F463307

General Info

Members Datasets Scaffolds Average Seq Length
557 213 1114 178

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10206522|Ga0105243_102065222
Length 204
Sequence VLAAQAPAVINPTSIEEDSFMFCPQCGQQQTSGIVRFCSRCGFPLDGVIQLLSTGGMLPVYQNPDEPVKISARRKGVKQGGLLLLIGAVLVPILGVMTDFSNSTFLQILTAFAAIICFVGGPLRMLYAAVFEEGAPNPYRGPRPYVPAQVPPRQFNHHVQPPGLPPQSVQPPAWRSRPITAELATPPSVTENTTRLLDRDEGKE

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
191 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
192 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
193 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
201 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
202 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
205 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 41.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10206522 3300009148 Bacteria 1726
2 SwRhRL3b_contig_3184544 2162886006 Unclassified 1151
3 SwRhRL2b_contig_194186 2162886007 Unclassified 1998
4 JGI24751J29686_10000218 3300002459 Bacteria 24391
5 rootL2_10239218 3300003322 Bacteria 2010
6 rootL2_10261268 3300003322 Bacteria 1946
7 Ga0065712_10021997 3300005290 Bacteria 2074
8 Ga0065712_10128382 3300005290 Bacteria 1579
9 Ga0065715_10005100 3300005293 Bacteria 3294
10 Ga0065715_10094547 3300005293 Bacteria 4308
11 Ga0065715_10134221 3300005293 Unclassified 1959
12 Ga0065715_10159827 3300005293 Unclassified 1598
13 Ga0065715_10427804 3300005293 Unclassified 847
14 Ga0065715_10471686 3300005293 Unclassified 805
15 Ga0065715_10580737 3300005293 Bacteria 720
16 Ga0065707_10011695 3300005295 Bacteria 3183
17 Ga0070676_10452792 3300005328 Unclassified 903
18 Ga0070676_10516370 3300005328 Unclassified 850
19 Ga0070690_100317436 3300005330 Bacteria 1122
20 Ga0070670_100001942 3300005331 Bacteria 16927
21 Ga0070670_100082192 3300005331 Bacteria 2768
22 Ga0070670_100190676 3300005331 Unclassified 1781
23 Ga0070670_100223868 3300005331 Bacteria 1637
24 Ga0070670_100224136 3300005331 Bacteria 1636
25 Ga0070677_10122467 3300005333 Bacteria 1176
26 Ga0068869_100767575 3300005334 Unclassified 827
27 Ga0070666_10078475 3300005335 Bacteria 2254
28 Ga0070666_10235350 3300005335 Unclassified 1294
29 Ga0070680_100051153 3300005336 Bacteria 3371
30 Ga0070680_100101773 3300005336 Bacteria 2385
31 Ga0070680_100489946 3300005336 Unclassified 1051
32 Ga0070682_100033639 3300005337 Bacteria 3116
33 Ga0068868_100382103 3300005338 Unclassified 1212
34 Ga0068868_100535719 3300005338 Unclassified 1030
35 Ga0070660_100116441 3300005339 Bacteria 2131
36 Ga0070689_100003738 3300005340 Bacteria 10192
37 Ga0070689_100579435 3300005340 Bacteria 970
38 Ga0070687_100004634 3300005343 Bacteria 5495
39 Ga0070687_100189263 3300005343 Unclassified 1239
40 Ga0070661_100056588 3300005344 Bacteria 2874
41 Ga0070692_10001483 3300005345 Bacteria 8562
42 Ga0070692_10027312 3300005345 Unclassified 2828
43 Ga0070692_10077167 3300005345 Bacteria 1787
44 Ga0070692_10116036 3300005345 Bacteria 1487
45 Ga0070692_10187109 3300005345 Unclassified 1204
46 Ga0070669_100003818 3300005353 Bacteria 10877
47 Ga0070669_100115698 3300005353 Bacteria 2040
48 Ga0070675_100230312 3300005354 Bacteria 1616
49 Ga0070673_100113055 3300005364 Bacteria 2255
50 Ga0070673_100211762 3300005364 Unclassified 1674
51 Ga0070673_101402196 3300005364 Unclassified 658
52 Ga0070688_100499427 3300005365 Unclassified 917
53 Ga0070659_100002310 3300005366 Bacteria 13569
54 Ga0070667_100373441 3300005367 Unclassified 1294
55 Ga0070703_10059516 3300005406 Unclassified 1246
56 Ga0070701_10081734 3300005438 Bacteria 1751
57 Ga0070701_10403194 3300005438 Bacteria 867
58 Ga0070705_100079077 3300005440 Unclassified 2013
59 Ga0070705_100288515 3300005440 Bacteria 1170
60 Ga0070700_100022792 3300005441 Bacteria 3657
61 Ga0070700_100105208 3300005441 Bacteria 1866
62 Ga0070700_100117575 3300005441 Unclassified 1776
63 Ga0070700_100146726 3300005441 Bacteria 1609
64 Ga0070700_100193924 3300005441 Unclassified 1422
65 Ga0070694_100009139 3300005444 Bacteria 6079
66 Ga0070694_100018842 3300005444 Bacteria 4385
67 Ga0070694_100034291 3300005444 Bacteria 3346
68 Ga0070694_100098871 3300005444 Unclassified 2061
69 Ga0070694_100180355 3300005444 Bacteria 1562
70 Ga0070694_100219619 3300005444 Unclassified 1425
71 Ga0070694_100388939 3300005444 Bacteria 1089
72 Ga0070694_100399582 3300005444 Unclassified 1076
73 Ga0070708_100157625 3300005445 Unclassified 2114
74 Ga0070708_100806383 3300005445 Unclassified 882
75 Ga0070678_100546340 3300005456 Unclassified 1028
76 Ga0070681_10002139 3300005458 Bacteria 17954
77 Ga0070681_10002839 3300005458 Bacteria 16010
78 Ga0070681_10988671 3300005458 Unclassified 761
79 Ga0068867_100050219 3300005459 Bacteria 3073
80 Ga0068867_100084812 3300005459 Bacteria 2394
81 Ga0068867_100170776 3300005459 Bacteria 1722
82 Ga0068867_100178951 3300005459 Bacteria 1685
83 Ga0068867_100491056 3300005459 Bacteria 1054
84 Ga0068867_101188076 3300005459 Unclassified 700
85 Ga0070685_10388480 3300005466 Unclassified 963
86 Ga0070685_10558833 3300005466 Unclassified 818
87 Ga0070706_100819671 3300005467 Unclassified 861
88 Ga0070707_100013470 3300005468 Bacteria 7651
89 Ga0070698_100014531 3300005471 Bacteria 8311
