018434 3300049743 Bacteria 4636
430 Ga0501081_0048829 3300049743 Bacteria 2913
431 Ga0501081_0117412 3300049743 Bacteria 1892
432 Ga0501081_0132540 3300049743 Bacteria 1781
433 Ga0501081_0143650 3300049743 Bacteria 1711
434 Ga0501081_0255713 3300049743 Bacteria 1279
435 Ga0501081_0307216 3300049743 Bacteria 1164
436 Ga0501081_0553971 3300049743 Bacteria 859
437 Ga0501081_0677490 3300049743 Bacteria 774
438 Ga0501081_0910518 3300049743 Unclassified 663
439 Ga0501083_0647434 3300049744 Unclassified 687
440 Ga0501083_1113757 3300049744 Bacteria 514
441 Ga0501275_087461 3300049772 Bacteria 514
442 Ga0501035_0305417 3300049822 Bacteria 1340
443 Ga0501035_0642821 3300049822 Bacteria 861
444 Ga0501044_1277137 3300049823 Unclassified 601
445 Ga0501045_0008979 3300049824 Bacteria 6981
446 Ga0501045_0161448 3300049824 Bacteria 1668
447 Ga0501045_0199978 3300049824 Bacteria 1489
448 Ga0501045_0240945 3300049824 Bacteria 1346
449 Ga0501045_0503115 3300049824 Bacteria 900
450 nmdc:mga05p37_132165_c1 3300050507 Bacteria 3062
451 nmdc:mga05p37_176098_c1 3300050507 Bacteria 2606
452 nmdc:mga05p37_1924237_c1 3300050507 Bacteria 564
453 nmdc:mga05p37_195378_c1 3300050507 Bacteria 2454
454 nmdc:mga05p37_1966837_c1 3300050507 Bacteria 555
455 nmdc:mga05p37_19747_c1 3300050507 Bacteria 8152
456 nmdc:mga05p37_2239365_c1 3300050507 Bacteria 506
457 nmdc:mga05p37_259751_c1 3300050507 Bacteria 2079
458 nmdc:mga05p37_26564_c1 3300050507 Bacteria 7041
459 nmdc:mga05p37_26790_c1 3300050507 Bacteria 7011
460 nmdc:mga05p37_282780_c1 3300050507 Bacteria 1978
461 nmdc:mga05p37_3637_c1 3300050507 Bacteria 18022
462 nmdc:mga05p37_441035_c1 3300050507 Bacteria 1510
463 nmdc:mga05p37_64400_c1 3300050507 Bacteria 4511
464 nmdc:mga05p37_771225_c1 3300050507 Bacteria 1057
465 nmdc:mga05p37_780639_c1 3300050507 Bacteria 1048
466 nmdc:mga05p37_8064_c1 3300050507 Bacteria 12441
467 nmdc:mga09592_1309617_c1 3300050508 Unclassified 595
468 nmdc:mga09592_15543_c1 3300050508 Bacteria 6222
469 nmdc:mga09592_177716_c1 3300050508 Bacteria 1841
470 nmdc:mga09592_2304_c1 3300050508 Bacteria 15400
471 nmdc:mga09592_2514_c1 3300050508 Bacteria 14835
472 nmdc:mga09592_49343_c1 3300050508 Bacteria 3548
473 nmdc:mga09592_626766_c1 3300050508 Bacteria 920
474 nmdc:mga09592_62904_c1 3300050508 Bacteria 3140
475 nmdc:mga09592_723052_c1 3300050508 Bacteria 846
476 nmdc:mga09592_8676_c1 3300050508 Bacteria 8272
477 nmdc:mga0qj67_1112309_c1 3300050509 Bacteria 617
478 nmdc:mga0qj67_1162516_c1 3300050509 Bacteria 601
479 nmdc:mga0qj67_119519_c1 3300050509 Bacteria 2131
480 nmdc:mga0qj67_12384_c1 3300050509 Bacteria 6424
481 nmdc:mga0qj67_357675_c1 3300050509 Bacteria 1180
482 nmdc:mga0qj67_4235_c1 3300050509 Bacteria 10397
483 nmdc:mga0qj67_437086_c1 3300050509 Bacteria 1054
484 nmdc:mga0qj67_450728_c1 3300050509 Bacteria 1036
485 nmdc:mga0qj67_497524_c1 3300050509 Bacteria 980
486 nmdc:mga0qj67_730_c1 3300050509 Bacteria 22368
487 nmdc:mga06r32_1001576_c1 3300050510 Bacteria 788
488 nmdc:mga06r32_1298226_c1 3300050510 Bacteria 672
489 nmdc:mga06r32_1609976_c1 3300050510 Bacteria 588
490 nmdc:mga06r32_1754208_c1 3300050510 Unclassified 557
491 nmdc:mga06r32_21102_c1 3300050510 Bacteria 6010
492 nmdc:mga06r32_220309_c1 3300050510 Bacteria 1886
493 nmdc:mga06r32_244405_c1 3300050510 Bacteria 1782
494 nmdc:mga06r32_275544_c1 3300050510 Bacteria 1670
495 nmdc:mga06r32_28853_c1 3300050510 Bacteria 5195
496 nmdc:mga06r32_314408_c1 3300050510 Bacteria 1552
497 nmdc:mga06r32_336246_c1 3300050510 Bacteria 1495
498 nmdc:mga06r32_4632_c1 3300050510 Bacteria 12337
499 nmdc:mga06r32_4693_c1 3300050510 Bacteria 12275
500 nmdc:mga08y16_1525_c2 3300050511 Bacteria 22882
501 nmdc:mga08y16_262979_c1 3300050511 Bacteria 1782
502 nmdc:mga08y16_272425_c1 3300050511 Bacteria 1747
503 nmdc:mga08y16_473861_c1 3300050511 Bacteria 1274
504 nmdc:mga08y16_514100_c1 3300050511 Bacteria 1215
505 nmdc:mga0n895_104422_c1 3300050512 Bacteria 2846
506 nmdc:mga0n895_12674_c1 3300050512 Bacteria 7570
507 nmdc:mga0n895_1404297_c1 3300050512 Bacteria 667
508 nmdc:mga0n895_2053864_c1 3300050512 Archaea 529
509 nmdc:mga0n895_2180744_c1 3300050512 Bacteria 510
510 nmdc:mga0n895_261735_c1 3300050512 Bacteria 1755
511 nmdc:mga0n895_81860_c1 3300050512 Bacteria 3217
512 nmdc:mga0rr50_1837884_c1 3300050513 Bacteria 510
513 nmdc:mga0rr50_252136_c1 3300050513 Bacteria 1466
514 nmdc:mga0rr50_58390_c1 3300050513 Bacteria 2891
515 nmdc:mga0rr50_627672_c1 3300050513 Bacteria 916
516 nmdc:mga0rr50_677900_c1 3300050513 Bacteria 880
517 nmdc:mga0rr50_68524_c1 3300050513 Bacteria 2699
518 nmdc:mga0rr50_790125_c1 3300050513 Bacteria 810
519 nmdc:mga08x19_1326301_c1 3300050514 Bacteria 510
520 nmdc:mga08x19_14078_c1 3300050514 Bacteria 4847
521 nmdc:mga08x19_178043_c1 3300050514 Bacteria 1451
522 nmdc:mga08x19_24491_c1 3300050514 Bacteria 3752
523 nmdc:mga08x19_638205_c1 3300050514 Bacteria 755
524 nmdc:mga08x19_700140_c1 3300050514 Bacteria 719
525 nmdc:mga0a205_104887_c1 3300050515 Bacteria 2726
526 nmdc:mga0a205_1405688_c1 3300050515 Unclassified 546
527 nmdc:mga0a205_347210_c1 3300050515 Bacteria 1352
528 nmdc:mga0a205_390220_c1 3300050515 Bacteria 1257
529 nmdc:mga0a205_403295_c1 3300050515 Bacteria 1231
530 nmdc:mga0a205_46111_c1 3300050515 Bacteria 4203
531 nmdc:mga0a205_47747_c1 3300050515 Bacteria 3080
532 nmdc:mga0a205_61655_c1 3300050515 Bacteria 3623
