F463261

General Info

Members Datasets Scaffolds Average Seq Length
556 370 476 96

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0090993|Ga0500604_0090993_343_693
Length 116
Sequence LGELHYGGIKIGIAREIIMTREKLSKDAITAALAELGGWSLAADGASIKRSFVFKNFSEAFAFMTRVALAAEKMDHHPDWSNVYKTVDVTLNTHDAGGVTPLDIALAKKMNGYFGG

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
3 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
4 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
5 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
6 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
7 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
8 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
9 2738543024 Aminobacter sp. AP02 Isolate Unclassified
10 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
11 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
12 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
13 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
14 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
15 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
16 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
17 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
18 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
19 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
20 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
21 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
22 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
23 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
24 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
25 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
26 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
27 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
28 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
29 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
30 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
31 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
32 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
33 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
34 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
35 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
36 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
37 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
38 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
39 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
40 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
41 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
42 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
43 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
44 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
45 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
46 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
47 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
48 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
49 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
50 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
51 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
52 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
53 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
54 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
55 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
56 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
57 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
58 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
59 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
60 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
61 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
62 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
63 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
64 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
65 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
66 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
67 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
68 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
69 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
70 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
71 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
72 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
73 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
74 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
75 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
76 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
77 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
78 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
79 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
80 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
83 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
84 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
87 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
88 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
89 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
90 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
111 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
112 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
113 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
125 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
145 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
146 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
166 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
290 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
291 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
319 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
320 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
321 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
322 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
329 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
330 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
331 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
334 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
350 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
355 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
356 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
357 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
361 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
366 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
367 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
368 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
369 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
370 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.61
Metatranscriptomes 0
Isolates 14.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.41
Nodule 11.87
Rhizoplane 3.06
Rhizosphere 66.01
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01DNS15 2088090003 Bacteria 522
2 JGI24741J21665_1018491 3300001915 Bacteria 1114
3 JGI24741J21665_1037089 3300001915 Bacteria 722
4 JGI24747J21853_1039588 3300001978 Bacteria 557
5 JGI24740J21852_10012384 3300001979 Bacteria 3215
6 JGI24740J21852_10074386 3300001979 Bacteria 902
7 JGI24740J21852_10153714 3300001979 Bacteria 571
8 JGI24739J22299_10014933 3300001989 Bacteria 2823
9 JGI24737J22298_10000079 3300001990 Bacteria 28549
10 JGI24737J22298_10030122 3300001990 Bacteria 1699
11 JGI24737J22298_10188805 3300001990 Bacteria 608
12 JGI24735J21928_10028653 3300002067 Bacteria 1662
13 JGI24744J21845_10060073 3300002077 Bacteria 696
14 JGI24742J22300_10084336 3300002244 Bacteria 603
15 JGI25165J46597_1000052 3300003214 Bacteria 236064
16 JGI25153J46596_10000007 3300003215 Bacteria 377573
17 rootL2_10141062 3300003322 Bacteria 1566
18 Ga0055525_1000080 3300003759 Bacteria 164642
19 Ga0055542_1000012 3300003762 Bacteria 391808
20 Ga0055529_1000002 3300003763 Bacteria 537914