90 Ga0070698_100072608 3300005471 Bacteria 3449
91 Ga0070699_100004458 3300005518 Bacteria 12381
92 Ga0070699_100121997 3300005518 Unclassified 2292
93 Ga0070699_100421183 3300005518 Unclassified 1208
94 Ga0070699_100869518 3300005518 Bacteria 825
95 Ga0070679_100028987 3300005530 Bacteria 5460
96 Ga0070679_100360104 3300005530 Bacteria 1402
97 Ga0070697_100262488 3300005536 Unclassified 1479
98 Ga0070697_100422115 3300005536 Unclassified 1159
99 Ga0068853_100008811 3300005539 Bacteria 8114
100 Ga0068853_100040408 3300005539 Bacteria 3979
101 Ga0068853_100096189 3300005539 Bacteria 2612
102 Ga0068853_100749063 3300005539 Unclassified 933
103 Ga0070672_100312993 3300005543 Unclassified 1333
104 Ga0070672_100539886 3300005543 Unclassified 1011
105 Ga0070686_100004304 3300005544 Bacteria 7836
106 Ga0070686_100008472 3300005544 Bacteria 5758
107 Ga0070686_100458732 3300005544 Bacteria 981
108 Ga0070686_100650528 3300005544 Unclassified 836
109 Ga0070686_101070829 3300005544 Unclassified 664
110 Ga0070695_100088744 3300005545 Bacteria 2060
111 Ga0070695_100145538 3300005545 Bacteria 1648
112 Ga0070695_100282225 3300005545 Unclassified 1221
113 Ga0070695_100343070 3300005545 Unclassified 1117
114 Ga0070695_100593332 3300005545 Unclassified 869
115 Ga0070696_100088855 3300005546 Unclassified 2197
116 Ga0070696_100091518 3300005546 Unclassified 2166
117 Ga0070696_100258150 3300005546 Unclassified 1320
118 Ga0070693_100011427 3300005547 Bacteria 4471
119 Ga0070693_100050418 3300005547 Unclassified 2379
120 Ga0070693_100161837 3300005547 Bacteria 1426
121 Ga0070693_100162871 3300005547 Unclassified 1422
122 Ga0070693_100205664 3300005547 Unclassified 1281
123 Ga0070693_100293870 3300005547 Bacteria 1092
124 Ga0070665_100101743 3300005548 Bacteria 2877
125 Ga0070665_101364035 3300005548 Unclassified 718
126 Ga0070704_100007854 3300005549 Bacteria 6365
127 Ga0070704_100008395 3300005549 Bacteria 6192
128 Ga0070704_100120794 3300005549 Unclassified 2012
129 Ga0070704_100278820 3300005549 Bacteria 1384
130 Ga0070704_101078729 3300005549 Unclassified 729
131 Ga0070704_101287587 3300005549 Unclassified 668
132 Ga0070664_100064290 3300005564 Bacteria 3129
133 Ga0068857_100001531 3300005577 Bacteria 18478
134 Ga0068857_100569494 3300005577 Unclassified 1068
135 Ga0068857_100669152 3300005577 Bacteria 985
136 Ga0068854_100193164 3300005578 Bacteria 1596
137 Ga0068854_100204726 3300005578 Unclassified 1553
138 Ga0068854_100232417 3300005578 Bacteria 1464
139 Ga0068856_100051069 3300005614 Bacteria 4077
140 Ga0070702_100002717 3300005615 Bacteria 7731
141 Ga0070702_100009949 3300005615 Bacteria 4670
142 Ga0070702_100092787 3300005615 Bacteria 1834
143 Ga0070702_100192382 3300005615 Unclassified 1343
144 Ga0070702_100225542 3300005615 Unclassified 1256
145 Ga0070702_100367445 3300005615 Bacteria 1019
146 Ga0068852_100433263 3300005616 Unclassified 1299
147 Ga0068852_100702205 3300005616 Unclassified 1022
148 Ga0068852_101029709 3300005616 Unclassified 842
149 Ga0068852_101238794 3300005616 Unclassified 767
150 Ga0068852_101301572 3300005616 Unclassified 748
151 Ga0068859_100042300 3300005617 Archaea 4576
152 Ga0068859_100044990 3300005617 Unclassified 4435
153 Ga0068859_100045907 3300005617 Unclassified 4388
154 Ga0068859_100183256 3300005617 Unclassified 2177
155 Ga0068859_100270784 3300005617 Unclassified 1790
156 Ga0068859_100278699 3300005617 Bacteria 1765
157 Ga0068859_100289083 3300005617 Unclassified 1732
158 Ga0068859_100341918 3300005617 Unclassified 1590
159 Ga0068859_100456604 3300005617 Unclassified 1374
160 Ga0068859_101269614 3300005617 Unclassified 811
161 Ga0068864_100004995 3300005618 Bacteria 10867
162 Ga0068864_100006828 3300005618 Bacteria 9349
163 Ga0068864_100021529 3300005618 Bacteria 5400
164 Ga0068864_100024672 3300005618 Bacteria 5058
165 Ga0068864_100147257 3300005618 Unclassified 2130
166 Ga0068864_100447854 3300005618 Unclassified 1234
167 Ga0068864_100671186 3300005618 Unclassified 1010
168 Ga0068864_100872469 3300005618 Unclassified 888
169 Ga0068864_101685528 3300005618 Unclassified 638
170 Ga0068866_10021422 3300005718 Bacteria 2977
171 Ga0068861_100002667 3300005719 Bacteria 11679
172 Ga0068861_100019293 3300005719 Bacteria 4871
173 Ga0068851_10005305 3300005834 Bacteria 5851
174 Ga0068870_10039111 3300005840 Unclassified 2453
175 Ga0068870_10043271 3300005840 Bacteria 2348
176 Ga0068870_10062704 3300005840 Bacteria 2003
177 Ga0068870_10340835 3300005840 Bacteria 959
178 Ga0068863_100065030 3300005841 Bacteria 3450
179 Ga0068863_100211146 3300005841 Unclassified 1869
180 Ga0068863_100644286 3300005841 Bacteria 1050
181 Ga0068863_100724143 3300005841 Unclassified 990
182 Ga0068863_100962144 3300005841 Unclassified 855
183 Ga0068863_101301499 3300005841 Unclassified 734
184 Ga0068863_101610534 3300005841 Unclassified 658
185 Ga0068858_100053174 3300005842 Bacteria 3747
186 Ga0068858_100053374 3300005842 Bacteria 3739
187 Ga0068858_100053455 3300005842 Bacteria 3736
188 Ga0068858_100117771 3300005842 Bacteria 2483
189 Ga0068858_100197326 3300005842 Bacteria 1902
190 Ga0068858_100351852 3300005842 Unclassified 1411
191 Ga0068858_100352958 3300005842 Unclassified 1409
192 Ga0068860_100034252 3300005843 Unclassified 4870