533 nmdc:mga0a205_774180_c1 3300050515 Bacteria 808
534 Ga0501084_0027433 3300054114 Bacteria 4758
535 Ga0501084_0034022 3300054114 Bacteria 4262
536 Ga0501084_0049665 3300054114 Bacteria 3511
537 Ga0501084_0239085 3300054114 Bacteria 1533
538 Ga0501084_0397853 3300054114 Bacteria 1164
539 Ga0501084_0404821 3300054114 Bacteria 1153
540 Ga0501084_0566251 3300054114 Bacteria 960
541 Ga0501084_1446895 3300054114 Bacteria 575
542 Ga0590075_179634 3300059424 Bacteria 559
543 Ga0590077_115603 3300059426 Bacteria 632
544 Ga0501082_0018583 3300060353 Bacteria 5991
545 Ga0501082_0164828 3300060353 Bacteria 1926
546 Ga0501082_0202243 3300060353 Bacteria 1728
547 Ga0501082_0210936 3300060353 Bacteria 1690
548 Ga0501082_0782438 3300060353 Bacteria 835
549 Ga0530510_0000752 3300061734 Bacteria 21005
550 Ga0530510_0023289 3300061734 Bacteria 4411
551 Ga0530510_0108522 3300061734 Bacteria 2032
552 Ga0530510_0126810 3300061734 Bacteria 1876
553 Ga0530510_0255807 3300061734 Bacteria 1305
554 Ga0530510_0285738 3300061734 Bacteria 1233
555 Ga0530510_0478171 3300061734 Bacteria 943
556 Ga0530510_0615200 3300061734 Unclassified 826
557 Ga0530510_0815872 3300061734 Archaea 712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100342669 Ga0070707_1003426692 76
2 3300025922 Ga0207646_10329778 Ga0207646_103297782 76
3 3300049588 Ga0501072_0245050 Ga0501072_0245050_315_569 76
4 3300049591 Ga0501075_0815885 Ga0501075_0815885_233_487 76
5 3300049743 Ga0501081_0018434 Ga0501081_0018434_1290_1544 76
6 3300061734 Ga0530510_0108522 Ga0530510_0108522_1708_1962 76
7 3300005445 Ga0070708_100018511 Ga0070708_1000185113 77
8 3300005467 Ga0070706_100515636 Ga0070706_1005156362 77
9 3300005467 Ga0070706_100534070 Ga0070706_1005340702 77
10 3300005467 Ga0070706_101059902 Ga0070706_1010599022 77
11 3300005468 Ga0070707_100141571 Ga0070707_1001415712 77
12 3300006844 Ga0075428_102312976 Ga0075428_1023129762 77
13 3300006846 Ga0075430_101248249 Ga0075430_1012482491 77
14 3300006880 Ga0075429_100197142 Ga0075429_1001971422 77
15 3300009147 Ga0114129_11115046 Ga0114129_111150461 77
16 3300025910 Ga0207684_10902145 Ga0207684_109021452 77
17 3300025910 Ga0207684_11557825 Ga0207684_115578252 77
18 3300025922 Ga0207646_10202214 Ga0207646_102022143 77
19 3300031548 Ga0307408_100068760 Ga0307408_1000687602 77
20 3300031731 Ga0307405_10101740 Ga0307405_101017402 77
21 3300031852 Ga0307410_11034351 Ga0307410_110343512 77
22 3300031903 Ga0307407_10590002 Ga0307407_105900022 77
23 3300031911 Ga0307412_10050009 Ga0307412_100500093 77
24 3300032002 Ga0307416_100019198 Ga0307416_1000191985 77
25 3300032126 Ga0307415_100825805 Ga0307415_1008258052 77
26 3300049522 Ga0501299_052786 Ga0501299_052786_566_802 77
27 3300049772 Ga0501275_087461 Ga0501275_087461_127_363 77
28 3300003203 JGI25406J46586_10023963 JGI25406J46586_100239632 78
29 3300005295 Ga0065707_10139934 Ga0065707_101399343 78
30 3300005328 Ga0070676_10287960 Ga0070676_102879602 78
31 3300005330 Ga0070690_100434967 Ga0070690_1004349672 78
32 3300005334 Ga0068869_100198283 Ga0068869_1001982832 78
33 3300005336 Ga0070680_100121332 Ga0070680_1001213323 78
34 3300005339 Ga0070660_101035249 Ga0070660_1010352491 78
35 3300005341 Ga0070691_10518037 Ga0070691_105180372 78
36 3300005345 Ga0070692_10183980 Ga0070692_101839802 78
37 3300005345 Ga0070692_10441180 Ga0070692_104411802 78
38 3300005345 Ga0070692_10894770 Ga0070692_108947701 78
39 3300005347 Ga0070668_100827292 Ga0070668_1008272922 78
40 3300005353 Ga0070669_100007768 Ga0070669_1000077683 78
41 3300005353 Ga0070669_100538717 Ga0070669_1005387172 78
42 3300005355 Ga0070671_100370537 Ga0070671_1003705372 78
43 3300005406 Ga0070703_10436886 Ga0070703_104368862 78
44 3300005440 Ga0070705_100275989 Ga0070705_1002759892 78
45 3300005440 Ga0070705_101595583 Ga0070705_1015955831 78
46 3300005444 Ga0070694_101827014 Ga0070694_1018270142 78
47 3300005445 Ga0070708_100003398 Ga0070708_1000033985 78
48 3300005445 Ga0070708_100004741 Ga0070708_1000047417 78
49 3300005445 Ga0070708_100049634 Ga0070708_1000496342 78
50 3300005445 Ga0070708_100112455 Ga0070708_1001124552 78
51 3300005445 Ga0070708_100649277 Ga0070708_1006492772 78
52 3300005455 Ga0070663_101579865 Ga0070663_1015798651 78
53 3300005457 Ga0070662_100047924 Ga0070662_1000479243 78
54 3300005458 Ga0070681_10709742 Ga0070681_107097422 78
55 3300005459 Ga0068867_100423924 Ga0068867_1004239242 78
56 3300005467 Ga0070706_100026814 Ga0070706_1000268145 78
57 3300005467 Ga0070706_100128449 Ga0070706_1001284492 78
58 3300005467 Ga0070706_100441595 Ga0070706_1004415952 78
59 3300005468 Ga0070707_100005143 Ga0070707_1000051438 78
60 3300005468 Ga0070707_100337481 Ga0070707_1003374811 78
61 3300005468 Ga0070707_100451905 Ga0070707_1004519052 78
62 3300005471 Ga0070698_100012089 Ga0070698_1000120897 78
63 3300005518 Ga0070699_100001887 Ga0070699_10000188710 78
64 3300005518 Ga0070699_100044579 Ga0070699_1000445793 78
65 3300005518 Ga0070699_100117381 Ga0070699_1001173812 78
66 3300005518 Ga0070699_100971502 Ga0070699_1009715021 78
67 3300005518 Ga0070699_101101832 Ga0070699_1011018321 78
68 3300005518 Ga0070699_101599621 Ga0070699_1015996212 78
69 3300005536 Ga0070697_100504109 Ga0070697_1005041092 78
70 3300005536 Ga0070697_101532754 Ga0070697_1015327542 78
71 3300005543 Ga0070672_100206066 Ga0070672_1002060662 78
72 3300005545 Ga0070695_100016418 Ga0070695_1000164184 78