21 Ga0055529_1000004 3300003763 Bacteria 433331
22 Ga0065165_1100152 3300005262 Bacteria 726
23 Ga0070658_10007991 3300005327 Bacteria 8509
24 Ga0070658_10051625 3300005327 Bacteria 3332
25 Ga0070658_10272215 3300005327 Bacteria 1440
26 Ga0070676_10385522 3300005328 Bacteria 971
27 Ga0070676_11003915 3300005328 Bacteria 626
28 Ga0070683_100025496 3300005329 Bacteria 5310
29 Ga0070670_100021324 3300005331 Bacteria 5573
30 Ga0068869_100671822 3300005334 Bacteria 881
31 Ga0070680_100015727 3300005336 Bacteria 5940
32 Ga0068868_100384115 3300005338 Bacteria 1209
33 Ga0070660_100000596 3300005339 Bacteria 24197
34 Ga0070660_100514276 3300005339 Bacteria 997
35 Ga0070660_100863023 3300005339 Bacteria 762
36 Ga0070661_100011818 3300005344 Bacteria 6090
37 Ga0070661_100019206 3300005344 Bacteria 4868
38 Ga0070661_100027323 3300005344 Bacteria 4108
39 Ga0070661_100096488 3300005344 Bacteria 2194
40 Ga0070692_11202944 3300005345 Bacteria 540
41 Ga0070668_100293013 3300005347 Bacteria 1363
42 Ga0070669_100738715 3300005353 Bacteria 833
43 Ga0070675_100265943 3300005354 Bacteria 1504
44 Ga0070671_100802356 3300005355 Bacteria 820
45 Ga0070674_100015088 3300005356 Bacteria 4816
46 Ga0070674_100438542 3300005356 Bacteria 1075
47 Ga0070673_100045759 3300005364 Bacteria 3396
48 Ga0070659_100015179 3300005366 Bacteria 5763
49 Ga0070659_100123700 3300005366 Bacteria 2097
50 Ga0070667_100009344 3300005367 Bacteria 8131
51 Ga0070663_100940740 3300005455 Bacteria 748
52 Ga0070663_101096254 3300005455 Bacteria 696
53 Ga0070678_100000816 3300005456 Bacteria 15760
54 Ga0070678_100143905 3300005456 Bacteria 1911
55 Ga0070678_102251823 3300005456 Bacteria 517
56 Ga0070662_100000589 3300005457 Bacteria 22114
57 Ga0070662_100112428 3300005457 Bacteria 2077
58 Ga0070662_100276082 3300005457 Bacteria 1359
59 Ga0070662_101149807 3300005457 Bacteria 667
60 Ga0070681_10000796 3300005458 Bacteria 26300
61 Ga0068867_100036928 3300005459 Bacteria 3549
62 Ga0070679_100020369 3300005530 Bacteria 6465
63 Ga0068853_100037655 3300005539 Bacteria 4116
64 Ga0068853_100050084 3300005539 Bacteria 3592
65 Ga0068853_101395202 3300005539 Bacteria 677
66 Ga0068853_101570070 3300005539 Bacteria 637
67 Ga0070672_100030101 3300005543 Bacteria 4075
68 Ga0070665_100000416 3300005548 Bacteria 62100
69 Ga0070665_100000532 3300005548 Bacteria 53844
70 Ga0070665_100135774 3300005548 Bacteria 2462
71 Ga0070665_100138196 3300005548 Bacteria 2440
72 Ga0068855_100134072 3300005563 Bacteria 2826
73 Ga0068855_100150413 3300005563 Bacteria 2647
74 Ga0070664_100014402 3300005564 Bacteria 6448
75 Ga0070664_100035488 3300005564 Bacteria 4186
76 Ga0068857_101200615 3300005577 Bacteria 734
77 Ga0068857_101453285 3300005577 Bacteria 667
78 Ga0068857_101457739 3300005577 Bacteria 666
79 Ga0068854_100033554 3300005578 Bacteria 3579
80 Ga0068854_100169562 3300005578 Bacteria 1697
81 Ga0068856_100021118 3300005614 Bacteria 6327
82 Ga0068856_100418863 3300005614 Bacteria 1359
83 Ga0068852_100072811 3300005616 Bacteria 3021
84 Ga0068852_100122689 3300005616 Bacteria 2382
85 Ga0068852_101376531 3300005616 Bacteria 727
86 Ga0068852_101583571 3300005616 Bacteria 677
87 Ga0068866_10504304 3300005718 Bacteria 801
88 Ga0068866_10700439 3300005718 Bacteria 695
89 Ga0068851_10229033 3300005834 Bacteria 1047
90 Ga0068851_10742836 3300005834 Bacteria 606
91 Ga0068851_10772426 3300005834 Bacteria 595
92 Ga0068863_100120226 3300005841 Bacteria 2504
93 Ga0068860_101941424 3300005843 Bacteria 610
94 Ga0075365_10179072 3300006038 Bacteria 1482
95 Ga0075365_10195732 3300006038 Bacteria 1415
96 Ga0075368_10017500 3300006042 Bacteria 2683
97 Ga0075368_10195111 3300006042 Bacteria 856
98 Ga0075363_100279544 3300006048 Bacteria 965
99 Ga0075363_100736444 3300006048 Bacteria 597
100 Ga0075364_10083790 3300006051 Bacteria 2111
101 Ga0075362_10139000 3300006177 Bacteria 1160
102 Ga0075362_10397363 3300006177 Bacteria 695
103 Ga0075367_10049835 3300006178 Bacteria 2470
104 Ga0075367_10222124 3300006178 Bacteria 1182
105 Ga0075366_10023913 3300006195 Bacteria 3561
106 Ga0075366_10730964 3300006195 Bacteria 615
107 Ga0075366_11042068 3300006195 Bacteria 511
108 Ga0075366_11073995 3300006195 Bacteria 503
109 Ga0075370_10011511 3300006353 Bacteria 4652
110 Ga0075370_10437122 3300006353 Bacteria 787
111 Ga0068871_100327567 3300006358 Bacteria 1350
112 Ga0105243_10000522 3300009148 Bacteria 39134
113 Ga0105243_10229154 3300009148 Bacteria 1647
114 Ga0105243_11658187 3300009148 Bacteria 667
115 Ga0105241_10004947 3300009174 Bacteria 9827
116 Ga0105241_12014272 3300009174 Bacteria 569
117 Ga0105241_12463689 3300009174 Unclassified 520
118 Ga0105242_10333506 3300009176 Bacteria 1395
119 Ga0105242_11869091 3300009176 Bacteria 640
120 Ga0105248_11445095 3300009177 Bacteria 778
121 Ga0105248_12191674 3300009177 Bacteria 629
122 Ga0105237_10182626 3300009545 Bacteria 2098
123 Ga0105239_10907321 3300010375 Bacteria 1011
124 Ga0105246_11085275 3300011119 Bacteria 730
125 Ga0157317_1004020 3300012475 Bacteria 942
126 Ga0157314_1042923 3300012500 Bacteria 553
127 Ga0157326_1002094 3300012513 Bacteria 2159
128 Ga0157373_10007516 3300013100 Bacteria 8103
129 Ga0157371_10000148 3300013102 Bacteria 101711
130 Ga0157371_10001786 3300013102 Bacteria 21751
131 Ga0157370_10000677 3300013104 Bacteria 42448
132 Ga0157370_10449655 3300013104 Bacteria 1184
133 Ga0157370_10952515 3300013104 Bacteria 778
134 Ga0157369_10001965 3300013105 Bacteria 24785
135 Ga0157374_10075102 3300013296 Bacteria 3194
136 Ga0157378_10289586 3300013297 Bacteria 1581
137 Ga0157378_10576153 3300013297 Bacteria 1134
138 Ga0157378_11426424 3300013297 Bacteria 736
139 Ga0157372_10001466 3300013307 Bacteria 25593
140 Ga0157375_11685755 3300013308 Bacteria 750
141 Ga0163163_10824756 3300014325 Bacteria 991
142 Ga0182008_10384017 3300014497 Bacteria 751
143 Ga0157376_10184773 3300014969 Bacteria 1908
144 Ga0157376_10187610 3300014969 Bacteria 1894
145 Ga0209674_105242 3300025226 Bacteria 1954
146 Ga0209563_100058 3300025230 Bacteria 302571
147 Ga0209437_132712 3300025233 Bacteria 512
148 Ga0209646_1004298 3300025246 Bacteria 2616
149 Ga0209026_1013419 3300025250 Bacteria 1396
150 Ga0209677_103554 3300025253 Bacteria 4967
151 Ga0209148_1000008 3300025254 Bacteria 1504371
152 Ga0209233_1000118 3300025261 Bacteria 236172
153 Ga0209233_1045825 3300025261 Bacteria 917
154 Ga0209233_1053946 3300025261 Bacteria 804
155 Ga0209455_1000002 3300025272 Bacteria 1505459
156 Ga0209758_1000017 3300025297 Bacteria 754393
157 Ga0207697_10064335 3300025315 Bacteria 1529
158 Ga0207656_10008253 3300025321 Bacteria 3824
159 Ga0207656_10012504 3300025321 Bacteria 3229
160 Ga0207682_10130164 3300025893 Bacteria 1123
161 Ga0207688_10237162 3300025901 Bacteria 1102
162 Ga0207680_10332522 3300025903 Bacteria 1064
163 Ga0207647_10045884 3300025904 Bacteria 2725
164 Ga0207647_10100966 3300025904 Bacteria 1712
165 Ga0207647_10279505 3300025904 Bacteria 953
166 Ga0207647_10406760 3300025904 Bacteria 766
167 Ga0207645_10129650 3300025907 Bacteria 1641
168 Ga0207645_10270887 3300025907 Bacteria 1126
169 Ga0207705_10000702 3300025909 Bacteria 27622
170 Ga0207705_10007056 3300025909 Bacteria 8286
171 Ga0207705_10078913 3300025909 Bacteria 2397
172 Ga0207705_10130784 3300025909 Bacteria 1868
173 Ga0207705_10792368 3300025909 Bacteria 736
174 Ga0207705_11385712 3300025909 Bacteria 535
175 Ga0207654_10013475 3300025911 Bacteria 4207
176 Ga0207654_10321581 3300025911 Bacteria 1058
177 Ga0207654_10398197 3300025911 Bacteria 957
178 Ga0207654_11251371 3300025911 Unclassified 541
179 Ga0207707_10005063 3300025912 Bacteria 11564
180 Ga0207695_10513459 3300025913 Bacteria 1080
181 Ga0207695_11396299 3300025913 Bacteria 581
182 Ga0207671_10125082 3300025914 Bacteria 1969
183 Ga0207671_10648571 3300025914 Bacteria 841
184 Ga0207671_10887977 3300025914 Bacteria 705
185 Ga0207660_10147150 3300025917 Bacteria 1806