193 Ga0068860_100093006 3300005843 Bacteria 2874
194 Ga0068860_100136567 3300005843 Bacteria 2355
195 Ga0068860_100146152 3300005843 Bacteria 2275
196 Ga0068860_100307408 3300005843 Unclassified 1554
197 Ga0068860_100412504 3300005843 Unclassified 1338
198 Ga0068860_100594272 3300005843 Unclassified 1112
199 Ga0068862_100207862 3300005844 Bacteria 1767
200 Ga0068862_100233231 3300005844 Bacteria 1670
201 Ga0068862_100482512 3300005844 Bacteria 1174
202 Ga0070716_100024080 3300006173 Bacteria 3237
203 Ga0097621_100001054 3300006237 Bacteria 19298
204 Ga0097621_100006958 3300006237 Bacteria 8054
205 Ga0097621_100092215 3300006237 Bacteria 2537
206 Ga0097621_100127197 3300006237 Unclassified 2165
207 Ga0068871_100002031 3300006358 Bacteria 13713
208 Ga0068871_100096695 3300006358 Bacteria 2468
209 Ga0068871_100436439 3300006358 Unclassified 1172
210 Ga0075428_100084832 3300006844 Bacteria 3455
211 Ga0075430_100428730 3300006846 Unclassified 1091
212 Ga0075431_100105194 3300006847 Bacteria 2912
213 Ga0075431_100478397 3300006847 Unclassified 1238
214 Ga0075433_10383802 3300006852 Bacteria 1240
215 Ga0075434_100012755 3300006871 Bacteria 7977
216 Ga0075434_100231629 3300006871 Bacteria 1867
217 Ga0075434_101247717 3300006871 Unclassified 755
218 Ga0075429_100107733 3300006880 Bacteria 2435
219 Ga0075429_100423734 3300006880 Unclassified 1166
220 Ga0068865_100472379 3300006881 Bacteria 1041
221 Ga0075436_100022800 3300006914 Bacteria 4301
222 Ga0097620_100042300 3300006931 Archaea 4576
223 Ga0097620_100044988 3300006931 Unclassified 4435
224 Ga0097620_100045904 3300006931 Unclassified 4388
225 Ga0097620_100133571 3300006931 Bacteria 2553
226 Ga0097620_100169452 3300006931 Bacteria 2264
227 Ga0097620_100183247 3300006931 Unclassified 2177
228 Ga0097620_100270784 3300006931 Unclassified 1790
229 Ga0097620_100278684 3300006931 Bacteria 1765
230 Ga0097620_100289083 3300006931 Unclassified 1732
231 Ga0097620_100341913 3300006931 Unclassified 1590
232 Ga0097620_100456599 3300006931 Unclassified 1374
233 Ga0097620_100962017 3300006931 Bacteria 937
234 Ga0097620_101269596 3300006931 Unclassified 811
235 Ga0075435_100094458 3300007076 Unclassified 2472
236 Ga0105251_10068542 3300009011 Unclassified 1655
237 Ga0105240_10294296 3300009093 Bacteria 1860
238 Ga0105240_10512508 3300009093 Unclassified 1332
239 Ga0111539_10000649 3300009094 Bacteria 44888
240 Ga0111539_10052149 3300009094 Bacteria 4870
241 Ga0111539_10063470 3300009094 Bacteria 4371
242 Ga0111539_10140813 3300009094 Bacteria 2824
243 Ga0105245_10397320 3300009098 Unclassified 1377
244 Ga0105247_10000299 3300009101 Bacteria 44672
245 Ga0105247_10177299 3300009101 Bacteria 1420
246 Ga0105247_10188970 3300009101 Bacteria 1378
247 Ga0105247_10206805 3300009101 Unclassified 1322
248 Ga0114129_10076503 3300009147 Bacteria 4659
249 Ga0114129_10082952 3300009147 Bacteria 4454
250 Ga0114129_10273895 3300009147 Bacteria 2257
251 Ga0114129_10548835 3300009147 Bacteria 1503
252 Ga0114129_10722319 3300009147 Bacteria 1278
253 Ga0114129_11379796 3300009147 Bacteria 870
254 Ga0114129_11562796 3300009147 Unclassified 809
255 Ga0105243_10008876 3300009148 Bacteria 7692
256 Ga0105243_10138260 3300009148 Unclassified 2075
257 Ga0105243_10302646 3300009148 Unclassified 1450
258 Ga0105243_10674361 3300009148 Bacteria 1005
259 Ga0105243_10887726 3300009148 Unclassified 886
260 Ga0105241_10064339 3300009174 Unclassified 2831
261 Ga0105241_10291756 3300009174 Unclassified 1397
262 Ga0105241_10409137 3300009174 Unclassified 1192
263 Ga0105241_11080133 3300009174 Bacteria 755
264 Ga0105241_11253366 3300009174 Unclassified 704
265 Ga0105242_10001833 3300009176 Bacteria 16678
266 Ga0105242_10123792 3300009176 Unclassified 2223
267 Ga0105242_10195309 3300009176 Bacteria 1794
268 Ga0105242_10955990 3300009176 Bacteria 861
269 Ga0105248_10049456 3300009177 Bacteria 4715
270 Ga0105248_10066463 3300009177 Bacteria 4049
271 Ga0105248_10249853 3300009177 Bacteria 1996
272 Ga0105248_10385817 3300009177 Bacteria 1577
273 Ga0105248_10970354 3300009177 Unclassified 960
274 Ga0105248_12214513 3300009177 Unclassified 625
275 Ga0105237_10001044 3300009545 Bacteria 37212
276 Ga0105237_10017128 3300009545 Bacteria 7516
277 Ga0105237_10653549 3300009545 Unclassified 1058
278 Ga0105238_10021389 3300009551 Bacteria 6589
279 Ga0105238_10078164 3300009551 Unclassified 3300
280 Ga0105249_10003520 3300009553 Bacteria 13543
281 Ga0105249_10014518 3300009553 Bacteria 6962
282 Ga0105249_10022684 3300009553 Bacteria 5624
283 Ga0105249_10482038 3300009553 Unclassified 1283
284 Ga0105249_10648491 3300009553 Bacteria 1113
285 Ga0105239_10074662 3300010375 Bacteria 3728
286 Ga0105239_10236090 3300010375 Bacteria 2052
287 Ga0105239_10265212 3300010375 Bacteria 1931
288 Ga0105239_10327652 3300010375 Unclassified 1727
289 Ga0105239_11598762 3300010375 Unclassified 754
290 Ga0105246_10169218 3300011119 Bacteria 1672
291 Ga0105246_10314543 3300011119 Unclassified 1270
292 Ga0105246_10464525 3300011119 Bacteria 1067
293 Ga0157373_10007413 3300013100 Bacteria 8159
294 Ga0157373_10020203 3300013100 Bacteria 4844
295 Ga0157373_10155575 3300013100 Bacteria 1608
296 Ga0157373_10165708 3300013100 Bacteria 1555
297 Ga0157373_10170103 3300013100 Unclassified 1533