73 3300005545 Ga0070695_100290511 Ga0070695_1002905112 78
74 3300005545 Ga0070695_100374508 Ga0070695_1003745082 78
75 3300005545 Ga0070695_100550863 Ga0070695_1005508632 78
76 3300005545 Ga0070695_101905822 Ga0070695_1019058222 78
77 3300005546 Ga0070696_100010846 Ga0070696_1000108462 78
78 3300005546 Ga0070696_100168560 Ga0070696_1001685602 78
79 3300005546 Ga0070696_100278710 Ga0070696_1002787102 78
80 3300005546 Ga0070696_100424180 Ga0070696_1004241802 78
81 3300005546 Ga0070696_101950150 Ga0070696_1019501501 78
82 3300005547 Ga0070693_101409316 Ga0070693_1014093162 78
83 3300005549 Ga0070704_100037842 Ga0070704_1000378423 78
84 3300005549 Ga0070704_100307683 Ga0070704_1003076832 78
85 3300005549 Ga0070704_100341454 Ga0070704_1003414542 78
86 3300005549 Ga0070704_100921267 Ga0070704_1009212672 78
87 3300005577 Ga0068857_100336068 Ga0068857_1003360682 78
88 3300005718 Ga0068866_10500962 Ga0068866_105009622 78
89 3300005718 Ga0068866_10793699 Ga0068866_107936992 78
90 3300005719 Ga0068861_100088444 Ga0068861_1000884442 78
91 3300005719 Ga0068861_102029130 Ga0068861_1020291302 78
92 3300005841 Ga0068863_100179556 Ga0068863_1001795562 78
93 3300005842 Ga0068858_100493001 Ga0068858_1004930012 78
94 3300005843 Ga0068860_100040860 Ga0068860_1000408603 78
95 3300005843 Ga0068860_100214402 Ga0068860_1002144022 78
96 3300005843 Ga0068860_100626821 Ga0068860_1006268212 78
97 3300005844 Ga0068862_100137191 Ga0068862_1001371912 78
98 3300005844 Ga0068862_100238024 Ga0068862_1002380242 78
99 3300005844 Ga0068862_100655470 Ga0068862_1006554702 78
100 3300005844 Ga0068862_102014326 Ga0068862_1020143262 78
101 3300005937 Ga0081455_10602442 Ga0081455_106024422 78
102 3300005985 Ga0081539_10000590 Ga0081539_1000059021 78
103 3300006058 Ga0075432_10029671 Ga0075432_100296712 78
104 3300006058 Ga0075432_10263730 Ga0075432_102637302 78
105 3300006058 Ga0075432_10323891 Ga0075432_103238912 78
106 3300006173 Ga0070716_100831971 Ga0070716_1008319712 78
107 3300006844 Ga0075428_100000730 Ga0075428_10000073027 78
108 3300006844 Ga0075428_100002131 Ga0075428_1000021315 78
109 3300006844 Ga0075428_100004460 Ga0075428_1000044608 78
110 3300006844 Ga0075428_100008047 Ga0075428_10000804710 78
111 3300006844 Ga0075428_100078195 Ga0075428_1000781955 78
112 3300006844 Ga0075428_100096687 Ga0075428_1000966873 78
113 3300006844 Ga0075428_100414213 Ga0075428_1004142132 78
114 3300006844 Ga0075428_101285534 Ga0075428_1012855342 78
115 3300006846 Ga0075430_100000231 Ga0075430_1000002315 78
116 3300006846 Ga0075430_100002031 Ga0075430_10000203117 78
117 3300006846 Ga0075430_100014328 Ga0075430_1000143287 78
118 3300006846 Ga0075430_100145930 Ga0075430_1001459302 78
119 3300006846 Ga0075430_100464135 Ga0075430_1004641352 78
120 3300006846 Ga0075430_100518911 Ga0075430_1005189112 78
121 3300006846 Ga0075430_100582619 Ga0075430_1005826192 78
122 3300006847 Ga0075431_100002752 Ga0075431_1000027523 78
123 3300006847 Ga0075431_100003918 Ga0075431_1000039185 78
124 3300006847 Ga0075431_100015118 Ga0075431_1000151185 78
125 3300006847 Ga0075431_100022070 Ga0075431_1000220705 78
126 3300006847 Ga0075431_100022758 Ga0075431_1000227583 78
127 3300006847 Ga0075431_100029323 Ga0075431_1000293235 78
128 3300006847 Ga0075431_100102507 Ga0075431_1001025072 78
129 3300006847 Ga0075431_100204072 Ga0075431_1002040723 78
130 3300006847 Ga0075431_100253927 Ga0075431_1002539272 78
131 3300006847 Ga0075431_100434852 Ga0075431_1004348522 78
132 3300006847 Ga0075431_100581765 Ga0075431_1005817652 78
133 3300006847 Ga0075431_101222792 Ga0075431_1012227922 78
134 3300006852 Ga0075433_10011771 Ga0075433_100117716 78
135 3300006852 Ga0075433_10074726 Ga0075433_100747262 78
136 3300006852 Ga0075433_10091142 Ga0075433_100911422 78
137 3300006852 Ga0075433_10118719 Ga0075433_101187193 78
138 3300006852 Ga0075433_10161033 Ga0075433_101610332 78
139 3300006852 Ga0075433_10210560 Ga0075433_102105603 78
140 3300006852 Ga0075433_10220432 Ga0075433_102204322 78
141 3300006852 Ga0075433_10324497 Ga0075433_103244972 78
142 3300006852 Ga0075433_10394673 Ga0075433_103946732 78
143 3300006852 Ga0075433_10912699 Ga0075433_109126992 78
144 3300006852 Ga0075433_11724673 Ga0075433_117246732 78
145 3300006871 Ga0075434_100030799 Ga0075434_1000307993 78
146 3300006871 Ga0075434_100106945 Ga0075434_1001069453 78
147 3300006871 Ga0075434_100331049 Ga0075434_1003310492 78
148 3300006871 Ga0075434_100338657 Ga0075434_1003386572 78
149 3300006871 Ga0075434_100414122 Ga0075434_1004141223 78
150 3300006871 Ga0075434_101414029 Ga0075434_1014140292 78
151 3300006871 Ga0075434_102564424 Ga0075434_1025644241 78
152 3300006871 Ga0075434_102616127 Ga0075434_1026161271 78
153 3300006880 Ga0075429_100002010 Ga0075429_1000020105 78
154 3300006880 Ga0075429_100002286 Ga0075429_1000022869 78
155 3300006880 Ga0075429_100002758 Ga0075429_1000027588 78
156 3300006880 Ga0075429_100003688 Ga0075429_1000036882 78
157 3300006880 Ga0075429_100023521 Ga0075429_1000235215 78
158 3300006880 Ga0075429_100043759 Ga0075429_1000437592 78
159 3300006880 Ga0075429_100079948 Ga0075429_1000799483 78
160 3300006880 Ga0075429_100106147 Ga0075429_1001061473 78
161 3300006880 Ga0075429_100253745 Ga0075429_1002537452 78
162 3300006880 Ga0075429_100884616 Ga0075429_1008846162 78
163 3300006881 Ga0068865_100056328 Ga0068865_1000563283 78