186 Ga0207657_10001287 3300025919 Bacteria 26666
187 Ga0207657_10002944 3300025919 Bacteria 18269
188 Ga0207657_10205061 3300025919 Bacteria 1584
189 Ga0207657_11160632 3300025919 Bacteria 588
190 Ga0207657_11239705 3300025919 Bacteria 565
191 Ga0207657_11376935 3300025919 Bacteria 530
192 Ga0207649_10001132 3300025920 Bacteria 16143
193 Ga0207649_10002474 3300025920 Bacteria 10327
194 Ga0207649_10007056 3300025920 Bacteria 6102
195 Ga0207649_10064136 3300025920 Bacteria 2322
196 Ga0207649_10096281 3300025920 Bacteria 1950
197 Ga0207652_10077021 3300025921 Bacteria 2909
198 Ga0207694_10034188 3300025924 Bacteria 3897
199 Ga0207694_10162537 3300025924 Bacteria 1804
200 Ga0207650_10245726 3300025925 Bacteria 1447
201 Ga0207659_10436631 3300025926 Bacteria 1100
202 Ga0207687_10179479 3300025927 Bacteria 1639
203 Ga0207644_10661099 3300025931 Bacteria 870
204 Ga0207690_10005504 3300025932 Bacteria 7473
205 Ga0207690_10015698 3300025932 Bacteria 4595
206 Ga0207690_10078446 3300025932 Bacteria 2298
207 Ga0207706_10078841 3300025933 Bacteria 2897
208 Ga0207706_10084438 3300025933 Bacteria 2792
209 Ga0207706_10274863 3300025933 Bacteria 1470
210 Ga0207706_10749509 3300025933 Bacteria 832
211 Ga0207706_11044056 3300025933 Bacteria 685
212 Ga0207709_10000109 3300025935 Bacteria 128086
213 Ga0207669_10000213 3300025937 Bacteria 26506
214 Ga0207669_10012260 3300025937 Bacteria 4209
215 Ga0207669_10138417 3300025937 Bacteria 1686
216 Ga0207704_10126852 3300025938 Bacteria 1759
217 Ga0207704_10730498 3300025938 Bacteria 822
218 Ga0207691_10069055 3300025940 Bacteria 3192
219 Ga0207689_11605640 3300025942 Bacteria 541
220 Ga0207661_10098230 3300025944 Bacteria 2453
221 Ga0207661_10440844 3300025944 Bacteria 1185
222 Ga0207661_10452061 3300025944 Bacteria 1170
223 Ga0207679_10050389 3300025945 Bacteria 3042
224 Ga0207679_10275444 3300025945 Bacteria 1441
225 Ga0207667_10000006 3300025949 Bacteria 679876
226 Ga0207667_10008324 3300025949 Bacteria 12334
227 Ga0207667_10068337 3300025949 Bacteria 3700
228 Ga0207667_10556171 3300025949 Bacteria 1160
229 Ga0207667_10632958 3300025949 Bacteria 1076
230 Ga0207651_11480434 3300025960 Bacteria 611
231 Ga0207668_10242131 3300025972 Bacteria 1460
232 Ga0207640_10005904 3300025981 Bacteria 6684
233 Ga0207640_10013294 3300025981 Bacteria 4714
234 Ga0207640_10032827 3300025981 Bacteria 3223
235 Ga0207640_11910762 3300025981 Bacteria 537
236 Ga0207658_10224984 3300025986 Bacteria 1580
237 Ga0207677_10199633 3300026023 Bacteria 1589
238 Ga0207677_11180176 3300026023 Bacteria 700
239 Ga0207639_10002059 3300026041 Bacteria 13563
240 Ga0207639_10002931 3300026041 Bacteria 11468
241 Ga0207639_10008345 3300026041 Bacteria 7099
242 Ga0207639_10039600 3300026041 Bacteria 3512
243 Ga0207639_10596463 3300026041 Bacteria 1018
244 Ga0207678_10049438 3300026067 Bacteria 3634
245 Ga0207678_11484381 3300026067 Bacteria 599
246 Ga0207678_11644812 3300026067 Bacteria 565
247 Ga0207678_11837216 3300026067 Bacteria 530
248 Ga0207702_10001342 3300026078 Bacteria 24608
249 Ga0207702_10014731 3300026078 Bacteria 6486
250 Ga0207702_10144276 3300026078 Bacteria 2158
251 Ga0207641_10098245 3300026088 Bacteria 2574
252 Ga0207641_12229190 3300026088 Bacteria 548
253 Ga0207648_10034099 3300026089 Bacteria 4489
254 Ga0207648_10051735 3300026089 Bacteria 3590
255 Ga0207674_10025271 3300026116 Bacteria 6338
256 Ga0207674_10702632 3300026116 Bacteria 976
257 Ga0207674_11648784 3300026116 Bacteria 610
258 Ga0207675_100259124 3300026118 Bacteria 1685
259 Ga0207675_100355482 3300026118 Bacteria 1436
260 Ga0207683_10004804 3300026121 Bacteria 11635
261 Ga0207683_10298325 3300026121 Bacteria 1474
262 Ga0207698_10029738 3300026142 Bacteria 3917
263 Ga0207698_10183558 3300026142 Bacteria 1856
264 Ga0207698_10313810 3300026142 Bacteria 1465
265 Ga0207698_10844671 3300026142 Unclassified 920
266 Ga0207698_10937842 3300026142 Bacteria 874
267 Ga0207698_11518381 3300026142 Bacteria 685
268 Ga0207698_11624682 3300026142 Bacteria 662
269 Ga0209813_10130106 3300027866 Bacteria 885
270 Ga0209813_10493460 3300027866 Bacteria 507
271 Ga0268266_10000002 3300028379 Bacteria 3059047
272 Ga0268266_10000641 3300028379 Bacteria 47529
273 Ga0268266_10035162 3300028379 Bacteria 4262
274 Ga0268266_10834101 3300028379 Bacteria 891
275 Ga0268266_10877671 3300028379 Bacteria 867
276 Ga0307517_10032277 3300028786 Bacteria 6057
277 Ga0265338_10060752 3300028800 Unclassified 3317
278 Ga0307513_10060146 3300031456 Bacteria 4028
279 Ga0307509_10874829 3300031507 Bacteria 563
280 Ga0307413_10068846 3300031824 Bacteria 2219
281 Ga0307413_10071596 3300031824 Bacteria 2185
282 Ga0307412_10176300 3300031911 Bacteria 1603
283 Ga0307412_10663056 3300031911 Bacteria 891
284 Ga0307409_102497059 3300031995 Bacteria 545
285 Ga0307414_10035908 3300032004 Bacteria 3303
286 Ga0307414_10202566 3300032004 Bacteria 1615
287 Ga0307414_10951155 3300032004 Bacteria 789
288 Ga0307411_10173774 3300032005 Bacteria 1628
289 Ga0307415_100238988 3300032126 Bacteria 1468
290 Ga0307510_10050450 3300033180 Bacteria 4414
291 Ga0373959_0086838 3300034820 Bacteria 728
292 Ga0373938_0170455 3300034957 Bacteria 589
293 Ga0373940_0157825 3300035088 Bacteria 726
294 Ga0373949_0195120 3300035090 Bacteria 606
295 Ga0373932_0095021 3300035112 Bacteria 962
296 Ga0373942_0006056 3300035207 Bacteria 2793
297 Ga0373931_0028453 3300035691 Bacteria 2862
298 Ga0395899_0312246 3300037312 Bacteria 1061
299 Ga0395905_0291521 3300037471 Bacteria 1518
300 Ga0395905_0354990 3300037471 Bacteria 1358
301 Ga0436364_0867874 3300037853 Bacteria 686
302 Ga0436365_1021728 3300039437 Unclassified 1850
303 Ga0439465_0301403 3300041413 Bacteria 600
304 Ga0451793_1776698 3300041452 Bacteria 706
305 Ga0451802_0174893 3300041460 Bacteria 582
306 Ga0451837_1733571 3300041494 Bacteria 567
307 Ga0451845_0398983 3300041501 Bacteria 545
308 Ga0451843_0000721 3300041509 Bacteria 694
309 Ga0439448_0023708 3300042005 Bacteria 1917
310 Ga0439457_037684 3300042014 Bacteria 1077
311 Ga0439434_0356005 3300042435 Bacteria 512
312 Ga0451577_1565663 3300042876 Bacteria 582
313 Ga0453684_0044880 3300044712 Bacteria 5905
314 Ga0466968_0198924 3300044735 Bacteria 938
315 Ga0466957_0289549 3300044842 Bacteria 1098
316 Ga0466960_0298739 3300044901 Bacteria 907
317 Ga0495629_0168870 3300046459 Bacteria 1519
318 Ga0495638_0023678 3300046460 Bacteria 4012
319 Ga0495650_0000367 3300046471 Bacteria 78952
320 Ga0495650_0311105 3300046471 Bacteria 526
321 Ga0495580_0036299 3300046472 Bacteria 3539
322 Ga0495582_0694260 3300046473 Bacteria 589
323 Ga0495584_0063377 3300046491 Bacteria 1858
324 Ga0495585_0001901 3300046492 Bacteria 15711
325 Ga0495585_0016943 3300046492 Bacteria 4219
326 Ga0495585_0195256 3300046492 Bacteria 1033
327 Ga0495596_0008321 3300046500 Bacteria 4624
328 Ga0495583_0001615 3300046506 Bacteria 22110
329 Ga0495583_0003764 3300046506 Bacteria 11268
330 Ga0495583_0005807 3300046506 Bacteria 8243
331 Ga0495606_0000071 3300046507 Bacteria 175933
332 Ga0495606_0041132 3300046507 Bacteria 3101
333 Ga0495606_0071436 3300046507 Bacteria 2185
334 Ga0495610_0164001 3300046512 Bacteria 937
335 Ga0495616_0148320 3300046513 Bacteria 1063
336 Ga0495616_0163481 3300046513 Bacteria 1000
337 Ga0495620_0144505 3300046515 Bacteria 929
338 Ga0495631_0085212 3300046518 Bacteria 1361
339 Ga0495637_0019171 3300046520 Bacteria 3164
340 Ga0495643_0000571 3300046522 Bacteria 45536
341 Ga0495643_0001197 3300046522 Bacteria 25265
342 Ga0495643_0027012 3300046522 Bacteria 3230
343 Ga0495643_0110844 3300046522 Bacteria 1395
344 Ga0495648_0000433 3300046524 Bacteria 45500
345 Ga0495648_0041522 3300046524 Bacteria 2904
346 Ga0495663_0000977 3300046525 Bacteria 9465
347 Ga0495642_0010129 3300046528 Bacteria 3610
348 Ga0495642_0490315 3300046528 Bacteria 544
349 Ga0495587_0273762 3300046536 Bacteria 947
350 Ga0495609_0078543 3300046538 Bacteria 1444
351 Ga0495622_0001736 3300046557 Bacteria 10781