298 Ga0157373_10264971 3300013100 Bacteria 1216
299 Ga0157378_10006996 3300013297 Bacteria 9845
300 Ga0157378_10023911 3300013297 Bacteria 5374
301 Ga0157378_10100467 3300013297 Bacteria 2641
302 Ga0157378_10102123 3300013297 Bacteria 2619
303 Ga0157378_10318098 3300013297 Unclassified 1511
304 Ga0157378_10602837 3300013297 Unclassified 1110
305 Ga0163162_10000664 3300013306 Bacteria 31849
306 Ga0163162_10013687 3300013306 Bacteria 7926
307 Ga0163162_10118911 3300013306 Bacteria 2745
308 Ga0163162_10146332 3300013306 Bacteria 2479
309 Ga0163162_10280392 3300013306 Bacteria 1799
310 Ga0163162_10459068 3300013306 Unclassified 1405
311 Ga0157372_10002400 3300013307 Bacteria 20287
312 Ga0157372_10334901 3300013307 Bacteria 1763
313 Ga0157375_10070995 3300013308 Bacteria 3494
314 Ga0157375_10367910 3300013308 Bacteria 1604
315 Ga0157375_10390522 3300013308 Bacteria 1558
316 Ga0157375_10666383 3300013308 Bacteria 1196
317 Ga0157375_10750095 3300013308 Unclassified 1127
318 Ga0157375_11125173 3300013308 Unclassified 920
319 Ga0157375_11170788 3300013308 Unclassified 901
320 Ga0163163_10001381 3300014325 Bacteria 20487
321 Ga0163163_10001672 3300014325 Bacteria 18710
322 Ga0163163_10032672 3300014325 Bacteria 5028
323 Ga0163163_10081710 3300014325 Bacteria 3234
324 Ga0163163_10235349 3300014325 Bacteria 1881
325 Ga0163163_10349989 3300014325 Bacteria 1533
326 Ga0163163_10488895 3300014325 Unclassified 1292
327 Ga0163163_10794271 3300014325 Bacteria 1010
328 Ga0157380_10001868 3300014326 Bacteria 13937
329 Ga0157380_10013856 3300014326 Bacteria 5888
330 Ga0157380_10772728 3300014326 Bacteria 975
331 Ga0157377_10390028 3300014745 Unclassified 945
332 Ga0157377_10591191 3300014745 Bacteria 790
333 Ga0157379_10194833 3300014968 Unclassified 1831
334 Ga0182007_10041201 3300015262 Unclassified 1540
335 Ga0182007_10099954 3300015262 Unclassified 960
336 Ga0163161_10007452 3300017792 Bacteria 7561
337 Ga0207697_10058389 3300025315 Bacteria 1603
338 Ga0207656_10000264 3300025321 Bacteria 18285
339 Ga0207653_10004921 3300025885 Bacteria 4172
340 Ga0207642_10340557 3300025899 Unclassified 881
341 Ga0207642_10426558 3300025899 Unclassified 799
342 Ga0207710_10050717 3300025900 Bacteria 1862
343 Ga0207710_10132839 3300025900 Unclassified 1196
344 Ga0207688_10187122 3300025901 Bacteria 1237
345 Ga0207680_10213907 3300025903 Unclassified 1319
346 Ga0207645_10075023 3300025907 Unclassified 2165
347 Ga0207643_10000479 3300025908 Bacteria 25852
348 Ga0207643_10006530 3300025908 Bacteria 6251
349 Ga0207643_10064119 3300025908 Unclassified 2103
350 Ga0207643_10163084 3300025908 Unclassified 1342
351 Ga0207643_10479858 3300025908 Bacteria 793
352 Ga0207654_10074965 3300025911 Unclassified 2020
353 Ga0207654_10159272 3300025911 Unclassified 1457
354 Ga0207654_10181230 3300025911 Bacteria 1374
355 Ga0207707_10008296 3300025912 Bacteria 9013
356 Ga0207707_10016870 3300025912 Bacteria 6361
357 Ga0207707_10740269 3300025912 Unclassified 823
358 Ga0207695_10282835 3300025913 Bacteria 1552
359 Ga0207671_10003000 3300025914 Bacteria 17302
360 Ga0207671_10220076 3300025914 Bacteria 1487
361 Ga0207660_10029007 3300025917 Bacteria 3791
362 Ga0207662_10032498 3300025918 Bacteria 3038
363 Ga0207662_10060546 3300025918 Bacteria 2271
364 Ga0207662_10066371 3300025918 Unclassified 2174
365 Ga0207657_10022003 3300025919 Bacteria 5986
366 Ga0207649_10022936 3300025920 Bacteria 3609
367 Ga0207652_10049433 3300025921 Unclassified 3600
368 Ga0207652_10423581 3300025921 Bacteria 1200
369 Ga0207646_10124846 3300025922 Bacteria 2314
370 Ga0207646_10126255 3300025922 Unclassified 2300
371 Ga0207646_10832381 3300025922 Bacteria 821
372 Ga0207681_10080138 3300025923 Bacteria 2302
373 Ga0207681_10346216 3300025923 Bacteria 1189
374 Ga0207694_10020834 3300025924 Bacteria 4963
375 Ga0207694_10068323 3300025924 Unclassified 2775
376 Ga0207694_10458633 3300025924 Bacteria 1064
377 Ga0207650_10000041 3300025925 Bacteria 197115
378 Ga0207650_10285038 3300025925 Unclassified 1346
379 Ga0207650_10305295 3300025925 Bacteria 1301
380 Ga0207650_10526768 3300025925 Unclassified 989
381 Ga0207659_10156489 3300025926 Bacteria 1785
382 Ga0207659_10191638 3300025926 Bacteria 1627
383 Ga0207687_10562187 3300025927 Bacteria 958
384 Ga0207687_10790147 3300025927 Bacteria 809
385 Ga0207644_10031762 3300025931 Bacteria 3681
386 Ga0207644_10162169 3300025931 Bacteria 1739
387 Ga0207690_10003301 3300025932 Bacteria 9652
388 Ga0207706_10107824 3300025933 Unclassified 2451
389 Ga0207686_10000641 3300025934 Bacteria 21571
390 Ga0207686_10070141 3300025934 Unclassified 2251
391 Ga0207686_10213698 3300025934 Bacteria 1388
392 Ga0207686_11073909 3300025934 Bacteria 655
393 Ga0207709_10002165 3300025935 Bacteria 12576
394 Ga0207709_10302633 3300025935 Unclassified 1190
395 Ga0207670_10000272 3300025936 Bacteria 32194
396 Ga0207670_10472101 3300025936 Unclassified 1015
397 Ga0207704_10186002 3300025938 Unclassified 1506
398 Ga0207704_10381688 3300025938 Unclassified 1106
399 Ga0207665_10034696 3300025939 Bacteria 3347
400 Ga0207691_10211389 3300025940 Bacteria 1685
401 Ga0207711_10176453 3300025941 Bacteria 1941
402 Ga0207711_10217635 3300025941 Unclassified 1746
403 Ga0207711_10493632 3300025941 Unclassified 1141
