F463257

General Info

Members Datasets Scaffolds Average Seq Length
556 326 555 118

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0040346|Ga0501073_0040346_171_605
Length 144
Sequence LPNIHACIGADRGVAIRFTQLYEDAMTYVDGFVVPVPKKKLKAYYAMAKTASKVWRDHGAVEYLECVADDVKKGKWTSFPRSVKLKAAETVIFAYIVYKSRKDRDRVLKAVMKDKRLAAMMDPKKMPFDARRMIYGGFKAVVKA

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
299 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
303 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
304 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
307 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
315 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
316 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
317 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.45
Nodule 0.18
Rhizoplane 3.24
Rhizosphere 75.54
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10079763 3300002075 Bacteria 684
2 JGI24742J22300_10010176 3300002244 Bacteria 1555
3 JGI25406J46586_10001293 3300003203 Bacteria 11776
4 Ga0065704_10285897 3300005289 Bacteria 913
5 Ga0065715_10199080 3300005293 Bacteria 1371
6 Ga0065707_10372585 3300005295 Bacteria 888
7 Ga0065707_10630501 3300005295 Bacteria 674
8 Ga0070658_10026704 3300005327 Bacteria 4634
9 Ga0070676_10044304 3300005328 Bacteria 2589
10 Ga0070676_10048407 3300005328 Bacteria 2485
11 Ga0070676_10181155 3300005328 Bacteria 1370
12 Ga0070690_100087579 3300005330 Bacteria 2045
13 Ga0070690_100156573 3300005330 Bacteria 1558
14 Ga0070670_100004813 3300005331 Bacteria 11336
15 Ga0070670_100040299 3300005331 Bacteria 4017
16 Ga0070670_100744677 3300005331 Bacteria 883
17 Ga0070677_10006580 3300005333 Bacteria 3862
18 Ga0068869_100146345 3300005334 Bacteria 1829
19 Ga0068869_100415375 3300005334 Bacteria 1109
20 Ga0070666_10215893 3300005335 Bacteria 1352
21 Ga0070680_100133393 3300005336 Bacteria 2079
22 Ga0070682_100498682 3300005337 Bacteria 943
23 Ga0070682_100695417 3300005337 Bacteria 815
24 Ga0068868_100161991 3300005338 Bacteria 1848
25 Ga0068868_100602253 3300005338 Bacteria 974
26 Ga0068868_101349763 3300005338 Bacteria 664
27 Ga0070660_100216289 3300005339 Bacteria 1557
28 Ga0070660_100673398 3300005339 Bacteria 867
29 Ga0070660_101301510 3300005339 Bacteria 617
30 Ga0070689_100132559 3300005340 Bacteria 1999
31 Ga0070689_100479077 3300005340 Bacteria 1063
32 Ga0070689_101298603 3300005340 Bacteria 655
33 Ga0070689_101980734 3300005340 Bacteria 532
34 Ga0070687_100363521 3300005343 Bacteria 938
35 Ga0070661_100249070 3300005344 Bacteria 1370
36 Ga0070661_101191285 3300005344 Bacteria 637
37 Ga0070692_10853791 3300005345 Bacteria 626
38 Ga0070668_100018714 3300005347 Bacteria 5201
39 Ga0070668_100321066 3300005347 Bacteria 1304
40 Ga0070669_100249621 3300005353 Bacteria 1412
41 Ga0070669_100280047 3300005353 Bacteria 1336
42 Ga0070669_100675155 3300005353 Bacteria 871
43 Ga0070675_100096376 3300005354 Bacteria 2485
44 Ga0070675_100205283 3300005354 Bacteria 1711
45 Ga0070671_100014163 3300005355 Bacteria 6439
46 Ga0070671_100046211 3300005355 Bacteria 3621
47 Ga0070671_100524177 3300005355 Bacteria 1020
48 Ga0070671_100796873 3300005355 Bacteria 822
49 Ga0070674_100037254 3300005356 Bacteria 3270
50 Ga0070674_100188498 3300005356 Bacteria 1585
51 Ga0070674_100295357 3300005356 Bacteria 1290
52 Ga0070674_100317957 3300005356 Bacteria 1247