164 3300006914 Ga0075436_100038531 Ga0075436_1000385312 78
165 3300006914 Ga0075436_100060960 Ga0075436_1000609602 78
166 3300006914 Ga0075436_100162499 Ga0075436_1001624992 78
167 3300006914 Ga0075436_100342526 Ga0075436_1003425262 78
168 3300006914 Ga0075436_100683031 Ga0075436_1006830311 78
169 3300006914 Ga0075436_101000859 Ga0075436_1010008592 78
170 3300007076 Ga0075435_100038595 Ga0075435_1000385952 78
171 3300007076 Ga0075435_100040907 Ga0075435_1000409073 78
172 3300007076 Ga0075435_100268651 Ga0075435_1002686512 78
173 3300007076 Ga0075435_100395649 Ga0075435_1003956492 78
174 3300007076 Ga0075435_100500341 Ga0075435_1005003412 78
175 3300007076 Ga0075435_101145914 Ga0075435_1011459142 78
176 3300007265 Ga0099794_10004846 Ga0099794_100048463 78
177 3300007265 Ga0099794_10119176 Ga0099794_101191762 78
178 3300007265 Ga0099794_10352066 Ga0099794_103520662 78
179 3300009094 Ga0111539_10005374 Ga0111539_100053746 78
180 3300009094 Ga0111539_10007166 Ga0111539_100071669 78
181 3300009094 Ga0111539_10287683 Ga0111539_102876833 78
182 3300009094 Ga0111539_10410888 Ga0111539_104108882 78
183 3300009094 Ga0111539_10591047 Ga0111539_105910472 78
184 3300009147 Ga0114129_10000409 Ga0114129_1000040948 78
185 3300009147 Ga0114129_10005405 Ga0114129_100054055 78
186 3300009147 Ga0114129_10012846 Ga0114129_100128464 78
187 3300009147 Ga0114129_10027218 Ga0114129_100272187 78
188 3300009147 Ga0114129_10041382 Ga0114129_100413825 78
189 3300009147 Ga0114129_10048567 Ga0114129_100485674 78
190 3300009147 Ga0114129_10096520 Ga0114129_100965205 78
191 3300009147 Ga0114129_10103915 Ga0114129_101039152 78
192 3300009147 Ga0114129_10117540 Ga0114129_101175405 78
193 3300009147 Ga0114129_10133111 Ga0114129_101331114 78
194 3300009147 Ga0114129_10189267 Ga0114129_101892672 78
195 3300009147 Ga0114129_10380707 Ga0114129_103807072 78
196 3300009147 Ga0114129_10383604 Ga0114129_103836043 78
197 3300009147 Ga0114129_10476342 Ga0114129_104763422 78
198 3300009147 Ga0114129_10740093 Ga0114129_107400932 78
199 3300009147 Ga0114129_11019406 Ga0114129_110194062 78
200 3300009147 Ga0114129_11386082 Ga0114129_113860822 78
201 3300009148 Ga0105243_11030689 Ga0105243_110306891 78
202 3300009148 Ga0105243_11115427 Ga0105243_111154272 78
203 3300009148 Ga0105243_12481902 Ga0105243_124819022 78
204 3300009174 Ga0105241_11162049 Ga0105241_111620492 78
205 3300009176 Ga0105242_10274760 Ga0105242_102747602 78
206 3300009176 Ga0105242_10436934 Ga0105242_104369342 78
207 3300009177 Ga0105248_11493127 Ga0105248_114931272 78
208 3300009553 Ga0105249_10107891 Ga0105249_101078913 78
209 3300009553 Ga0105249_10629519 Ga0105249_106295192 78
210 3300009553 Ga0105249_13579693 Ga0105249_135796932 78
211 3300013297 Ga0157378_10186060 Ga0157378_101860602 78
212 3300013297 Ga0157378_10206834 Ga0157378_102068342 78
213 3300013306 Ga0163162_10035530 Ga0163162_100355304 78
214 3300013306 Ga0163162_10636790 Ga0163162_106367902 78
215 3300013308 Ga0157375_10107120 Ga0157375_101071203 78
216 3300014325 Ga0163163_10738351 Ga0163163_107383512 78
217 3300014745 Ga0157377_11361195 Ga0157377_113611952 78
218 3300017792 Ga0163161_10773749 Ga0163161_107737492 78
219 3300025885 Ga0207653_10336897 Ga0207653_103368972 78
220 3300025899 Ga0207642_10362368 Ga0207642_103623682 78
221 3300025910 Ga0207684_10001569 Ga0207684_1000156913 78
222 3300025910 Ga0207684_10152518 Ga0207684_101525182 78
223 3300025910 Ga0207684_10345744 Ga0207684_103457442 78
224 3300025917 Ga0207660_10095536 Ga0207660_100955363 78
225 3300025922 Ga0207646_10003627 Ga0207646_100036275 78
226 3300025922 Ga0207646_10011305 Ga0207646_100113059 78
227 3300025923 Ga0207681_10005950 Ga0207681_100059507 78
228 3300025923 Ga0207681_10167891 Ga0207681_101678911 78
229 3300025923 Ga0207681_10434216 Ga0207681_104342162 78
230 3300025931 Ga0207644_10365136 Ga0207644_103651362 78
231 3300025933 Ga0207706_10040039 Ga0207706_100400395 78
232 3300025934 Ga0207686_10277975 Ga0207686_102779752 78
233 3300025935 Ga0207709_10327298 Ga0207709_103272982 78
234 3300025938 Ga0207704_10213861 Ga0207704_102138612 78
235 3300025940 Ga0207691_10059467 Ga0207691_100594672 78
236 3300025941 Ga0207711_10500895 Ga0207711_105008952 78
237 3300025941 Ga0207711_10738642 Ga0207711_107386422 78
238 3300025942 Ga0207689_10155863 Ga0207689_101558632 78
239 3300025961 Ga0207712_10353524 Ga0207712_103535242 78
240 3300025961 Ga0207712_10515628 Ga0207712_105156282 78
241 3300025972 Ga0207668_10029590 Ga0207668_100295904 78
242 3300026035 Ga0207703_10263243 Ga0207703_102632432 78
243 3300026067 Ga0207678_11212226 Ga0207678_112122262 78
244 3300026075 Ga0207708_10174889 Ga0207708_101748892 78
245 3300026075 Ga0207708_10544340 Ga0207708_105443402 78
246 3300026088 Ga0207641_10121042 Ga0207641_101210423 78
247 3300026089 Ga0207648_10515399 Ga0207648_105153992 78
248 3300026118 Ga0207675_100055837 Ga0207675_1000558373 78
249 3300026118 Ga0207675_101058813 Ga0207675_1010588132 78
250 3300026118 Ga0207675_101302643 Ga0207675_1013026432 78
251 3300027614 Ga0209970_1049136 Ga0209970_10491361 78
252 3300027671 Ga0209588_1002075 Ga0209588_10020754 78
253 3300027682 Ga0209971_1011959 Ga0209971_10119593 78
254 3300027907 Ga0207428_10006460 Ga0207428_100064603 78
255 3300027907 Ga0207428_10148830 Ga0207428_101488302 78
256 3300027907 Ga0207428_10246787 Ga0207428_102467872 78
257 3300027907 Ga0207428_10952429 Ga0207428_109524292 78