404 Ga0207711_10634858 3300025941 Unclassified 996
405 Ga0207711_10863002 3300025941 Bacteria 842
406 Ga0207689_10086351 3300025942 Unclassified 2579
407 Ga0207689_10289102 3300025942 Bacteria 1358
408 Ga0207689_10581440 3300025942 Unclassified 942
409 Ga0207689_10825897 3300025942 Unclassified 782
410 Ga0207679_10058565 3300025945 Bacteria 2855
411 Ga0207651_10089229 3300025960 Bacteria 2250
412 Ga0207651_10369066 3300025960 Unclassified 1214
413 Ga0207651_11437309 3300025960 Unclassified 621
414 Ga0207712_10003970 3300025961 Bacteria 9344
415 Ga0207712_10010000 3300025961 Bacteria 6014
416 Ga0207712_10037646 3300025961 Bacteria 3302
417 Ga0207640_10036013 3300025981 Bacteria 3103
418 Ga0207640_10485180 3300025981 Unclassified 1026
419 Ga0207640_10724737 3300025981 Bacteria 855
420 Ga0207658_10053238 3300025986 Bacteria 2990
421 Ga0207677_10039813 3300026023 Bacteria 3093
422 Ga0207677_10150671 3300026023 Bacteria 1794
423 Ga0207677_10487232 3300026023 Unclassified 1064
424 Ga0207677_10501083 3300026023 Unclassified 1050
425 Ga0207703_10084539 3300026035 Bacteria 2654
426 Ga0207703_10180107 3300026035 Bacteria 1865
427 Ga0207703_10187780 3300026035 Bacteria 1828
428 Ga0207703_10475961 3300026035 Bacteria 1170
429 Ga0207639_10008968 3300026041 Bacteria 6886
430 Ga0207639_10032729 3300026041 Bacteria 3830
431 Ga0207708_10000879 3300026075 Bacteria 22563
432 Ga0207708_10004416 3300026075 Bacteria 10365
433 Ga0207708_10028034 3300026075 Bacteria 4264
434 Ga0207708_10032884 3300026075 Bacteria 3938
435 Ga0207708_10033243 3300026075 Bacteria 3918
436 Ga0207702_10110355 3300026078 Unclassified 2444
437 Ga0207641_10033895 3300026088 Bacteria 4244
438 Ga0207641_10155115 3300026088 Bacteria 2077
439 Ga0207641_10662435 3300026088 Unclassified 1026
440 Ga0207641_11300965 3300026088 Unclassified 727
441 Ga0207648_10082701 3300026089 Bacteria 2800
442 Ga0207648_10113825 3300026089 Bacteria 2376
443 Ga0207648_10175418 3300026089 Unclassified 1896
444 Ga0207648_10321570 3300026089 Unclassified 1390
445 Ga0207648_10340115 3300026089 Bacteria 1351
446 Ga0207648_10434744 3300026089 Bacteria 1193
447 Ga0207648_11039674 3300026089 Unclassified 767
448 Ga0207676_10019198 3300026095 Bacteria 4982
449 Ga0207676_10028059 3300026095 Bacteria 4200
450 Ga0207676_10093249 3300026095 Bacteria 2478
451 Ga0207676_10213891 3300026095 Unclassified 1712
452 Ga0207676_10272107 3300026095 Unclassified 1534
453 Ga0207676_10325840 3300026095 Unclassified 1412
454 Ga0207676_10326605 3300026095 Unclassified 1410
455 Ga0207676_10341018 3300026095 Bacteria 1382
456 Ga0207676_10352389 3300026095 Unclassified 1361
457 Ga0207676_10851283 3300026095 Unclassified 892
458 Ga0207676_11319680 3300026095 Unclassified 716
459 Ga0207674_10000098 3300026116 Bacteria 98523
460 Ga0207674_10149546 3300026116 Bacteria 2292
461 Ga0207674_10201305 3300026116 Unclassified 1941
462 Ga0207674_11288821 3300026116 Unclassified 700
463 Ga0207675_100007249 3300026118 Bacteria 10483
464 Ga0207675_100013382 3300026118 Bacteria 7655
465 Ga0207675_100021736 3300026118 Bacteria 5971
466 Ga0207675_100492204 3300026118 Bacteria 1220
467 Ga0207675_101551957 3300026118 Unclassified 683
468 Ga0207683_10266172 3300026121 Bacteria 1565
469 Ga0207698_10116967 3300026142 Unclassified 2248
470 Ga0207698_10349780 3300026142 Unclassified 1395
471 Ga0207698_10633517 3300026142 Unclassified 1057
472 Ga0207698_10993297 3300026142 Unclassified 850
473 Ga0207698_11356391 3300026142 Unclassified 726
474 Ga0207428_10007591 3300027907 Bacteria 9887
475 Ga0207428_10418451 3300027907 Unclassified 980
476 Ga0268266_10463165 3300028379 Unclassified 1206
477 Ga0268264_10024983 3300028381 Bacteria 4883
478 Ga0268264_10031371 3300028381 Unclassified 4357
479 Ga0268264_10036878 3300028381 Bacteria 4029
480 Ga0268264_10059578 3300028381 Bacteria 3199
481 Ga0268264_10158529 3300028381 Unclassified 2036
482 Ga0268264_10464507 3300028381 Unclassified 1228
483 Ga0307408_100116018 3300031548 Bacteria 2066
484 Ga0307408_100355449 3300031548 Unclassified 1244
485 Ga0307413_10174245 3300031824 Unclassified 1526
486 Ga0307410_10192297 3300031852 Unclassified 1552
487 Ga0307406_10055414 3300031901 Bacteria 2534
488 Ga0307406_10732922 3300031901 Unclassified 828
489 Ga0307407_10041508 3300031903 Bacteria 2573
490 Ga0307412_10325972 3300031911 Bacteria 1224
491 Ga0307409_100429624 3300031995 Unclassified 1269
492 Ga0307416_100130619 3300032002 Unclassified 2260
493 Ga0307416_100412824 3300032002 Unclassified 1391
494 Ga0307416_100544846 3300032002 Bacteria 1233
495 Ga0307416_100764695 3300032002 Unclassified 1060
496 Ga0307414_10013789 3300032004 Bacteria 4822
497 Ga0307414_10017736 3300032004 Bacteria 4363
498 Ga0307414_10276067 3300032004 Bacteria 1410
499 Ga0307411_10012031 3300032005 Bacteria 4701
500 Ga0307415_100019512 3300032126 Bacteria 4118
501 Ga0307415_100020201 3300032126 Bacteria 4062
502 Ga0373940_0044451 3300035088 Unclassified 1231
503 Ga0373951_0004606 3300035091 Unclassified 3263
504 Ga0373951_0143628 3300035091 Unclassified 664
505 Ga0373941_0082531 3300035115 Bacteria 1088
506 Ga0373942_0013040 3300035207 Bacteria 1993
507 Ga0373931_0414864 3300035691 Unclassified 855
508 Ga0395898_0183893 3300037466 Bacteria 1997