352 Ga0495633_0001671 3300046558 Bacteria 16741
353 Ga0495633_0075787 3300046558 Bacteria 1566
354 Ga0495667_1023031 3300046559 Bacteria 503
355 Ga0495668_0000013 3300046616 Bacteria 452938
356 Ga0495611_0002611 3300046648 Bacteria 8156
357 Ga0495611_0080988 3300046648 Bacteria 1493
358 Ga0495611_0176428 3300046648 Bacteria 998
359 Ga0495625_0001280 3300046660 Bacteria 31552
360 Ga0495625_0006841 3300046660 Bacteria 10073
361 Ga0495625_0021091 3300046660 Bacteria 5021
362 Ga0495625_0156938 3300046660 Bacteria 1526
363 Ga0495625_0362501 3300046660 Bacteria 913
364 Ga0495625_0479850 3300046660 Bacteria 763
365 Ga0495625_0582754 3300046660 Bacteria 674
366 Ga0495661_0044371 3300046665 Bacteria 2726
367 Ga0495661_0396564 3300046665 Bacteria 672
368 Ga0495658_0823968 3300046683 Bacteria 594
369 Ga0495669_0000150 3300046684 Bacteria 44519
370 Ga0495613_0193923 3300046689 Bacteria 1435
371 Ga0495670_0052281 3300046691 Bacteria 2045
372 Ga0495649_0035952 3300046694 Bacteria 2723
373 Ga0495649_0088080 3300046694 Bacteria 1656
374 Ga0495600_0015525 3300046809 Bacteria 4815
375 Ga0495660_0163138 3300046810 Bacteria 1091
376 Ga0495636_0027414 3300047318 Bacteria 2321
377 Ga0495683_0001252 3300047323 Bacteria 17227
378 Ga0495687_000347 3300047443 Bacteria 59340
379 Ga0495687_000952 3300047443 Bacteria 29762
380 Ga0495677_0000317 3300047445 Bacteria 20851
381 Ga0495673_0091553 3300047469 Bacteria 1242
382 Ga0495681_0004037 3300047470 Bacteria 10096
383 Ga0495681_0077201 3300047470 Bacteria 1495
384 Ga0495686_0052745 3300047472 Bacteria 2549
385 Ga0495686_0161083 3300047472 Bacteria 1311
386 Ga0495686_0459553 3300047472 Bacteria 675
387 Ga0495686_0515788 3300047472 Bacteria 628
388 Ga0495686_0535585 3300047472 Bacteria 613
389 Ga0495615_0061889 3300048090 Bacteria 990
390 Ga0496102_0000086 3300048905 Bacteria 132217
391 Ga0496102_0316152 3300048905 Bacteria 1471
392 Ga0496103_0000266 3300048906 Bacteria 50137
393 Ga0496104_0021506 3300048907 Bacteria 5924
394 Ga0496105_0002490 3300048908 Bacteria 13347
395 Ga0496107_0936538 3300048910 Bacteria 630
396 Ga0496108_0129280 3300048911 Bacteria 2171
397 Ga0496108_0879819 3300048911 Bacteria 770
398 Ga0496108_1660459 3300048911 Bacteria 527
399 Ga0496109_0715255 3300048912 Bacteria 939
400 Ga0496110_0412936 3300048913 Bacteria 1231
401 Ga0496111_0001089 3300048914 Bacteria 15008
402 Ga0496113_0062994 3300048916 Bacteria 2802
403 Ga0496114_0004727 3300048917 Bacteria 10595
404 Ga0496115_0002331 3300048918 Bacteria 13604
405 Ga0496116_0008285 3300048919 Bacteria 9036
406 Ga0496117_0000175 3300048920 Bacteria 132363
407 Ga0496118_0002277 3300048921 Bacteria 26191
408 Ga0496119_0005767 3300048922 Bacteria 11729
409 Ga0496119_0068700 3300048922 Bacteria 2085
410 Ga0496120_0001500 3300048923 Bacteria 27635
411 Ga0496120_0007339 3300048923 Bacteria 8223
412 Ga0496121_0001017 3300048924 Bacteria 50104
413 Ga0496122_0004496 3300048925 Bacteria 17232
414 Ga0496123_0028973 3300048926 Bacteria 4087
415 Ga0496124_0000831 3300048927 Bacteria 50314
416 Ga0496125_0002213 3300048928 Bacteria 25926
417 Ga0496126_0000204 3300048929 Bacteria 132495
418 Ga0495682_0063328 3300049460 Bacteria 1334
419 Ga0501290_006432 3300049513 Bacteria 1472
420 Ga0501298_026022 3300049521 Bacteria 1123
421 Ga0501299_011832 3300049522 Bacteria 1479
422 Ga0501300_001665 3300049523 Bacteria 3331
423 Ga0501031_0101971 3300049568 Bacteria 1872
424 Ga0501033_0812888 3300049570 Bacteria 631
425 Ga0501034_0383042 3300049571 Bacteria 1331
426 Ga0501036_1012913 3300049572 Bacteria 680
427 Ga0501039_0389764 3300049575 Bacteria 1094
428 Ga0501047_0110626 3300049581 Bacteria 2630
429 Ga0501047_0419335 3300049581 Bacteria 1170
430 Ga0501224_027328 3300049664 Bacteria 853
431 Ga0501227_033327 3300049665 Bacteria 1246
432 Ga0501242_063314 3300049674 Bacteria 566
433 Ga0501257_000005 3300049686 Bacteria 58189
434 Ga0501080_1649949 3300049742 Bacteria 542
435 Ga0501278_006288 3300049774 Bacteria 887
436 Ga0501280_013944 3300049776 Bacteria 1140
437 Ga0501035_0375442 3300049822 Bacteria 1186
438 Ga0501035_0419257 3300049822 Bacteria 1111
439 Ga0501044_0236090 3300049823 Bacteria 1774
440 Ga0501044_0368639 3300049823 Bacteria 1353
441 nmdc:mga03683_391191_c1 3300050489 Bacteria 663
442 nmdc:mga00v17_869102_c1 3300050491 Bacteria 572
443 nmdc:mga0yw44_1155030_c1 3300050492 Bacteria 523
444 nmdc:mga0k408_37820_c1 3300050493 Bacteria 2771
445 nmdc:mga0k408_532821_c1 3300050493 Bacteria 695
446 nmdc:mga06z11_112459_c1 3300050494 Bacteria 1510
447 nmdc:mga06z11_233087_c1 3300050494 Bacteria 1079
448 nmdc:mga07m45_194823_c1 3300050496 Bacteria 1179
449 nmdc:mga07m45_422834_c1 3300050496 Bacteria 773
450 nmdc:mga07m45_707_c1 3300050496 Bacteria 14168
451 nmdc:mga0sz30_267673_c1 3300050516 Bacteria 761
452 Ga0500610_0001011 3300053079 Bacteria 9171
453 Ga0500610_0029286 3300053079 Bacteria 2781
454 Ga0495655_0376724 3300053083 Bacteria 501
455 Ga0500643_034023 3300053087 Bacteria 1538
456 Ga0500647_0262801 3300053091 Bacteria 753
457 Ga0500556_0355597 3300053104 Bacteria 567
458 Ga0500595_002233 3300053119 Bacteria 9834
459 Ga0500607_138633 3300053121 Bacteria 1148
460 Ga0500642_0013301 3300053130 Bacteria 3019
461 Ga0500559_0150435 3300053136 Bacteria 1092
462 Ga0500568_0141139 3300053139 Bacteria 893
463 Ga0500585_068753 3300053144 Bacteria 1278
464 Ga0500604_0090993 3300053151 Bacteria 996
465 Ga0500620_005796 3300053155 Bacteria 2895
466 Ga0500620_066264 3300053155 Bacteria 1236
467 Ga0500627_0122869 3300053158 Bacteria 1171
468 Ga0500627_0479356 3300053158 Unclassified 520
469 Ga0500636_0001455 3300053177 Bacteria 12872
470 Ga0500645_000231 3300053730 Bacteria 42528
471 Ga0500645_009201 3300053730 Bacteria 3329
472 Ga0500609_002966 3300053731 Bacteria 2417
473 Ga0500596_000253 3300053735 Bacteria 9366
474 Ga0501084_1859532 3300054114 Bacteria 503
475 Ga0500661_023165 3300055283 Bacteria 1099
476 Ga0501082_1367156 3300060353 Bacteria 619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026023 Ga0207677_10199633 Ga0207677_101996333 90
2 iso_pu_bacteria 2643221551 2643777207 92
3 iso_pu_bacteria 2643221555 2643795655 92
4 iso_pu_bacteria 2643221564 2643837010 92
5 iso_pu_bacteria 2643221623 2644130681 92
6 iso_pu_bacteria 2693429783 2694631646 92
7 iso_pu_bacteria 2693429784 2694638298 92
8 iso_pu_bacteria 2721755686 2723573395 92
9 iso_pu_bacteria 2738543024 2739306001 92
10 iso_pu_bacteria 2847670302 2847673726 92
11 iso_pu_bacteria 2847686936 2847690233 92
12 iso_pu_bacteria 2856314179 2856318849 92
13 iso_pu_bacteria 2856364286 2856365101 92
14 iso_pu_bacteria 2869285874 2869286275 92
15 iso_pu_bacteria 2871429161 2871430244 92
16 iso_pu_bacteria 2871444079 2871444521 92
17 iso_pu_bacteria 2871495908 2871500157 92
18 iso_pu_bacteria 2874102143 2874104871 92
19 iso_pu_bacteria 2874123672 2874130052 92
20 iso_pu_bacteria 2874146452 2874146660 92
21 iso_pu_bacteria 2874155637 2874155735 92
22 iso_pu_bacteria 2876369609 2876375915 92
23 iso_pu_bacteria 2876377896 2876379699 92
24 iso_pu_bacteria 2876392853 2876399214 92
25 iso_pu_bacteria 2876413966 2876414064 92
26 iso_pu_bacteria 2878035449 2878039165 92
27 iso_pu_bacteria 2878745973 2878746440 92
28 iso_pu_bacteria 2878760144 2878764279 92
29 iso_pu_bacteria 2878767105 2878771349 92
30 iso_pu_bacteria 2881147464 2881148493 92
31 iso_pu_bacteria 2881861095 2881868612 92
32 iso_pu_bacteria 2882632389 2882640402 92
33 iso_pu_bacteria 2885305155 2885307139 92
34 iso_pu_bacteria 2885318864 2885322928 92
35 iso_pu_bacteria 2885326080 2885330293 92
36 iso_pu_bacteria 2885334103 2885342027 92
37 iso_pu_bacteria 2903492973 2903499851 92
38 iso_pu_bacteria 2903540706 2903544972 92
39 iso_pu_bacteria 2904659560 2904665741 92
40 iso_pu_bacteria 2906308376 2906308841 92
41 iso_pu_bacteria 2906321335 2906322121 92
42 iso_pu_bacteria 2906328253 2906333907 92
43 iso_pu_bacteria 2906414383 2906418918 92
44 iso_pu_bacteria 2922158528 2922165406 92