258 3300028380 Ga0268265_10294783 Ga0268265_102947832 78
259 3300028380 Ga0268265_10611385 Ga0268265_106113852 78
260 3300028380 Ga0268265_11036301 Ga0268265_110363012 78
261 3300028380 Ga0268265_12306337 Ga0268265_123063372 78
262 3300028381 Ga0268264_10205469 Ga0268264_102054692 78
263 3300028381 Ga0268264_10686782 Ga0268264_106867822 78
264 3300028381 Ga0268264_11634390 Ga0268264_116343902 78
265 3300031548 Ga0307408_100059036 Ga0307408_1000590363 78
266 3300031548 Ga0307408_100303093 Ga0307408_1003030932 78
267 3300031548 Ga0307408_101519340 Ga0307408_1015193402 78
268 3300031548 Ga0307408_101961701 Ga0307408_1019617011 78
269 3300031731 Ga0307405_10098255 Ga0307405_100982552 78
270 3300031731 Ga0307405_10548613 Ga0307405_105486132 78
271 3300031824 Ga0307413_10540045 Ga0307413_105400452 78
272 3300031824 Ga0307413_10873023 Ga0307413_108730232 78
273 3300031901 Ga0307406_10157534 Ga0307406_101575342 78
274 3300031901 Ga0307406_10363032 Ga0307406_103630322 78
275 3300031901 Ga0307406_10376845 Ga0307406_103768452 78
276 3300031903 Ga0307407_10149190 Ga0307407_101491902 78
277 3300031903 Ga0307407_10548544 Ga0307407_105485442 78
278 3300031903 Ga0307407_10703671 Ga0307407_107036712 78
279 3300031911 Ga0307412_10708459 Ga0307412_107084592 78
280 3300031911 Ga0307412_11947274 Ga0307412_119472741 78
281 3300031995 Ga0307409_100855928 Ga0307409_1008559282 78
282 3300031995 Ga0307409_101366801 Ga0307409_1013668012 78
283 3300032002 Ga0307416_100001116 Ga0307416_1000011166 78
284 3300032002 Ga0307416_100296974 Ga0307416_1002969742 78
285 3300032002 Ga0307416_100483445 Ga0307416_1004834452 78
286 3300032004 Ga0307414_10853757 Ga0307414_108537571 78
287 3300032005 Ga0307411_10253089 Ga0307411_102530892 78
288 3300034816 Ga0373930_0013823 Ga0373930_0013823_148_390 78
289 3300034817 Ga0373948_0099203 Ga0373948_0099203_43_285 78
290 3300034820 Ga0373959_0029697 Ga0373959_0029697_560_802 78
291 3300034957 Ga0373938_0237789 Ga0373938_0237789_212_451 78
292 3300035090 Ga0373949_0220497 Ga0373949_0220497_261_500 78
293 3300035115 Ga0373941_0017800 Ga0373941_0017800_70_312 78
294 3300035115 Ga0373941_0186816 Ga0373941_0186816_526_768 78
295 3300035121 Ga0373960_0032047 Ga0373960_0032047_396_638 78
296 3300035691 Ga0373931_0005687 Ga0373931_0005687_3288_3530 78
297 3300037312 Ga0395899_0108149 Ga0395899_0108149_1595_1834 78
298 3300037418 Ga0395900_0005301 Ga0395900_0005301_1250_1489 78
299 3300037418 Ga0395900_0157056 Ga0395900_0157056_1810_2046 78
300 3300037418 Ga0395900_1604043 Ga0395900_1604043_58_294 78
301 3300037466 Ga0395898_0920375 Ga0395898_0920375_172_411 78
302 3300037471 Ga0395905_0488956 Ga0395905_0488956_873_1109 78
303 3300038443 Ga0395901_0006655 Ga0395901_0006655_1622_1861 78
304 3300038443 Ga0395901_0288985 Ga0395901_0288985_229_465 78
305 3300038443 Ga0395901_1364015 Ga0395901_1364015_407_643 78
306 3300042125 Ga0450923_084503 Ga0450923_084503_142_381 78
307 3300042461 Ga0439460_0325467 Ga0439460_0325467_199_438 78
308 3300042876 Ga0451577_0133090 Ga0451577_0133090_1852_2094 78
309 3300042876 Ga0451577_1964739 Ga0451577_1964739_253_492 78
310 3300044673 Ga0453683_0049752 Ga0453683_0049752_1513_1755 78
311 3300045051 Ga0451576_0927356 Ga0451576_0927356_199_438 78
312 3300045051 Ga0451576_1030787 Ga0451576_1030787_32_271 78
313 3300045051 Ga0451576_1358889 Ga0451576_1358889_261_500 78
314 3300046499 Ga0495594_0145992 Ga0495594_0145992_367_606 78
315 3300046501 Ga0495607_0240936 Ga0495607_0240936_305_544 78
316 3300046528 Ga0495642_0046221 Ga0495642_0046221_1044_1283 78
317 3300046539 Ga0495621_0042337 Ga0495621_0042337_1030_1269 78
318 3300046539 Ga0495621_0498851 Ga0495621_0498851_222_461 78
319 3300046557 Ga0495622_0286852 Ga0495622_0286852_362_601 78
320 3300046615 Ga0495656_0168259 Ga0495656_0168259_744_983 78
321 3300046664 Ga0495659_0038870 Ga0495659_0038870_1083_1322 78
322 3300046664 Ga0495659_0252966 Ga0495659_0252966_89_328 78
323 3300046684 Ga0495669_0127823 Ga0495669_0127823_563_802 78
324 3300046684 Ga0495669_0245689 Ga0495669_0245689_128_367 78
325 3300047318 Ga0495636_0008556 Ga0495636_0008556_3661_3900 78
326 3300048905 Ga0496102_0020793 Ga0496102_0020793_3497_3739 78
327 3300048909 Ga0496106_0353466 Ga0496106_0353466_451_690 78
328 3300048909 Ga0496106_0661919 Ga0496106_0661919_581_823 78
329 3300048909 Ga0496106_0843949 Ga0496106_0843949_473_712 78
330 3300048910 Ga0496107_0392864 Ga0496107_0392864_416_658 78
331 3300048910 Ga0496107_0647534 Ga0496107_0647534_214_453 78
332 3300049568 Ga0501031_0073696 Ga0501031_0073696_391_651 78
333 3300049568 Ga0501031_0544019 Ga0501031_0544019_324_563 78
334 3300049569 Ga0501032_0491778 Ga0501032_0491778_343_603 78
335 3300049570 Ga0501033_0592062 Ga0501033_0592062_412_672 78
336 3300049570 Ga0501033_1047399 Ga0501033_1047399_66_305 78
337 3300049572 Ga0501036_0128413 Ga0501036_0128413_585_845 78
338 3300049572 Ga0501036_0769670 Ga0501036_0769670_288_527 78
339 3300049572 Ga0501036_0870226 Ga0501036_0870226_240_482 78
340 3300049572 Ga0501036_0892787 Ga0501036_0892787_187_426 78
341 3300049574 Ga0501038_0151067 Ga0501038_0151067_1197_1457 78
342 3300049574 Ga0501038_0233255 Ga0501038_0233255_107_346 78
343 3300049574 Ga0501038_0560416 Ga0501038_0560416_358_597 78
344 3300049574 Ga0501038_0791671 Ga0501038_0791671_51_293 78
345 3300049575 Ga0501039_0123427 Ga0501039_0123427_256_516 78