509 Ga0395905_0752457 3300037471 Unclassified 877
510 Ga0439455_0020060 3300042012 Unclassified 1581
511 Ga0450889_018837 3300042144 Unclassified 757
512 Ga0451576_0769781 3300045051 Unclassified 1011
513 Ga0451576_1027304 3300045051 Unclassified 864
514 Ga0495582_0332609 3300046473 Unclassified 874
515 Ga0496103_0164603 3300048906 Unclassified 1423
516 Ga0496104_0025120 3300048907 Bacteria 5490
517 Ga0496110_0567026 3300048913 Unclassified 1031
518 Ga0496112_0289267 3300048915 Unclassified 1585
519 Ga0496113_0072195 3300048916 Bacteria 2626
520 Ga0501198_017699 3300049649 Bacteria 1111
521 Ga0501207_011915 3300049654 Bacteria 1301
522 Ga0501209_048758 3300049656 Unclassified 1148
523 Ga0501214_007897 3300049659 Unclassified 1104
524 Ga0501216_002627 3300049660 Bacteria 2565
525 Ga0501217_007211 3300049661 Bacteria 2377
526 Ga0501217_041624 3300049661 Bacteria 1171
527 Ga0501223_038634 3300049663 Unclassified 927
528 Ga0501227_001207 3300049665 Bacteria 5792
529 Ga0501227_031472 3300049665 Bacteria 1275
530 Ga0501228_019061 3300049666 Bacteria 761
531 Ga0501233_004575 3300049668 Unclassified 2542
532 Ga0501243_039671 3300049675 Bacteria 824
533 Ga0501251_012287 3300049681 Bacteria 1033
534 Ga0501257_003867 3300049686 Bacteria 3241
535 Ga0501258_034605 3300049687 Unclassified 652
536 Ga0501225_0003909 3300049705 Bacteria 4460
537 Ga0501225_0072207 3300049705 Bacteria 982
538 Ga0501234_003782 3300049707 Bacteria 2378
539 Ga0501268_018063 3300049765 Bacteria 1182
540 Ga0501273_027236 3300049770 Unclassified 800
541 Ga0501226_018570 3300049853 Unclassified 766
542 nmdc:mga05p37_1440759_c1 3300050507 Unclassified 690
543 nmdc:mga05p37_162207_c1 3300050507 Bacteria 2729
544 nmdc:mga05p37_222411_c1 3300050507 Bacteria 2278
545 nmdc:mga05p37_28444_c1 3300050507 Bacteria 6815
546 nmdc:mga05p37_862895_c1 3300050507 Unclassified 981
547 nmdc:mga09592_112885_c1 3300050508 Bacteria 2331
548 nmdc:mga09592_124417_c1 3300050508 Unclassified 2216
549 nmdc:mga0qj67_45825_c1 3300050509 Bacteria 3450
550 nmdc:mga0qj67_704961_c1 3300050509 Unclassified 803
551 nmdc:mga08y16_1148_c1 3300050511 Bacteria 26081
552 nmdc:mga08y16_177981_c1 3300050511 Bacteria 2209
553 nmdc:mga08y16_230677_c1 3300050511 Bacteria 1915
554 nmdc:mga08y16_90544_c1 3300050511 Bacteria 3189
555 nmdc:mga0n895_358274_c1 3300050512 Unclassified 1477
556 nmdc:mga0a205_366635_c1 3300050515 Unclassified 1307
557 nmdc:mga0a205_42816_c1 3300050515 Bacteria 4364
558 Ga0105243_10206522
559 SwRhRL3b_contig_3184544
560 SwRhRL2b_contig_194186
561 JGI24751J29686_10000218
562 rootL2_10239218
563 rootL2_10261268
564 Ga0065712_10021997
565 Ga0065712_10128382
566 Ga0065715_10005100
567 Ga0065715_10094547
568 Ga0065715_10134221
569 Ga0065715_10159827
570 Ga0065715_10427804
571 Ga0065715_10471686
572 Ga0065715_10580737
573 Ga0065707_10011695
574 Ga0070676_10452792
575 Ga0070676_10516370
576 Ga0070690_100317436
577 Ga0070670_100001942
578 Ga0070670_100082192
579 Ga0070670_100190676
580 Ga0070670_100223868
581 Ga0070670_100224136
582 Ga0070677_10122467
583 Ga0068869_100767575
584 Ga0070666_10078475
585 Ga0070666_10235350
586 Ga0070680_100051153
587 Ga0070680_100101773
588 Ga0070680_100489946
589 Ga0070682_100033639
590 Ga0068868_100382103
591 Ga0068868_100535719
592 Ga0070660_100116441
593 Ga0070689_100003738
594 Ga0070689_100579435
595 Ga0070687_100004634
596 Ga0070687_100189263
597 Ga0070661_100056588
598 Ga0070692_10001483
599 Ga0070692_10027312
600 Ga0070692_10077167
601 Ga0070692_10116036
602 Ga0070692_10187109
603 Ga0070669_100003818
604 Ga0070669_100115698
605 Ga0070675_100230312
606 Ga0070673_100113055
607 Ga0070673_100211762
608 Ga0070673_101402196
609 Ga0070688_100499427
610 Ga0070659_100002310
611 Ga0070667_100373441
612 Ga0070703_10059516
613 Ga0070701_10081734
614 Ga0070701_10403194
615 Ga0070705_100079077
616 Ga0070705_100288515
617 Ga0070700_100022792
618 Ga0070700_100105208
619 Ga0070700_100117575
620 Ga0070700_100146726
621 Ga0070700_100193924
622 Ga0070694_100009139
623 Ga0070694_100018842
624 Ga0070694_100034291
625 Ga0070694_100098871
626 Ga0070694_100180355
627 Ga0070694_100219619
628 Ga0070694_100388939
629 Ga0070694_100399582
630 Ga0070708_100157625
631 Ga0070708_100806383
632 Ga0070678_100546340
633 Ga0070681_10002139
634 Ga0070681_10002839
635 Ga0070681_10988671
636 Ga0068867_100050219
637 Ga0068867_100084812
638 Ga0068867_100170776
639 Ga0068867_100178951
640 Ga0068867_100491056
641 Ga0068867_101188076
642 Ga0070685_10388480
643 Ga0070685_10558833
644 Ga0070706_100819671
645 Ga0070707_100013470
646 Ga0070698_100014531
647 Ga0070698_100072608
648 Ga0070699_100004458
649 Ga0070699_100121997
650 Ga0070699_100421183
651 Ga0070699_100869518
652 Ga0070679_100028987
653 Ga0070679_100360104
654 Ga0070697_100262488
655 Ga0070697_100422115
656 Ga0068853_100008811
657 Ga0068853_100040408
658 Ga0068853_100096189
659 Ga0068853_100749063
660 Ga0070672_100312993
661 Ga0070672_100539886
662 Ga0070686_100004304
663 Ga0070686_100008472
664 Ga0070686_100458732
665 Ga0070686_100650528
666 Ga0070686_101070829
667 Ga0070695_100088744
668 Ga0070695_100145538
669 Ga0070695_100282225
670 Ga0070695_100343070
671 Ga0070695_100593332
672 Ga0070696_100088855
673 Ga0070696_100091518