45 iso_pu_bacteria 2924726620 2924727679 92
46 iso_pu_bacteria 2924762789 2924768612 92
47 iso_pu_bacteria 2924784321 2924790914 92
48 iso_pu_bacteria 2937813078 2937822180 92
49 iso_pu_bacteria 2937822353 2937823886 92
50 iso_pu_bacteria 2937891427 2937894386 92
51 iso_pu_bacteria 2937994558 2937998817 92
52 iso_pu_bacteria 2938014810 2938017586 92
53 iso_pu_bacteria 2958064165 2958065659 92
54 iso_pu_bacteria 2958115193 2958120405 92
55 iso_pu_bacteria 2958130278 2958130674 92
56 iso_pu_bacteria 2958165035 2958169292 92
57 iso_pu_bacteria 2958179912 2958180013 92
58 iso_pu_bacteria 2961077736 2961077840 92
59 iso_pu_bacteria 2961114664 2961121084 92
60 iso_pu_bacteria 2961163497 2961167754 92
61 iso_pu_bacteria 2965018300 2965022573 92
62 iso_pu_bacteria 2968097103 2968100234 92
63 iso_pu_bacteria 2968110612 2968117234 92
64 iso_pu_bacteria 2968128360 2968129639 92
65 iso_pu_bacteria 2968171901 2968176155 92
66 iso_pu_bacteria 2970554993 2970559123 92
67 iso_pu_bacteria 2977843712 2977844323 92
68 iso_pu_bacteria 2977858184 2977862073 92
69 iso_pu_bacteria 2977864932 2977865655 92
70 iso_pu_bacteria 2977942078 2977942447 92
71 iso_pu_bacteria 2979779861 2979784484 92
72 iso_pu_bacteria 2987659509 2987663761 92
73 iso_pu_bacteria 2987666974 2987673341 92
74 iso_pu_bacteria 2996341866 2996343619 92
75 iso_pu_bacteria 3004188549 3004192818 92
76 iso_pu_bacteria 8002285264 8002291889 92
77 iso_pu_bacteria 8004387939 8004388699 92
78 iso_pu_bacteria 8004445564 8004448257 92
79 iso_pu_bacteria 8004640170 8004646539 92
80 iso_pu_bacteria 8004703790 8004706438 92
81 iso_pu_bacteria 8004714634 8004715097 92
82 3300042876 Ga0451577_1565663 Ga0451577_1565663_134_424 93
83 3300005548 Ga0070665_100000532 Ga0070665_10000053243 94
84 3300005841 Ga0068863_100120226 Ga0068863_1001202262 94
85 3300009177 Ga0105248_11445095 Ga0105248_114450952 94
86 3300026088 Ga0207641_10098245 Ga0207641_100982452 94
87 3300026142 Ga0207698_10844671 Ga0207698_108446711 94
88 3300028379 Ga0268266_10000641 Ga0268266_1000064116 94
89 3300028800 Ga0265338_10060752 Ga0265338_100607521 94
90 3300031824 Ga0307413_10068846 Ga0307413_100688461 94
91 3300031911 Ga0307412_10663056 Ga0307412_106630561 94
92 3300031995 Ga0307409_102497059 Ga0307409_1024970592 94
93 3300032004 Ga0307414_10035908 Ga0307414_100359086 94
94 3300041494 Ga0451837_1733571 Ga0451837_1733571_203_490 94
95 3300041509 Ga0451843_0000721 Ga0451843_0000721_388_675 94
96 3300042435 Ga0439434_0356005 Ga0439434_0356005_118_405 94
97 3300046472 Ga0495580_0036299 Ga0495580_0036299_1273_1560 94
98 3300047472 Ga0495686_0052745 Ga0495686_0052745_199_486 94
99 3300049571 Ga0501034_0383042 Ga0501034_0383042_964_1257 94
100 3300053139 Ga0500568_0141139 Ga0500568_0141139_450_737 94
101 3300060353 Ga0501082_1367156 Ga0501082_1367156_257_544 94
102 2088090003 LJN_F7QKVOU01DNS15 LJN_02202320 95
103 3300001915 JGI24741J21665_1018491 JGI24741J21665_10184912 95
104 3300001915 JGI24741J21665_1037089 JGI24741J21665_10370892 95
105 3300001978 JGI24747J21853_1039588 JGI24747J21853_10395882 95
106 3300001979 JGI24740J21852_10012384 JGI24740J21852_100123842 95
107 3300001979 JGI24740J21852_10074386 JGI24740J21852_100743862 95
108 3300001979 JGI24740J21852_10153714 JGI24740J21852_101537142 95
109 3300001989 JGI24739J22299_10014933 JGI24739J22299_100149334 95
110 3300001990 JGI24737J22298_10000079 JGI24737J22298_1000007922 95
111 3300001990 JGI24737J22298_10030122 JGI24737J22298_100301222 95
112 3300001990 JGI24737J22298_10188805 JGI24737J22298_101888052 95
113 3300002067 JGI24735J21928_10028653 JGI24735J21928_100286532 95
114 3300002077 JGI24744J21845_10060073 JGI24744J21845_100600731 95
115 3300002244 JGI24742J22300_10084336 JGI24742J22300_100843362 95
116 3300003214 JGI25165J46597_1000052 JGI25165J46597_1000052181 95
117 3300003215 JGI25153J46596_10000007 JGI25153J46596_1000000771 95
118 3300003322 rootL2_10141062 rootL2_101410622 95
119 3300003759 Ga0055525_1000080 Ga0055525_100008050 95
120 3300003762 Ga0055542_1000012 Ga0055542_1000012248 95
121 3300003763 Ga0055529_1000002 Ga0055529_1000002164 95
122 3300003763 Ga0055529_1000004 Ga0055529_1000004391 95
123 3300005262 Ga0065165_1100152 Ga0065165_11001521 95
124 3300005327 Ga0070658_10007991 Ga0070658_100079915 95
125 3300005327 Ga0070658_10051625 Ga0070658_100516252 95
126 3300005327 Ga0070658_10272215 Ga0070658_102722153 95
127 3300005328 Ga0070676_10385522 Ga0070676_103855222 95
128 3300005328 Ga0070676_11003915 Ga0070676_110039152 95
129 3300005329 Ga0070683_100025496 Ga0070683_1000254964 95
130 3300005331 Ga0070670_100021324 Ga0070670_1000213243 95
131 3300005334 Ga0068869_100671822 Ga0068869_1006718221 95
132 3300005336 Ga0070680_100015727 Ga0070680_1000157274 95
133 3300005338 Ga0068868_100384115 Ga0068868_1003841151 95
134 3300005339 Ga0070660_100000596 Ga0070660_10000059620 95
135 3300005339 Ga0070660_100514276 Ga0070660_1005142762 95
136 3300005339 Ga0070660_100863023 Ga0070660_1008630232 95
137 3300005344 Ga0070661_100011818 Ga0070661_1000118184 95
138 3300005344 Ga0070661_100019206 Ga0070661_1000192066 95
139 3300005344 Ga0070661_100027323 Ga0070661_1000273234 95
140 3300005344 Ga0070661_100096488 Ga0070661_1000964881 95
141 3300005345 Ga0070692_11202944 Ga0070692_112029442 95
142 3300005347 Ga0070668_100293013 Ga0070668_1002930132 95
143 3300005353 Ga0070669_100738715 Ga0070669_1007387151 95
144 3300005354 Ga0070675_100265943 Ga0070675_1002659432 95
145 3300005355 Ga0070671_100802356 Ga0070671_1008023562 95
146 3300005356 Ga0070674_100015088 Ga0070674_1000150884 95
147 3300005356 Ga0070674_100438542 Ga0070674_1004385421 95
148 3300005364 Ga0070673_100045759 Ga0070673_1000457594 95
149 3300005366 Ga0070659_100015179 Ga0070659_1000151794 95
150 3300005366 Ga0070659_100123700 Ga0070659_1001237001 95
151 3300005367 Ga0070667_100009344 Ga0070667_1000093444 95
152 3300005455 Ga0070663_100940740 Ga0070663_1009407401 95
153 3300005455 Ga0070663_101096254 Ga0070663_1010962542 95
154 3300005456 Ga0070678_100000816 Ga0070678_1000008161 95
155 3300005456 Ga0070678_100143905 Ga0070678_1001439052 95
156 3300005456 Ga0070678_102251823 Ga0070678_1022518231 95
157 3300005457 Ga0070662_100000589 Ga0070662_10000058920 95
158 3300005457 Ga0070662_100112428 Ga0070662_1001124281 95
159 3300005457 Ga0070662_100276082 Ga0070662_1002760822 95
160 3300005457 Ga0070662_101149807 Ga0070662_1011498071 95
161 3300005458 Ga0070681_10000796 Ga0070681_100007968 95
162 3300005459 Ga0068867_100036928 Ga0068867_1000369284 95
163 3300005530 Ga0070679_100020369 Ga0070679_1000203693 95
164 3300005539 Ga0068853_100037655 Ga0068853_1000376554 95
165 3300005539 Ga0068853_100050084 Ga0068853_1000500844 95
166 3300005539 Ga0068853_101395202 Ga0068853_1013952021 95
167 3300005539 Ga0068853_101570070 Ga0068853_1015700701 95
168 3300005543 Ga0070672_100030101 Ga0070672_1000301013 95
169 3300005548 Ga0070665_100000416 Ga0070665_10000041649 95
170 3300005548 Ga0070665_100135774 Ga0070665_1001357741 95
171 3300005548 Ga0070665_100138196 Ga0070665_1001381963 95
172 3300005563 Ga0068855_100134072 Ga0068855_1001340722 95
173 3300005563 Ga0068855_100150413 Ga0068855_1001504132 95
174 3300005564 Ga0070664_100014402 Ga0070664_1000144027 95
175 3300005564 Ga0070664_100035488 Ga0070664_1000354883 95
176 3300005577 Ga0068857_101200615 Ga0068857_1012006152 95
177 3300005577 Ga0068857_101453285 Ga0068857_1014532851 95
178 3300005577 Ga0068857_101457739 Ga0068857_1014577392 95
179 3300005578 Ga0068854_100033554 Ga0068854_1000335543 95
180 3300005578 Ga0068854_100169562 Ga0068854_1001695623 95
181 3300005614 Ga0068856_100021118 Ga0068856_1000211185 95
182 3300005614 Ga0068856_100418863 Ga0068856_1004188632 95
183 3300005616 Ga0068852_100072811 Ga0068852_1000728113 95
184 3300005616 Ga0068852_100122689 Ga0068852_1001226893 95
185 3300005616 Ga0068852_101376531 Ga0068852_1013765311 95
186 3300005616 Ga0068852_101583571 Ga0068852_1015835712 95