346 3300049575 Ga0501039_0456659 Ga0501039_0456659_752_991 78
347 3300049575 Ga0501039_0551161 Ga0501039_0551161_651_890 78
348 3300049575 Ga0501039_1090793 Ga0501039_1090793_222_461 78
349 3300049575 Ga0501039_1296195 Ga0501039_1296195_296_535 78
350 3300049576 Ga0501040_0023620 Ga0501040_0023620_394_633 78
351 3300049576 Ga0501040_0039674 Ga0501040_0039674_1659_1919 78
352 3300049576 Ga0501040_0196215 Ga0501040_0196215_585_827 78
353 3300049576 Ga0501040_0303194 Ga0501040_0303194_457_696 78
354 3300049576 Ga0501040_0309652 Ga0501040_0309652_699_938 78
355 3300049576 Ga0501040_0352427 Ga0501040_0352427_269_511 78
356 3300049576 Ga0501040_0386110 Ga0501040_0386110_727_966 78
357 3300049576 Ga0501040_0562558 Ga0501040_0562558_195_434 78
358 3300049577 Ga0501041_0015767 Ga0501041_0015767_430_690 78
359 3300049577 Ga0501041_0107730 Ga0501041_0107730_42_281 78
360 3300049577 Ga0501041_0361252 Ga0501041_0361252_521_760 78
361 3300049577 Ga0501041_0546713 Ga0501041_0546713_328_567 78
362 3300049578 Ga0501042_0007494 Ga0501042_0007494_4817_5077 78
363 3300049578 Ga0501042_0088395 Ga0501042_0088395_1300_1542 78
364 3300049578 Ga0501042_0093054 Ga0501042_0093054_124_363 78
365 3300049578 Ga0501042_0153670 Ga0501042_0153670_1155_1394 78
366 3300049578 Ga0501042_0597807 Ga0501042_0597807_552_791 78
367 3300049578 Ga0501042_1196682 Ga0501042_1196682_112_351 78
368 3300049579 Ga0501043_0135906 Ga0501043_0135906_342_602 78
369 3300049579 Ga0501043_0985152 Ga0501043_0985152_63_302 78
370 3300049580 Ga0501046_0103769 Ga0501046_0103769_762_1022 78
371 3300049580 Ga0501046_0486464 Ga0501046_0486464_302_544 78
372 3300049580 Ga0501046_0750187 Ga0501046_0750187_325_564 78
373 3300049580 Ga0501046_0787235 Ga0501046_0787235_323_562 78
374 3300049582 Ga0501048_0227392 Ga0501048_0227392_1015_1260 78
375 3300049582 Ga0501048_0378600 Ga0501048_0378600_345_587 78
376 3300049582 Ga0501048_0552500 Ga0501048_0552500_155_394 78
377 3300049582 Ga0501048_0573271 Ga0501048_0573271_520_759 78
378 3300049582 Ga0501048_0623214 Ga0501048_0623214_125_364 78
379 3300049582 Ga0501048_1243973 Ga0501048_1243973_171_410 78
380 3300049583 Ga0501067_0017887 Ga0501067_0017887_3146_3385 78
381 3300049583 Ga0501067_0607223 Ga0501067_0607223_225_464 78
382 3300049584 Ga0501068_0085412 Ga0501068_0085412_828_1067 78
383 3300049584 Ga0501068_0270257 Ga0501068_0270257_531_770 78
384 3300049584 Ga0501068_0395711 Ga0501068_0395711_448_708 78
385 3300049585 Ga0501069_0095988 Ga0501069_0095988_631_870 78
386 3300049586 Ga0501070_0422118 Ga0501070_0422118_807_1043 78
387 3300049587 Ga0501071_0020373 Ga0501071_0020373_105_365 78
388 3300049587 Ga0501071_0523232 Ga0501071_0523232_279_521 78
389 3300049587 Ga0501071_0556971 Ga0501071_0556971_122_364 78
390 3300049587 Ga0501071_0705729 Ga0501071_0705729_225_464 78
391 3300049587 Ga0501071_0841096 Ga0501071_0841096_329_568 78
392 3300049588 Ga0501072_0088028 Ga0501072_0088028_861_1103 78
393 3300049588 Ga0501072_0102912 Ga0501072_0102912_1419_1658 78
394 3300049588 Ga0501072_0111527 Ga0501072_0111527_1436_1696 78
395 3300049588 Ga0501072_0201827 Ga0501072_0201827_1123_1362 78
396 3300049588 Ga0501072_0219998 Ga0501072_0219998_1248_1490 78
397 3300049588 Ga0501072_0455531 Ga0501072_0455531_354_593 78
398 3300049589 Ga0501073_0270167 Ga0501073_0270167_673_933 78
399 3300049590 Ga0501074_0060028 Ga0501074_0060028_565_825 78
400 3300049590 Ga0501074_0126708 Ga0501074_0126708_66_308 78
401 3300049590 Ga0501074_0251959 Ga0501074_0251959_148_387 78
402 3300049590 Ga0501074_0392568 Ga0501074_0392568_253_492 78
403 3300049591 Ga0501075_0011352 Ga0501075_0011352_1603_1863 78
404 3300049591 Ga0501075_0047410 Ga0501075_0047410_229_471 78
405 3300049591 Ga0501075_0085383 Ga0501075_0085383_207_446 78
406 3300049591 Ga0501075_0092149 Ga0501075_0092149_228_467 78
407 3300049591 Ga0501075_0100916 Ga0501075_0100916_588_827 78
408 3300049591 Ga0501075_0475362 Ga0501075_0475362_673_915 78
409 3300049591 Ga0501075_0494730 Ga0501075_0494730_620_859 78
410 3300049592 Ga0501076_0012196 Ga0501076_0012196_2049_2309 78
411 3300049592 Ga0501076_0184330 Ga0501076_0184330_474_713 78
412 3300049592 Ga0501076_0203696 Ga0501076_0203696_1014_1253 78
413 3300049592 Ga0501076_0284026 Ga0501076_0284026_273_515 78
414 3300049592 Ga0501076_0534857 Ga0501076_0534857_578_820 78
415 3300049592 Ga0501076_0997226 Ga0501076_0997226_69_308 78
416 3300049592 Ga0501076_1168476 Ga0501076_1168476_203_442 78
417 3300049593 Ga0501077_0003874 Ga0501077_0003874_4705_4965 78
418 3300049593 Ga0501077_0064014 Ga0501077_0064014_549_788 78
419 3300049593 Ga0501077_0077607 Ga0501077_0077607_1297_1539 78
420 3300049593 Ga0501077_0458025 Ga0501077_0458025_250_489 78
421 3300049593 Ga0501077_0461225 Ga0501077_0461225_299_538 78
422 3300049593 Ga0501077_0495399 Ga0501077_0495399_426_668 78
423 3300049741 Ga0501079_0103802 Ga0501079_0103802_419_658 78
424 3300049741 Ga0501079_0116363 Ga0501079_0116363_624_863 78
425 3300049741 Ga0501079_0119718 Ga0501079_0119718_369_629 78
426 3300049741 Ga0501079_0319650 Ga0501079_0319650_188_430 78
427 3300049741 Ga0501079_0379917 Ga0501079_0379917_573_812 78
428 3300049741 Ga0501079_0950581 Ga0501079_0950581_23_262 78
429 3300049742 Ga0501080_0270605 Ga0501080_0270605_292_552 78
430 3300049742 Ga0501080_0588415 Ga0501080_0588415_696_935 78