674 Ga0070696_100258150
675 Ga0070693_100011427
676 Ga0070693_100050418
677 Ga0070693_100161837
678 Ga0070693_100162871
679 Ga0070693_100205664
680 Ga0070693_100293870
681 Ga0070665_100101743
682 Ga0070665_101364035
683 Ga0070704_100007854
684 Ga0070704_100008395
685 Ga0070704_100120794
686 Ga0070704_100278820
687 Ga0070704_101078729
688 Ga0070704_101287587
689 Ga0070664_100064290
690 Ga0068857_100001531
691 Ga0068857_100569494
692 Ga0068857_100669152
693 Ga0068854_100193164
694 Ga0068854_100204726
695 Ga0068854_100232417
696 Ga0068856_100051069
697 Ga0070702_100002717
698 Ga0070702_100009949
699 Ga0070702_100092787
700 Ga0070702_100192382
701 Ga0070702_100225542
702 Ga0070702_100367445
703 Ga0068852_100433263
704 Ga0068852_100702205
705 Ga0068852_101029709
706 Ga0068852_101238794
707 Ga0068852_101301572
708 Ga0068859_100042300
709 Ga0068859_100044990
710 Ga0068859_100045907
711 Ga0068859_100183256
712 Ga0068859_100270784
713 Ga0068859_100278699
714 Ga0068859_100289083
715 Ga0068859_100341918
716 Ga0068859_100456604
717 Ga0068859_101269614
718 Ga0068864_100004995
719 Ga0068864_100006828
720 Ga0068864_100021529
721 Ga0068864_100024672
722 Ga0068864_100147257
723 Ga0068864_100447854
724 Ga0068864_100671186
725 Ga0068864_100872469
726 Ga0068864_101685528
727 Ga0068866_10021422
728 Ga0068861_100002667
729 Ga0068861_100019293
730 Ga0068851_10005305
731 Ga0068870_10039111
732 Ga0068870_10043271
733 Ga0068870_10062704
734 Ga0068870_10340835
735 Ga0068863_100065030
736 Ga0068863_100211146
737 Ga0068863_100644286
738 Ga0068863_100724143
739 Ga0068863_100962144
740 Ga0068863_101301499
741 Ga0068863_101610534
742 Ga0068858_100053174
743 Ga0068858_100053374
744 Ga0068858_100053455
745 Ga0068858_100117771
746 Ga0068858_100197326
747 Ga0068858_100351852
748 Ga0068858_100352958
749 Ga0068860_100034252
750 Ga0068860_100093006
751 Ga0068860_100136567
752 Ga0068860_100146152
753 Ga0068860_100307408
754 Ga0068860_100412504
755 Ga0068860_100594272
756 Ga0068862_100207862
757 Ga0068862_100233231
758 Ga0068862_100482512
759 Ga0070716_100024080
760 Ga0097621_100001054
761 Ga0097621_100006958
762 Ga0097621_100092215
763 Ga0097621_100127197
764 Ga0068871_100002031
765 Ga0068871_100096695
766 Ga0068871_100436439
767 Ga0075428_100084832
768 Ga0075430_100428730
769 Ga0075431_100105194
770 Ga0075431_100478397
771 Ga0075433_10383802
772 Ga0075434_100012755
773 Ga0075434_100231629
774 Ga0075434_101247717
775 Ga0075429_100107733
776 Ga0075429_100423734
777 Ga0068865_100472379
778 Ga0075436_100022800
779 Ga0097620_100042300
780 Ga0097620_100044988
781 Ga0097620_100045904
782 Ga0097620_100133571
783 Ga0097620_100169452
784 Ga0097620_100183247
785 Ga0097620_100270784
786 Ga0097620_100278684
787 Ga0097620_100289083
788 Ga0097620_100341913
789 Ga0097620_100456599
790 Ga0097620_100962017
791 Ga0097620_101269596
792 Ga0075435_100094458
793 Ga0105251_10068542
794 Ga0105240_10294296
795 Ga0105240_10512508
796 Ga0111539_10000649
797 Ga0111539_10052149
798 Ga0111539_10063470
799 Ga0111539_10140813
800 Ga0105245_10397320
801 Ga0105247_10000299
802 Ga0105247_10177299
803 Ga0105247_10188970
804 Ga0105247_10206805
805 Ga0114129_10076503
806 Ga0114129_10082952
807 Ga0114129_10273895
808 Ga0114129_10548835
809 Ga0114129_10722319
810 Ga0114129_11379796
811 Ga0114129_11562796
812 Ga0105243_10008876
813 Ga0105243_10138260
814 Ga0105243_10302646
815 Ga0105243_10674361
816 Ga0105243_10887726
817 Ga0105241_10064339
818 Ga0105241_10291756
819 Ga0105241_10409137
820 Ga0105241_11080133
821 Ga0105241_11253366
822 Ga0105242_10001833
823 Ga0105242_10123792
824 Ga0105242_10195309
825 Ga0105242_10955990
826 Ga0105248_10049456
827 Ga0105248_10066463
828 Ga0105248_10249853
829 Ga0105248_10385817
830 Ga0105248_10970354
831 Ga0105248_12214513
832 Ga0105237_10001044
833 Ga0105237_10017128
834 Ga0105237_10653549
835 Ga0105238_10021389
836 Ga0105238_10078164
837 Ga0105249_10003520
838 Ga0105249_10014518
839 Ga0105249_10022684
840 Ga0105249_10482038
841 Ga0105249_10648491
842 Ga0105239_10074662
843 Ga0105239_10236090
844 Ga0105239_10265212
845 Ga0105239_10327652
846 Ga0105239_11598762
847 Ga0105246_10169218
848 Ga0105246_10314543
849 Ga0105246_10464525
850 Ga0157373_10007413
851 Ga0157373_10020203
852 Ga0157373_10155575
853 Ga0157373_10165708
854 Ga0157373_10170103
855 Ga0157373_10264971
856 Ga0157378_10006996
857 Ga0157378_10023911
858 Ga0157378_10100467
859 Ga0157378_10102123
860 Ga0157378_10318098
861 Ga0157378_10602837
862 Ga0163162_10000664
863 Ga0163162_10013687
864 Ga0163162_10118911
865 Ga0163162_10146332
866 Ga0163162_10280392
867 Ga0163162_10459068
868 Ga0157372_10002400
869 Ga0157372_10334901
870 Ga0157375_10070995
871 Ga0157375_10367910
872 Ga0157375_10390522
873 Ga0157375_10666383
874 Ga0157375_10750095
875 Ga0157375_11125173
876 Ga0157375_11170788
877 Ga0163163_10001381
878 Ga0163163_10001672
879 Ga0163163_10032672
880 Ga0163163_10081710
881 Ga0163163_10235349
882 Ga0163163_10349989
883 Ga0163163_10488895
884 Ga0163163_10794271
885 Ga0157380_10001868
886 Ga0157380_10013856
887 Ga0157380_10772728
888 Ga0157377_10390028
889 Ga0157377_10591191
890 Ga0157379_10194833
891 Ga0182007_10041201
892 Ga0182007_10099954
893 Ga0163161_10007452
894 Ga0207697_10058389
895 Ga0207656_10000264