187 3300005718 Ga0068866_10504304 Ga0068866_105043042 95
188 3300005718 Ga0068866_10700439 Ga0068866_107004392 95
189 3300005834 Ga0068851_10229033 Ga0068851_102290332 95
190 3300005834 Ga0068851_10742836 Ga0068851_107428362 95
191 3300005834 Ga0068851_10772426 Ga0068851_107724262 95
192 3300005843 Ga0068860_101941424 Ga0068860_1019414241 95
193 3300006038 Ga0075365_10179072 Ga0075365_101790722 95
194 3300006038 Ga0075365_10195732 Ga0075365_101957323 95
195 3300006042 Ga0075368_10017500 Ga0075368_100175003 95
196 3300006042 Ga0075368_10195111 Ga0075368_101951112 95
197 3300006048 Ga0075363_100279544 Ga0075363_1002795442 95
198 3300006048 Ga0075363_100736444 Ga0075363_1007364442 95
199 3300006051 Ga0075364_10083790 Ga0075364_100837903 95
200 3300006177 Ga0075362_10139000 Ga0075362_101390002 95
201 3300006177 Ga0075362_10397363 Ga0075362_103973632 95
202 3300006178 Ga0075367_10049835 Ga0075367_100498352 95
203 3300006178 Ga0075367_10222124 Ga0075367_102221242 95
204 3300006195 Ga0075366_10023913 Ga0075366_100239133 95
205 3300006195 Ga0075366_10730964 Ga0075366_107309641 95
206 3300006195 Ga0075366_11042068 Ga0075366_110420681 95
207 3300006195 Ga0075366_11073995 Ga0075366_110739952 95
208 3300006353 Ga0075370_10011511 Ga0075370_100115114 95
209 3300006353 Ga0075370_10437122 Ga0075370_104371222 95
210 3300006358 Ga0068871_100327567 Ga0068871_1003275673 95
211 3300009148 Ga0105243_10000522 Ga0105243_1000052216 95
212 3300009148 Ga0105243_10229154 Ga0105243_102291542 95
213 3300009148 Ga0105243_11658187 Ga0105243_116581872 95
214 3300009174 Ga0105241_10004947 Ga0105241_100049474 95
215 3300009174 Ga0105241_12014272 Ga0105241_120142721 95
216 3300009174 Ga0105241_12463689 Ga0105241_124636891 95
217 3300009176 Ga0105242_10333506 Ga0105242_103335062 95
218 3300009176 Ga0105242_11869091 Ga0105242_118690911 95
219 3300009177 Ga0105248_12191674 Ga0105248_121916742 95
220 3300009545 Ga0105237_10182626 Ga0105237_101826262 95
221 3300010375 Ga0105239_10907321 Ga0105239_109073212 95
222 3300011119 Ga0105246_11085275 Ga0105246_110852751 95
223 3300012475 Ga0157317_1004020 Ga0157317_10040203 95
224 3300012500 Ga0157314_1042923 Ga0157314_10429232 95
225 3300012513 Ga0157326_1002094 Ga0157326_10020942 95
226 3300013100 Ga0157373_10007516 Ga0157373_100075162 95
227 3300013102 Ga0157371_10000148 Ga0157371_1000014884 95
228 3300013102 Ga0157371_10001786 Ga0157371_1000178620 95
229 3300013104 Ga0157370_10000677 Ga0157370_1000067726 95
230 3300013104 Ga0157370_10449655 Ga0157370_104496552 95
231 3300013104 Ga0157370_10952515 Ga0157370_109525152 95
232 3300013105 Ga0157369_10001965 Ga0157369_100019653 95
233 3300013296 Ga0157374_10075102 Ga0157374_100751022 95
234 3300013297 Ga0157378_10289586 Ga0157378_102895863 95
235 3300013297 Ga0157378_10576153 Ga0157378_105761532 95
236 3300013297 Ga0157378_11426424 Ga0157378_114264242 95
237 3300013307 Ga0157372_10001466 Ga0157372_100014667 95
238 3300013308 Ga0157375_11685755 Ga0157375_116857552 95
239 3300014325 Ga0163163_10824756 Ga0163163_108247562 95
240 3300014497 Ga0182008_10384017 Ga0182008_103840172 95
241 3300014969 Ga0157376_10184773 Ga0157376_101847732 95
242 3300014969 Ga0157376_10187610 Ga0157376_101876102 95
243 3300025226 Ga0209674_105242 Ga0209674_1052421 95
244 3300025230 Ga0209563_100058 Ga0209563_100058171 95
245 3300025233 Ga0209437_132712 Ga0209437_1327121 95
246 3300025246 Ga0209646_1004298 Ga0209646_10042981 95
247 3300025250 Ga0209026_1013419 Ga0209026_10134193 95
248 3300025253 Ga0209677_103554 Ga0209677_1035546 95
249 3300025254 Ga0209148_1000008 Ga0209148_1000008883 95
250 3300025261 Ga0209233_1000118 Ga0209233_100011883 95
251 3300025261 Ga0209233_1045825 Ga0209233_10458252 95
252 3300025261 Ga0209233_1053946 Ga0209233_10539462 95
253 3300025272 Ga0209455_1000002 Ga0209455_1000002542 95
254 3300025297 Ga0209758_1000017 Ga0209758_100001772 95
255 3300025315 Ga0207697_10064335 Ga0207697_100643352 95
256 3300025321 Ga0207656_10008253 Ga0207656_100082534 95
257 3300025321 Ga0207656_10012504 Ga0207656_100125042 95
258 3300025893 Ga0207682_10130164 Ga0207682_101301641 95
259 3300025901 Ga0207688_10237162 Ga0207688_102371622 95
260 3300025903 Ga0207680_10332522 Ga0207680_103325222 95
261 3300025904 Ga0207647_10045884 Ga0207647_100458842 95
262 3300025904 Ga0207647_10100966 Ga0207647_101009662 95
263 3300025904 Ga0207647_10279505 Ga0207647_102795052 95
264 3300025904 Ga0207647_10406760 Ga0207647_104067601 95
265 3300025907 Ga0207645_10129650 Ga0207645_101296502 95
266 3300025907 Ga0207645_10270887 Ga0207645_102708872 95
267 3300025909 Ga0207705_10000702 Ga0207705_1000070225 95
268 3300025909 Ga0207705_10007056 Ga0207705_100070565 95
269 3300025909 Ga0207705_10078913 Ga0207705_100789134 95
270 3300025909 Ga0207705_10130784 Ga0207705_101307842 95
271 3300025909 Ga0207705_10792368 Ga0207705_107923682 95
272 3300025909 Ga0207705_11385712 Ga0207705_113857121 95
273 3300025911 Ga0207654_10013475 Ga0207654_100134755 95
274 3300025911 Ga0207654_10321581 Ga0207654_103215812 95
275 3300025911 Ga0207654_10398197 Ga0207654_103981972 95
276 3300025911 Ga0207654_11251371 Ga0207654_112513711 95
277 3300025912 Ga0207707_10005063 Ga0207707_1000506311 95
278 3300025913 Ga0207695_10513459 Ga0207695_105134592 95
279 3300025913 Ga0207695_11396299 Ga0207695_113962991 95
280 3300025914 Ga0207671_10125082 Ga0207671_101250824 95
281 3300025914 Ga0207671_10648571 Ga0207671_106485712 95
282 3300025914 Ga0207671_10887977 Ga0207671_108879771 95
283 3300025917 Ga0207660_10147150 Ga0207660_101471502 95
284 3300025919 Ga0207657_10001287 Ga0207657_1000128724 95
285 3300025919 Ga0207657_10002944 Ga0207657_100029447 95
286 3300025919 Ga0207657_10205061 Ga0207657_102050612 95
287 3300025919 Ga0207657_11160632 Ga0207657_111606322 95
288 3300025919 Ga0207657_11239705 Ga0207657_112397052 95
289 3300025919 Ga0207657_11376935 Ga0207657_113769352 95
290 3300025920 Ga0207649_10001132 Ga0207649_1000113217 95
291 3300025920 Ga0207649_10002474 Ga0207649_1000247410 95
292 3300025920 Ga0207649_10007056 Ga0207649_100070565 95
293 3300025920 Ga0207649_10064136 Ga0207649_100641362 95
294 3300025920 Ga0207649_10096281 Ga0207649_100962812 95
295 3300025921 Ga0207652_10077021 Ga0207652_100770213 95
296 3300025924 Ga0207694_10034188 Ga0207694_100341884 95
297 3300025924 Ga0207694_10162537 Ga0207694_101625373 95
298 3300025925 Ga0207650_10245726 Ga0207650_102457263 95
299 3300025926 Ga0207659_10436631 Ga0207659_104366311 95
300 3300025927 Ga0207687_10179479 Ga0207687_101794792 95
301 3300025931 Ga0207644_10661099 Ga0207644_106610992 95
302 3300025932 Ga0207690_10005504 Ga0207690_100055045 95
303 3300025932 Ga0207690_10015698 Ga0207690_100156984 95
304 3300025932 Ga0207690_10078446 Ga0207690_100784463 95
305 3300025933 Ga0207706_10078841 Ga0207706_100788412 95
306 3300025933 Ga0207706_10084438 Ga0207706_100844385 95
307 3300025933 Ga0207706_10274863 Ga0207706_102748632 95
308 3300025933 Ga0207706_10749509 Ga0207706_107495091 95
309 3300025933 Ga0207706_11044056 Ga0207706_110440562 95
310 3300025935 Ga0207709_10000109 Ga0207709_1000010995 95
311 3300025937 Ga0207669_10000213 Ga0207669_1000021311 95
312 3300025937 Ga0207669_10012260 Ga0207669_100122605 95
313 3300025937 Ga0207669_10138417 Ga0207669_101384173 95
314 3300025938 Ga0207704_10126852 Ga0207704_101268521 95
315 3300025938 Ga0207704_10730498 Ga0207704_107304982 95
316 3300025940 Ga0207691_10069055 Ga0207691_100690553 95
317 3300025942 Ga0207689_11605640 Ga0207689_116056402 95
318 3300025944 Ga0207661_10098230 Ga0207661_100982303 95
319 3300025944 Ga0207661_10440844 Ga0207661_104408442 95
320 3300025944 Ga0207661_10452061 Ga0207661_104520612 95
321 3300025945 Ga0207679_10050389 Ga0207679_100503892 95
322 3300025945 Ga0207679_10275444 Ga0207679_102754443 95
323 3300025949 Ga0207667_10000006 Ga0207667_1000000610 95
324 3300025949 Ga0207667_10008324 Ga0207667_100083246 95