431 3300049742 Ga0501080_0590249 Ga0501080_0590249_273_512 78
432 3300049743 Ga0501081_0048829 Ga0501081_0048829_2187_2426 78
433 3300049743 Ga0501081_0117412 Ga0501081_0117412_225_485 78
434 3300049743 Ga0501081_0132540 Ga0501081_0132540_19_261 78
435 3300049743 Ga0501081_0143650 Ga0501081_0143650_1417_1656 78
436 3300049743 Ga0501081_0255713 Ga0501081_0255713_519_758 78
437 3300049743 Ga0501081_0307216 Ga0501081_0307216_771_1013 78
438 3300049743 Ga0501081_0553971 Ga0501081_0553971_546_785 78
439 3300049743 Ga0501081_0677490 Ga0501081_0677490_517_756 78
440 3300049743 Ga0501081_0910518 Ga0501081_0910518_320_559 78
441 3300049744 Ga0501083_0647434 Ga0501083_0647434_146_406 78
442 3300049744 Ga0501083_1113757 Ga0501083_1113757_38_277 78
443 3300049822 Ga0501035_0305417 Ga0501035_0305417_544_783 78
444 3300049822 Ga0501035_0642821 Ga0501035_0642821_305_547 78
445 3300049823 Ga0501044_1277137 Ga0501044_1277137_338_580 78
446 3300049824 Ga0501045_0008979 Ga0501045_0008979_5982_6242 78
447 3300049824 Ga0501045_0161448 Ga0501045_0161448_783_1025 78
448 3300049824 Ga0501045_0199978 Ga0501045_0199978_719_958 78
449 3300049824 Ga0501045_0240945 Ga0501045_0240945_110_349 78
450 3300049824 Ga0501045_0503115 Ga0501045_0503115_204_446 78
451 3300050507 nmdc:mga05p37_132165_c1 nmdc:mga05p37_132165_c1_511_750 78
452 3300050507 nmdc:mga05p37_176098_c1 nmdc:mga05p37_176098_c1_957_1193 78
453 3300050507 nmdc:mga05p37_1924237_c1 nmdc:mga05p37_1924237_c1_36_275 78
454 3300050507 nmdc:mga05p37_195378_c1 nmdc:mga05p37_195378_c1_639_875 78
455 3300050507 nmdc:mga05p37_1966837_c1 nmdc:mga05p37_1966837_c1_287_526 78
456 3300050507 nmdc:mga05p37_19747_c1 nmdc:mga05p37_19747_c1_7043_7282 78
457 3300050507 nmdc:mga05p37_2239365_c1 nmdc:mga05p37_2239365_c1_250_492 78
458 3300050507 nmdc:mga05p37_259751_c1 nmdc:mga05p37_259751_c1_205_444 78
459 3300050507 nmdc:mga05p37_26564_c1 nmdc:mga05p37_26564_c1_520_759 78
460 3300050507 nmdc:mga05p37_26790_c1 nmdc:mga05p37_26790_c1_6501_6743 78
461 3300050507 nmdc:mga05p37_282780_c1 nmdc:mga05p37_282780_c1_27_266 78
462 3300050507 nmdc:mga05p37_3637_c1 nmdc:mga05p37_3637_c1_4831_5067 78
463 3300050507 nmdc:mga05p37_441035_c1 nmdc:mga05p37_441035_c1_750_989 78
464 3300050507 nmdc:mga05p37_64400_c1 nmdc:mga05p37_64400_c1_3131_3370 78
465 3300050507 nmdc:mga05p37_771225_c1 nmdc:mga05p37_771225_c1_585_824 78
466 3300050507 nmdc:mga05p37_780639_c1 nmdc:mga05p37_780639_c1_82_318 78
467 3300050507 nmdc:mga05p37_8064_c1 nmdc:mga05p37_8064_c1_2365_2601 78
468 3300050508 nmdc:mga09592_1309617_c1 nmdc:mga09592_1309617_c1_104_343 78
469 3300050508 nmdc:mga09592_15543_c1 nmdc:mga09592_15543_c1_2106_2345 78
470 3300050508 nmdc:mga09592_177716_c1 nmdc:mga09592_177716_c1_1135_1374 78
471 3300050508 nmdc:mga09592_2304_c1 nmdc:mga09592_2304_c1_1721_1957 78
472 3300050508 nmdc:mga09592_2514_c1 nmdc:mga09592_2514_c1_8608_8844 78
473 3300050508 nmdc:mga09592_49343_c1 nmdc:mga09592_49343_c1_168_410 78
474 3300050508 nmdc:mga09592_626766_c1 nmdc:mga09592_626766_c1_382_618 78
475 3300050508 nmdc:mga09592_62904_c1 nmdc:mga09592_62904_c1_2722_2961 78
476 3300050508 nmdc:mga09592_723052_c1 nmdc:mga09592_723052_c1_244_483 78
477 3300050508 nmdc:mga09592_8676_c1 nmdc:mga09592_8676_c1_252_491 78
478 3300050509 nmdc:mga0qj67_1112309_c1 nmdc:mga0qj67_1112309_c1_73_315 78
479 3300050509 nmdc:mga0qj67_1162516_c1 nmdc:mga0qj67_1162516_c1_150_386 78
480 3300050509 nmdc:mga0qj67_119519_c1 nmdc:mga0qj67_119519_c1_990_1229 78
481 3300050509 nmdc:mga0qj67_12384_c1 nmdc:mga0qj67_12384_c1_3715_3954 78
482 3300050509 nmdc:mga0qj67_357675_c1 nmdc:mga0qj67_357675_c1_761_1000 78
483 3300050509 nmdc:mga0qj67_4235_c1 nmdc:mga0qj67_4235_c1_6763_7002 78
484 3300050509 nmdc:mga0qj67_437086_c1 nmdc:mga0qj67_437086_c1_87_326 78
485 3300050509 nmdc:mga0qj67_450728_c1 nmdc:mga0qj67_450728_c1_214_453 78
486 3300050509 nmdc:mga0qj67_497524_c1 nmdc:mga0qj67_497524_c1_671_916 78
487 3300050509 nmdc:mga0qj67_730_c1 nmdc:mga0qj67_730_c1_12358_12597 78
488 3300050510 nmdc:mga06r32_1001576_c1 nmdc:mga06r32_1001576_c1_184_423 78
489 3300050510 nmdc:mga06r32_1298226_c1 nmdc:mga06r32_1298226_c1_41_280 78
490 3300050510 nmdc:mga06r32_1609976_c1 nmdc:mga06r32_1609976_c1_33_272 78
491 3300050510 nmdc:mga06r32_1754208_c1 nmdc:mga06r32_1754208_c1_55_294 78
492 3300050510 nmdc:mga06r32_21102_c1 nmdc:mga06r32_21102_c1_808_1044 78
493 3300050510 nmdc:mga06r32_220309_c1 nmdc:mga06r32_220309_c1_763_1002 78
494 3300050510 nmdc:mga06r32_244405_c1 nmdc:mga06r32_244405_c1_524_763 78
495 3300050510 nmdc:mga06r32_275544_c1 nmdc:mga06r32_275544_c1_137_376 78
496 3300050510 nmdc:mga06r32_28853_c1 nmdc:mga06r32_28853_c1_1881_2120 78
497 3300050510 nmdc:mga06r32_314408_c1 nmdc:mga06r32_314408_c1_1160_1408 78
498 3300050510 nmdc:mga06r32_336246_c1 nmdc:mga06r32_336246_c1_588_824 78
499 3300050510 nmdc:mga06r32_4632_c1 nmdc:mga06r32_4632_c1_177_413 78
500 3300050510 nmdc:mga06r32_4693_c1 nmdc:mga06r32_4693_c1_8768_9007 78
501 3300050511 nmdc:mga08y16_1525_c2 nmdc:mga08y16_1525_c2_14750_14989 78
502 3300050511 nmdc:mga08y16_262979_c1 nmdc:mga08y16_262979_c1_584_823 78
503 3300050511 nmdc:mga08y16_272425_c1 nmdc:mga08y16_272425_c1_1238_1480 78
504 3300050511 nmdc:mga08y16_473861_c1 nmdc:mga08y16_473861_c1_742_981 78
505 3300050511 nmdc:mga08y16_514100_c1 nmdc:mga08y16_514100_c1_870_1109 78
506 3300050512 nmdc:mga0n895_104422_c1 nmdc:mga0n895_104422_c1_586_828 78