896 Ga0207653_10004921
897 Ga0207642_10340557
898 Ga0207642_10426558
899 Ga0207710_10050717
900 Ga0207710_10132839
901 Ga0207688_10187122
902 Ga0207680_10213907
903 Ga0207645_10075023
904 Ga0207643_10000479
905 Ga0207643_10006530
906 Ga0207643_10064119
907 Ga0207643_10163084
908 Ga0207643_10479858
909 Ga0207654_10074965
910 Ga0207654_10159272
911 Ga0207654_10181230
912 Ga0207707_10008296
913 Ga0207707_10016870
914 Ga0207707_10740269
915 Ga0207695_10282835
916 Ga0207671_10003000
917 Ga0207671_10220076
918 Ga0207660_10029007
919 Ga0207662_10032498
920 Ga0207662_10060546
921 Ga0207662_10066371
922 Ga0207657_10022003
923 Ga0207649_10022936
924 Ga0207652_10049433
925 Ga0207652_10423581
926 Ga0207646_10124846
927 Ga0207646_10126255
928 Ga0207646_10832381
929 Ga0207681_10080138
930 Ga0207681_10346216
931 Ga0207694_10020834
932 Ga0207694_10068323
933 Ga0207694_10458633
934 Ga0207650_10000041
935 Ga0207650_10285038
936 Ga0207650_10305295
937 Ga0207650_10526768
938 Ga0207659_10156489
939 Ga0207659_10191638
940 Ga0207687_10562187
941 Ga0207687_10790147
942 Ga0207644_10031762
943 Ga0207644_10162169
944 Ga0207690_10003301
945 Ga0207706_10107824
946 Ga0207686_10000641
947 Ga0207686_10070141
948 Ga0207686_10213698
949 Ga0207686_11073909
950 Ga0207709_10002165
951 Ga0207709_10302633
952 Ga0207670_10000272
953 Ga0207670_10472101
954 Ga0207704_10186002
955 Ga0207704_10381688
956 Ga0207665_10034696
957 Ga0207691_10211389
958 Ga0207711_10176453
959 Ga0207711_10217635
960 Ga0207711_10493632
961 Ga0207711_10634858
962 Ga0207711_10863002
963 Ga0207689_10086351
964 Ga0207689_10289102
965 Ga0207689_10581440
966 Ga0207689_10825897
967 Ga0207679_10058565
968 Ga0207651_10089229
969 Ga0207651_10369066
970 Ga0207651_11437309
971 Ga0207712_10003970
972 Ga0207712_10010000
973 Ga0207712_10037646
974 Ga0207640_10036013
975 Ga0207640_10485180
976 Ga0207640_10724737
977 Ga0207658_10053238
978 Ga0207677_10039813
979 Ga0207677_10150671
980 Ga0207677_10487232
981 Ga0207677_10501083
982 Ga0207703_10084539
983 Ga0207703_10180107
984 Ga0207703_10187780
985 Ga0207703_10475961
986 Ga0207639_10008968
987 Ga0207639_10032729
988 Ga0207708_10000879
989 Ga0207708_10004416
990 Ga0207708_10028034
991 Ga0207708_10032884
992 Ga0207708_10033243
993 Ga0207702_10110355
994 Ga0207641_10033895
995 Ga0207641_10155115
996 Ga0207641_10662435
997 Ga0207641_11300965
998 Ga0207648_10082701
999 Ga0207648_10113825
1000 Ga0207648_10175418
1001 Ga0207648_10321570
1002 Ga0207648_10340115
1003 Ga0207648_10434744
1004 Ga0207648_11039674
1005 Ga0207676_10019198
1006 Ga0207676_10028059
1007 Ga0207676_10093249
1008 Ga0207676_10213891
1009 Ga0207676_10272107
1010 Ga0207676_10325840
1011 Ga0207676_10326605
1012 Ga0207676_10341018
1013 Ga0207676_10352389
1014 Ga0207676_10851283
1015 Ga0207676_11319680
1016 Ga0207674_10000098
1017 Ga0207674_10149546
1018 Ga0207674_10201305
1019 Ga0207674_11288821
1020 Ga0207675_100007249
1021 Ga0207675_100013382
1022 Ga0207675_100021736
1023 Ga0207675_100492204
1024 Ga0207675_101551957
1025 Ga0207683_10266172
1026 Ga0207698_10116967
1027 Ga0207698_10349780
1028 Ga0207698_10633517
1029 Ga0207698_10993297
1030 Ga0207698_11356391
1031 Ga0207428_10007591
1032 Ga0207428_10418451
1033 Ga0268266_10463165
1034 Ga0268264_10024983
1035 Ga0268264_10031371
1036 Ga0268264_10036878
1037 Ga0268264_10059578
1038 Ga0268264_10158529
1039 Ga0268264_10464507
1040 Ga0307408_100116018
1041 Ga0307408_100355449
1042 Ga0307413_10174245
1043 Ga0307410_10192297
1044 Ga0307406_10055414
1045 Ga0307406_10732922
1046 Ga0307407_10041508
1047 Ga0307412_10325972
1048 Ga0307409_100429624
1049 Ga0307416_100130619
1050 Ga0307416_100412824
1051 Ga0307416_100544846
1052 Ga0307416_100764695
1053 Ga0307414_10013789
1054 Ga0307414_10017736
1055 Ga0307414_10276067
1056 Ga0307411_10012031
1057 Ga0307415_100019512
1058 Ga0307415_100020201
1059 Ga0373940_0044451
1060 Ga0373951_0004606
1061 Ga0373951_0143628
1062 Ga0373941_0082531
1063 Ga0373942_0013040
1064 Ga0373931_0414864
1065 Ga0395898_0183893
1066 Ga0395905_0752457
1067 Ga0439455_0020060
1068 Ga0450889_018837
1069 Ga0451576_0769781
1070 Ga0451576_1027304
1071 Ga0495582_0332609
1072 Ga0496103_0164603
1073 Ga0496104_0025120
1074 Ga0496110_0567026
1075 Ga0496112_0289267
1076 Ga0496113_0072195
1077 Ga0501198_017699
1078 Ga0501207_011915
1079 Ga0501209_048758
1080 Ga0501214_007897
1081 Ga0501216_002627
1082 Ga0501217_007211
1083 Ga0501217_041624
1084 Ga0501223_038634
1085 Ga0501227_001207
1086 Ga0501227_031472
1087 Ga0501228_019061
1088 Ga0501233_004575
1089 Ga0501243_039671
1090 Ga0501251_012287
1091 Ga0501257_003867
1092 Ga0501258_034605
1093 Ga0501225_0003909
1094 Ga0501225_0072207
1095 Ga0501234_003782
1096 Ga0501268_018063
1097 Ga0501273_027236
1098 Ga0501226_018570
1099 nmdc:mga05p37_1440759_c1
1100 nmdc:mga05p37_162207_c1
1101 nmdc:mga05p37_222411_c1
1102 nmdc:mga05p37_28444_c1
1103 nmdc:mga05p37_862895_c1
1104 nmdc:mga09592_112885_c1
1105 nmdc:mga09592_124417_c1
1106 nmdc:mga0qj67_45825_c1
1107 nmdc:mga0qj67_704961_c1
1108 nmdc:mga08y16_1148_c1
1109 nmdc:mga08y16_177981_c1
1110 nmdc:mga08y16_230677_c1
1111 nmdc:mga08y16_90544_c1
1112 nmdc:mga0n895_358274_c1
1113 nmdc:mga0a205_366635_c1
1114 nmdc:mga0a205_42816_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map