325 3300025949 Ga0207667_10068337 Ga0207667_100683374 95
326 3300025949 Ga0207667_10556171 Ga0207667_105561712 95
327 3300025949 Ga0207667_10632958 Ga0207667_106329582 95
328 3300025960 Ga0207651_11480434 Ga0207651_114804342 95
329 3300025972 Ga0207668_10242131 Ga0207668_102421313 95
330 3300025981 Ga0207640_10005904 Ga0207640_100059044 95
331 3300025981 Ga0207640_10013294 Ga0207640_100132943 95
332 3300025981 Ga0207640_10032827 Ga0207640_100328272 95
333 3300025981 Ga0207640_11910762 Ga0207640_119107621 95
334 3300025986 Ga0207658_10224984 Ga0207658_102249843 95
335 3300026023 Ga0207677_11180176 Ga0207677_111801762 95
336 3300026041 Ga0207639_10002059 Ga0207639_1000205917 95
337 3300026041 Ga0207639_10002931 Ga0207639_1000293112 95
338 3300026041 Ga0207639_10008345 Ga0207639_100083451 95
339 3300026041 Ga0207639_10039600 Ga0207639_100396002 95
340 3300026041 Ga0207639_10596463 Ga0207639_105964632 95
341 3300026067 Ga0207678_10049438 Ga0207678_100494382 95
342 3300026067 Ga0207678_11484381 Ga0207678_114843812 95
343 3300026067 Ga0207678_11644812 Ga0207678_116448121 95
344 3300026067 Ga0207678_11837216 Ga0207678_118372161 95
345 3300026078 Ga0207702_10001342 Ga0207702_1000134225 95
346 3300026078 Ga0207702_10014731 Ga0207702_100147317 95
347 3300026078 Ga0207702_10144276 Ga0207702_101442762 95
348 3300026088 Ga0207641_12229190 Ga0207641_122291901 95
349 3300026089 Ga0207648_10034099 Ga0207648_100340992 95
350 3300026089 Ga0207648_10051735 Ga0207648_100517355 95
351 3300026116 Ga0207674_10025271 Ga0207674_100252713 95
352 3300026116 Ga0207674_10702632 Ga0207674_107026322 95
353 3300026116 Ga0207674_11648784 Ga0207674_116487841 95
354 3300026118 Ga0207675_100259124 Ga0207675_1002591243 95
355 3300026118 Ga0207675_100355482 Ga0207675_1003554823 95
356 3300026121 Ga0207683_10004804 Ga0207683_100048041 95
357 3300026121 Ga0207683_10298325 Ga0207683_102983253 95
358 3300026142 Ga0207698_10029738 Ga0207698_100297382 95
359 3300026142 Ga0207698_10183558 Ga0207698_101835583 95
360 3300026142 Ga0207698_10313810 Ga0207698_103138103 95
361 3300026142 Ga0207698_10937842 Ga0207698_109378422 95
362 3300026142 Ga0207698_11518381 Ga0207698_115183811 95
363 3300026142 Ga0207698_11624682 Ga0207698_116246822 95
364 3300027866 Ga0209813_10130106 Ga0209813_101301062 95
365 3300027866 Ga0209813_10493460 Ga0209813_104934601 95
366 3300028379 Ga0268266_10000002 Ga0268266_1000000261 95
367 3300028379 Ga0268266_10035162 Ga0268266_100351623 95
368 3300028379 Ga0268266_10834101 Ga0268266_108341012 95
369 3300028379 Ga0268266_10877671 Ga0268266_108776712 95
370 3300028786 Ga0307517_10032277 Ga0307517_100322777 95
371 3300031456 Ga0307513_10060146 Ga0307513_100601464 95
372 3300031507 Ga0307509_10874829 Ga0307509_108748292 95
373 3300031824 Ga0307413_10071596 Ga0307413_100715963 95
374 3300031911 Ga0307412_10176300 Ga0307412_101763003 95
375 3300032004 Ga0307414_10202566 Ga0307414_102025662 95
376 3300032004 Ga0307414_10951155 Ga0307414_109511552 95
377 3300032005 Ga0307411_10173774 Ga0307411_101737743 95
378 3300032126 Ga0307415_100238988 Ga0307415_1002389883 95
379 3300033180 Ga0307510_10050450 Ga0307510_100504501 95
380 3300034820 Ga0373959_0086838 Ga0373959_0086838_257_544 95
381 3300034957 Ga0373938_0170455 Ga0373938_0170455_272_559 95
382 3300035088 Ga0373940_0157825 Ga0373940_0157825_368_655 95
383 3300035090 Ga0373949_0195120 Ga0373949_0195120_222_509 95
384 3300035112 Ga0373932_0095021 Ga0373932_0095021_287_574 95
385 3300035207 Ga0373942_0006056 Ga0373942_0006056_1905_2192 95
386 3300035691 Ga0373931_0028453 Ga0373931_0028453_1083_1370 95
387 3300037312 Ga0395899_0312246 Ga0395899_0312246_528_818 95
388 3300037471 Ga0395905_0291521 Ga0395905_0291521_1196_1489 95
389 3300037471 Ga0395905_0354990 Ga0395905_0354990_473_805 95
390 3300037853 Ga0436364_0867874 Ga0436364_0867874_103_390 95
391 3300039437 Ga0436365_1021728 Ga0436365_1021728_911_1201 95
392 3300041413 Ga0439465_0301403 Ga0439465_0301403_31_327 95
393 3300041452 Ga0451793_1776698 Ga0451793_1776698_58_348 95
394 3300041460 Ga0451802_0174893 Ga0451802_0174893_19_309 95
395 3300041501 Ga0451845_0398983 Ga0451845_0398983_135_431 95
396 3300042005 Ga0439448_0023708 Ga0439448_0023708_1110_1454 95
397 3300042014 Ga0439457_037684 Ga0439457_037684_706_1017 95
398 3300044712 Ga0453684_0044880 Ga0453684_0044880_3193_3507 95
399 3300044735 Ga0466968_0198924 Ga0466968_0198924_24_317 95
400 3300044842 Ga0466957_0289549 Ga0466957_0289549_468_758 95
401 3300044901 Ga0466960_0298739 Ga0466960_0298739_85_378 95
402 3300046459 Ga0495629_0168870 Ga0495629_0168870_851_1141 95
403 3300046460 Ga0495638_0023678 Ga0495638_0023678_205_492 95
404 3300046471 Ga0495650_0000367 Ga0495650_0000367_69243_69533 95
405 3300046471 Ga0495650_0311105 Ga0495650_0311105_94_390 95
406 3300046473 Ga0495582_0694260 Ga0495582_0694260_170_460 95
407 3300046491 Ga0495584_0063377 Ga0495584_0063377_1241_1531 95
408 3300046492 Ga0495585_0001901 Ga0495585_0001901_12683_12973 95
409 3300046492 Ga0495585_0016943 Ga0495585_0016943_1289_1579 95
410 3300046492 Ga0495585_0195256 Ga0495585_0195256_194_484 95
411 3300046500 Ga0495596_0008321 Ga0495596_0008321_1397_1687 95
412 3300046506 Ga0495583_0001615 Ga0495583_0001615_12434_12724 95
413 3300046506 Ga0495583_0003764 Ga0495583_0003764_5529_5819 95
414 3300046506 Ga0495583_0005807 Ga0495583_0005807_783_1073 95
415 3300046507 Ga0495606_0000071 Ga0495606_0000071_61953_62297 95
416 3300046507 Ga0495606_0041132 Ga0495606_0041132_2323_2667 95
417 3300046507 Ga0495606_0071436 Ga0495606_0071436_670_960 95
418 3300046512 Ga0495610_0164001 Ga0495610_0164001_482_772 95
419 3300046513 Ga0495616_0148320 Ga0495616_0148320_651_941 95
420 3300046513 Ga0495616_0163481 Ga0495616_0163481_283_579 95
421 3300046515 Ga0495620_0144505 Ga0495620_0144505_327_617 95
422 3300046518 Ga0495631_0085212 Ga0495631_0085212_990_1334 95
423 3300046520 Ga0495637_0019171 Ga0495637_0019171_777_1067 95
424 3300046522 Ga0495643_0000571 Ga0495643_0000571_36218_36508 95
425 3300046522 Ga0495643_0001197 Ga0495643_0001197_12462_12752 95
426 3300046522 Ga0495643_0027012 Ga0495643_0027012_2926_3216 95
427 3300046522 Ga0495643_0110844 Ga0495643_0110844_821_1111 95
428 3300046524 Ga0495648_0000433 Ga0495648_0000433_17330_17620 95
429 3300046524 Ga0495648_0041522 Ga0495648_0041522_1084_1374 95
430 3300046525 Ga0495663_0000977 Ga0495663_0000977_5412_5702 95
431 3300046528 Ga0495642_0010129 Ga0495642_0010129_3011_3301 95
432 3300046528 Ga0495642_0490315 Ga0495642_0490315_16_312 95
433 3300046536 Ga0495587_0273762 Ga0495587_0273762_88_378 95
434 3300046538 Ga0495609_0078543 Ga0495609_0078543_1060_1350 95
435 3300046557 Ga0495622_0001736 Ga0495622_0001736_8758_9048 95
436 3300046558 Ga0495633_0001671 Ga0495633_0001671_4960_5250 95
437 3300046558 Ga0495633_0075787 Ga0495633_0075787_1125_1415 95
438 3300046559 Ga0495667_1023031 Ga0495667_1023031_101_391 95
439 3300046616 Ga0495668_0000013 Ga0495668_0000013_440747_441037 95
440 3300046648 Ga0495611_0002611 Ga0495611_0002611_270_560 95
441 3300046648 Ga0495611_0080988 Ga0495611_0080988_643_933 95
442 3300046648 Ga0495611_0176428 Ga0495611_0176428_491_781 95
443 3300046660 Ga0495625_0001280 Ga0495625_0001280_13834_14124 95
444 3300046660 Ga0495625_0006841 Ga0495625_0006841_6462_6752 95
445 3300046660 Ga0495625_0021091 Ga0495625_0021091_1250_1543 95
446 3300046660 Ga0495625_0156938 Ga0495625_0156938_1163_1453 95
447 3300046660 Ga0495625_0362501 Ga0495625_0362501_42_332 95
448 3300046660 Ga0495625_0479850 Ga0495625_0479850_59_403 95
449 3300046660 Ga0495625_0582754 Ga0495625_0582754_35_370 95
450 3300046665 Ga0495661_0044371 Ga0495661_0044371_282_572 95
451 3300046665 Ga0495661_0396564 Ga0495661_0396564_94_390 95
452 3300046683 Ga0495658_0823968 Ga0495658_0823968_286_576 95
453 3300046684 Ga0495669_0000150 Ga0495669_0000150_31412_31702 95
454 3300046689 Ga0495613_0193923 Ga0495613_0193923_12_302 95
455 3300046691 Ga0495670_0052281 Ga0495670_0052281_665_955 95