507 3300050512 nmdc:mga0n895_12674_c1 nmdc:mga0n895_12674_c1_6566_6805 78
508 3300050512 nmdc:mga0n895_1404297_c1 nmdc:mga0n895_1404297_c1_27_266 78
509 3300050512 nmdc:mga0n895_2053864_c1 nmdc:mga0n895_2053864_c1_242_481 78
510 3300050512 nmdc:mga0n895_2180744_c1 nmdc:mga0n895_2180744_c1_39_275 78
511 3300050512 nmdc:mga0n895_261735_c1 nmdc:mga0n895_261735_c1_294_533 78
512 3300050512 nmdc:mga0n895_81860_c1 nmdc:mga0n895_81860_c1_1028_1270 78
513 3300050513 nmdc:mga0rr50_1837884_c1 nmdc:mga0rr50_1837884_c1_236_472 78
514 3300050513 nmdc:mga0rr50_252136_c1 nmdc:mga0rr50_252136_c1_675_917 78
515 3300050513 nmdc:mga0rr50_58390_c1 nmdc:mga0rr50_58390_c1_2190_2429 78
516 3300050513 nmdc:mga0rr50_627672_c1 nmdc:mga0rr50_627672_c1_444_683 78
517 3300050513 nmdc:mga0rr50_677900_c1 nmdc:mga0rr50_677900_c1_479_718 78
518 3300050513 nmdc:mga0rr50_68524_c1 nmdc:mga0rr50_68524_c1_1155_1394 78
519 3300050513 nmdc:mga0rr50_790125_c1 nmdc:mga0rr50_790125_c1_299_538 78
520 3300050514 nmdc:mga08x19_1326301_c1 nmdc:mga08x19_1326301_c1_39_275 78
521 3300050514 nmdc:mga08x19_14078_c1 nmdc:mga08x19_14078_c1_2428_2667 78
522 3300050514 nmdc:mga08x19_178043_c1 nmdc:mga08x19_178043_c1_1186_1425 78
523 3300050514 nmdc:mga08x19_24491_c1 nmdc:mga08x19_24491_c1_747_986 78
524 3300050514 nmdc:mga08x19_638205_c1 nmdc:mga08x19_638205_c1_503_742 78
525 3300050514 nmdc:mga08x19_700140_c1 nmdc:mga08x19_700140_c1_234_473 78
526 3300050515 nmdc:mga0a205_104887_c1 nmdc:mga0a205_104887_c1_1758_1997 78
527 3300050515 nmdc:mga0a205_1405688_c1 nmdc:mga0a205_1405688_c1_231_470 78
528 3300050515 nmdc:mga0a205_347210_c1 nmdc:mga0a205_347210_c1_195_434 78
529 3300050515 nmdc:mga0a205_390220_c1 nmdc:mga0a205_390220_c1_983_1219 78
530 3300050515 nmdc:mga0a205_403295_c1 nmdc:mga0a205_403295_c1_244_483 78
531 3300050515 nmdc:mga0a205_46111_c1 nmdc:mga0a205_46111_c1_2973_3209 78
532 3300050515 nmdc:mga0a205_47747_c1 nmdc:mga0a205_47747_c1_540_782 78
533 3300050515 nmdc:mga0a205_61655_c1 nmdc:mga0a205_61655_c1_2203_2442 78
534 3300050515 nmdc:mga0a205_774180_c1 nmdc:mga0a205_774180_c1_352_591 78
535 3300054114 Ga0501084_0027433 Ga0501084_0027433_1252_1512 78
536 3300054114 Ga0501084_0034022 Ga0501084_0034022_1115_1354 78
537 3300054114 Ga0501084_0049665 Ga0501084_0049665_2385_2627 78
538 3300054114 Ga0501084_0239085 Ga0501084_0239085_890_1132 78
539 3300054114 Ga0501084_0397853 Ga0501084_0397853_273_512 78
540 3300054114 Ga0501084_0404821 Ga0501084_0404821_689_928 78
541 3300054114 Ga0501084_0566251 Ga0501084_0566251_600_839 78
542 3300054114 Ga0501084_1446895 Ga0501084_1446895_267_506 78
543 3300059424 Ga0590075_179634 Ga0590075_179634_251_490 78
544 3300059426 Ga0590077_115603 Ga0590077_115603_190_429 78
545 3300060353 Ga0501082_0018583 Ga0501082_0018583_1999_2259 78
546 3300060353 Ga0501082_0164828 Ga0501082_0164828_1652_1891 78
547 3300060353 Ga0501082_0202243 Ga0501082_0202243_20_259 78
548 3300060353 Ga0501082_0210936 Ga0501082_0210936_1398_1640 78
549 3300060353 Ga0501082_0782438 Ga0501082_0782438_126_365 78
550 3300061734 Ga0530510_0000752 Ga0530510_0000752_5752_5994 78
551 3300061734 Ga0530510_0023289 Ga0530510_0023289_903_1163 78
552 3300061734 Ga0530510_0126810 Ga0530510_0126810_237_479 78
553 3300061734 Ga0530510_0255807 Ga0530510_0255807_120_359 78
554 3300061734 Ga0530510_0285738 Ga0530510_0285738_527_769 78
555 3300061734 Ga0530510_0478171 Ga0530510_0478171_422_661 78
556 3300061734 Ga0530510_0615200 Ga0530510_0615200_424_666 78
557 3300061734 Ga0530510_0815872 Ga0530510_0815872_255_494 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02609

Exonuc_VII_S

Exonuclease VII small subunit

6

57

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x4t-assembly1.cif.gz_A solution structure of isy1 domain in hypothetical protein 0.9514 6 44
6ff7-assembly1.cif.gz_w human bact spliceosome core structure 0.9104 6 53
1vp7-assembly3.cif.gz_E crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9021 5 61
1vp7-assembly1.cif.gz_A crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.9015 5 61
1vp7-assembly2.cif.gz_C crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution 0.8852 5 61
ID Description Score Start End Superfamily
af_Q54GH3_197_290_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9476 6 56 1.20.58.160
4goeB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9137 4 45 1.20.5.420
4javA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.9103 6 60 1.10.287.130
af_P00522_1513_1620_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8876 6 46 1.20.120.330
1yxrA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8816 6 53 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A0S8DRV1-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9489 1 51 GO:0005829
GO:0006308
GO:0008855
GO:0009318
AF-A0A2J8B5B0-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9436 2 58 GO:0005829
GO:0006308
GO:0008855
GO:0009318
AF-U1NPJ3-F1-model_v4 Exonuclease VII small subunit 0.9425 1 51 GO:0006308
GO:0008855
GO:0009318
AF-A0A849WH39-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9418 1 54 GO:0005829
GO:0006308
GO:0008855
GO:0009318
AF-A0A1D7TTB7-F1-model_v4 Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) 0.9327 1 55 GO:0005829
GO:0006308
GO:0008855
GO:0009318

Feature Viewer

pLDDT pTM Quality
83.29 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map