456 3300046694 Ga0495649_0035952 Ga0495649_0035952_1631_1921 95
457 3300046694 Ga0495649_0088080 Ga0495649_0088080_268_558 95
458 3300046809 Ga0495600_0015525 Ga0495600_0015525_3302_3592 95
459 3300046810 Ga0495660_0163138 Ga0495660_0163138_124_468 95
460 3300047318 Ga0495636_0027414 Ga0495636_0027414_292_582 95
461 3300047323 Ga0495683_0001252 Ga0495683_0001252_10346_10636 95
462 3300047443 Ga0495687_000347 Ga0495687_000347_11908_12252 95
463 3300047443 Ga0495687_000952 Ga0495687_000952_19515_19805 95
464 3300047445 Ga0495677_0000317 Ga0495677_0000317_9127_9417 95
465 3300047469 Ga0495673_0091553 Ga0495673_0091553_373_663 95
466 3300047470 Ga0495681_0004037 Ga0495681_0004037_3696_3986 95
467 3300047470 Ga0495681_0077201 Ga0495681_0077201_305_595 95
468 3300047472 Ga0495686_0161083 Ga0495686_0161083_985_1281 95
469 3300047472 Ga0495686_0459553 Ga0495686_0459553_261_551 95
470 3300047472 Ga0495686_0515788 Ga0495686_0515788_26_316 95
471 3300047472 Ga0495686_0535585 Ga0495686_0535585_135_425 95
472 3300048090 Ga0495615_0061889 Ga0495615_0061889_389_679 95
473 3300048905 Ga0496102_0000086 Ga0496102_0000086_122418_122708 95
474 3300048905 Ga0496102_0316152 Ga0496102_0316152_610_906 95
475 3300048906 Ga0496103_0000266 Ga0496103_0000266_40170_40460 95
476 3300048907 Ga0496104_0021506 Ga0496104_0021506_3749_4039 95
477 3300048908 Ga0496105_0002490 Ga0496105_0002490_3457_3747 95
478 3300048910 Ga0496107_0936538 Ga0496107_0936538_253_543 95
479 3300048911 Ga0496108_0129280 Ga0496108_0129280_1790_2086 95
480 3300048911 Ga0496108_0879819 Ga0496108_0879819_218_505 95
481 3300048911 Ga0496108_1660459 Ga0496108_1660459_15_359 95
482 3300048912 Ga0496109_0715255 Ga0496109_0715255_523_813 95
483 3300048913 Ga0496110_0412936 Ga0496110_0412936_775_1065 95
484 3300048914 Ga0496111_0001089 Ga0496111_0001089_9323_9613 95
485 3300048916 Ga0496113_0062994 Ga0496113_0062994_1190_1480 95
486 3300048917 Ga0496114_0004727 Ga0496114_0004727_6666_6956 95
487 3300048918 Ga0496115_0002331 Ga0496115_0002331_3876_4166 95
488 3300048919 Ga0496116_0008285 Ga0496116_0008285_5575_5865 95
489 3300048920 Ga0496117_0000175 Ga0496117_0000175_9626_9916 95
490 3300048921 Ga0496118_0002277 Ga0496118_0002277_9803_10093 95
491 3300048922 Ga0496119_0005767 Ga0496119_0005767_9434_9724 95
492 3300048922 Ga0496119_0068700 Ga0496119_0068700_415_708 95
493 3300048923 Ga0496120_0001500 Ga0496120_0001500_17452_17745 95
494 3300048923 Ga0496120_0007339 Ga0496120_0007339_2254_2544 95
495 3300048924 Ga0496121_0001017 Ga0496121_0001017_9639_9929 95
496 3300048925 Ga0496122_0004496 Ga0496122_0004496_11810_12100 95
497 3300048926 Ga0496123_0028973 Ga0496123_0028973_1166_1456 95
498 3300048927 Ga0496124_0000831 Ga0496124_0000831_40162_40452 95
499 3300048928 Ga0496125_0002213 Ga0496125_0002213_14062_14352 95
500 3300048929 Ga0496126_0000204 Ga0496126_0000204_9804_10094 95
501 3300049460 Ga0495682_0063328 Ga0495682_0063328_503_793 95
502 3300049513 Ga0501290_006432 Ga0501290_006432_1013_1300 95
503 3300049521 Ga0501298_026022 Ga0501298_026022_44_331 95
504 3300049522 Ga0501299_011832 Ga0501299_011832_854_1141 95
505 3300049523 Ga0501300_001665 Ga0501300_001665_1374_1748 95
506 3300049568 Ga0501031_0101971 Ga0501031_0101971_1031_1333 95
507 3300049570 Ga0501033_0812888 Ga0501033_0812888_220_510 95
508 3300049572 Ga0501036_1012913 Ga0501036_1012913_91_393 95
509 3300049575 Ga0501039_0389764 Ga0501039_0389764_289_591 95
510 3300049581 Ga0501047_0110626 Ga0501047_0110626_658_948 95
511 3300049581 Ga0501047_0419335 Ga0501047_0419335_136_426 95
512 3300049664 Ga0501224_027328 Ga0501224_027328_274_564 95
513 3300049665 Ga0501227_033327 Ga0501227_033327_277_564 95
514 3300049674 Ga0501242_063314 Ga0501242_063314_78_368 95
515 3300049686 Ga0501257_000005 Ga0501257_000005_3573_3860 95
516 3300049742 Ga0501080_1649949 Ga0501080_1649949_191_481 95
517 3300049774 Ga0501278_006288 Ga0501278_006288_530_826 95
518 3300049776 Ga0501280_013944 Ga0501280_013944_677_973 95
519 3300049822 Ga0501035_0375442 Ga0501035_0375442_870_1160 95
520 3300049822 Ga0501035_0419257 Ga0501035_0419257_750_1040 95
521 3300049823 Ga0501044_0236090 Ga0501044_0236090_197_487 95
522 3300049823 Ga0501044_0368639 Ga0501044_0368639_618_908 95
523 3300050489 nmdc:mga03683_391191_c1 nmdc:mga03683_391191_c1_156_449 95
524 3300050491 nmdc:mga00v17_869102_c1 nmdc:mga00v17_869102_c1_43_336 95
525 3300050492 nmdc:mga0yw44_1155030_c1 nmdc:mga0yw44_1155030_c1_91_387 95
526 3300050493 nmdc:mga0k408_37820_c1 nmdc:mga0k408_37820_c1_2190_2480 95
527 3300050493 nmdc:mga0k408_532821_c1 nmdc:mga0k408_532821_c1_169_465 95
528 3300050494 nmdc:mga06z11_112459_c1 nmdc:mga06z11_112459_c1_1168_1461 95
529 3300050494 nmdc:mga06z11_233087_c1 nmdc:mga06z11_233087_c1_736_1032 95
530 3300050496 nmdc:mga07m45_194823_c1 nmdc:mga07m45_194823_c1_489_782 95
531 3300050496 nmdc:mga07m45_422834_c1 nmdc:mga07m45_422834_c1_352_648 95
532 3300050496 nmdc:mga07m45_707_c1 nmdc:mga07m45_707_c1_2425_2715 95
533 3300050516 nmdc:mga0sz30_267673_c1 nmdc:mga0sz30_267673_c1_430_720 95
534 3300053079 Ga0500610_0001011 Ga0500610_0001011_7677_7967 95
535 3300053079 Ga0500610_0029286 Ga0500610_0029286_1207_1503 95
536 3300053083 Ga0495655_0376724 Ga0495655_0376724_44_340 95
537 3300053087 Ga0500643_034023 Ga0500643_034023_800_1090 95
538 3300053091 Ga0500647_0262801 Ga0500647_0262801_177_467 95
539 3300053104 Ga0500556_0355597 Ga0500556_0355597_203_547 95
540 3300053119 Ga0500595_002233 Ga0500595_002233_6389_6679 95
541 3300053121 Ga0500607_138633 Ga0500607_138633_331_621 95
542 3300053130 Ga0500642_0013301 Ga0500642_0013301_1824_2114 95
543 3300053136 Ga0500559_0150435 Ga0500559_0150435_592_882 95
544 3300053144 Ga0500585_068753 Ga0500585_068753_210_500 95
545 3300053151 Ga0500604_0090993 Ga0500604_0090993_343_693 95
546 3300053155 Ga0500620_005796 Ga0500620_005796_73_423 95
547 3300053155 Ga0500620_066264 Ga0500620_066264_535_831 95
548 3300053158 Ga0500627_0122869 Ga0500627_0122869_256_552 95
549 3300053158 Ga0500627_0479356 Ga0500627_0479356_147_437 95
550 3300053177 Ga0500636_0001455 Ga0500636_0001455_3819_4115 95
551 3300053730 Ga0500645_000231 Ga0500645_000231_29488_29778 95
552 3300053730 Ga0500645_009201 Ga0500645_009201_2776_3069 95
553 3300053731 Ga0500609_002966 Ga0500609_002966_1957_2247 95
554 3300053735 Ga0500596_000253 Ga0500596_000253_5371_5661 95
555 3300054114 Ga0501084_1859532 Ga0501084_1859532_170_460 95
556 3300055283 Ga0500661_023165 Ga0500661_023165_470_760 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

22

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9715 3 94
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9655 1 94
1dco-assembly1.cif.gz_D dcoh, a bifunctional protein-binding transcriptional coactivator 0.9567 5 94
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9519 1 94
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9518 1 94
ID Description Score Start End Superfamily
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9748 4 95 3.30.1360.20
af_Q54RY8_2_96_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9635 1 94 3.30.1360.20
af_Q4DG70_107_224_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9555 27 93 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9482 4 94 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9417 4 94 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A1W9HF79-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.004 1 94 GO:0006729
GO:0008124
AF-A0A426RTU1-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.004 2 94 GO:0006729
GO:0008124
AF-A0A222WVS3-F1-model_v4 deleted 1.001 1 95
AF-A0A1B3N0Z4-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1 1 95 GO:0006729
GO:0008124
AF-A0A258H569-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9981 1 94 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
96.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map