53 Ga0070674_100642367 3300005356 Bacteria 901
54 Ga0070673_100019735 3300005364 Bacteria 4845
55 Ga0070673_100104198 3300005364 Bacteria 2342
56 Ga0070673_100229692 3300005364 Bacteria 1609
57 Ga0070688_100020065 3300005365 Bacteria 3881
58 Ga0070688_100022928 3300005365 Bacteria 3665
59 Ga0070659_100739425 3300005366 Bacteria 853
60 Ga0070659_101580875 3300005366 Bacteria 585
61 Ga0070667_100193896 3300005367 Bacteria 1801
62 Ga0070667_100286722 3300005367 Bacteria 1480
63 Ga0070701_10107477 3300005438 Bacteria 1554
64 Ga0070701_10227590 3300005438 Bacteria 1115
65 Ga0070700_100365427 3300005441 Bacteria 1074
66 Ga0070700_100541055 3300005441 Bacteria 903
67 Ga0070708_100168325 3300005445 Bacteria 2045
68 Ga0070663_100063389 3300005455 Bacteria 2669
69 Ga0070663_100486514 3300005455 Bacteria 1022
70 Ga0070678_100076855 3300005456 Bacteria 2517
71 Ga0070678_100231485 3300005456 Bacteria 1541
72 Ga0070662_100162997 3300005457 Bacteria 1745
73 Ga0068867_100063416 3300005459 Bacteria 2746
74 Ga0068867_100229962 3300005459 Bacteria 1499
75 Ga0070685_10045269 3300005466 Bacteria 2523
76 Ga0070685_10315486 3300005466 Bacteria 1058
77 Ga0070685_10332225 3300005466 Bacteria 1034
78 Ga0070707_100378842 3300005468 Bacteria 1374
79 Ga0070698_100289629 3300005471 Bacteria 1569
80 Ga0070699_100318381 3300005518 Bacteria 1398
81 Ga0068853_100001086 3300005539 Bacteria 19242
82 Ga0068853_100542210 3300005539 Bacteria 1101
83 Ga0068853_100766640 3300005539 Bacteria 923
84 Ga0070672_100040734 3300005543 Bacteria 3566
85 Ga0070672_100110945 3300005543 Bacteria 2235
86 Ga0070672_100158395 3300005543 Bacteria 1877
87 Ga0070672_100692745 3300005543 Bacteria 892
88 Ga0070686_100006631 3300005544 Bacteria 6444
89 Ga0070695_101017095 3300005545 Bacteria 675
90 Ga0070693_100083992 3300005547 Bacteria 1904
91 Ga0070693_100646475 3300005547 Bacteria 769
92 Ga0070665_100288753 3300005548 Bacteria 1643
93 Ga0070665_100547656 3300005548 Bacteria 1169
94 Ga0070704_101102753 3300005549 Bacteria 721
95 Ga0068855_100058405 3300005563 Bacteria 4518
96 Ga0070664_100525004 3300005564 Bacteria 1093
97 Ga0070664_101238848 3300005564 Bacteria 704
98 Ga0070664_101348717 3300005564 Bacteria 674
99 Ga0068857_100275168 3300005577 Bacteria 1548
100 Ga0068857_100526388 3300005577 Bacteria 1112
101 Ga0068857_100816610 3300005577 Bacteria 891
102 Ga0068854_100509521 3300005578 Bacteria 1015
103 Ga0068854_100551653 3300005578 Bacteria 977
104 Ga0070702_100038593 3300005615 Bacteria 2661
105 Ga0070702_100093099 3300005615 Bacteria 1832
106 Ga0070702_100406950 3300005615 Bacteria 975
107 Ga0068852_100099423 3300005616 Bacteria 2622
108 Ga0068852_102096782 3300005616 Bacteria 587
109 Ga0068852_102590209 3300005616 Unclassified 527
110 Ga0068859_100169406 3300005617 Bacteria 2265
111 Ga0068864_100000918 3300005618 Bacteria 24714
112 Ga0068864_100017967 3300005618 Bacteria 5901
113 Ga0068864_100036622 3300005618 Bacteria 4183
114 Ga0068866_10015940 3300005718 Bacteria 3349
115 Ga0068866_10186634 3300005718 Bacteria 1229
116 Ga0068861_100679586 3300005719 Bacteria 954
117 Ga0068851_10260087 3300005834 Bacteria 987
118 Ga0068851_10457987 3300005834 Bacteria 759
119 Ga0068870_10867494 3300005840 Bacteria 635
120 Ga0068863_100003461 3300005841 Bacteria 15572
121 Ga0068863_100026752 3300005841 Bacteria 5501
122 Ga0068863_100205838 3300005841 Bacteria 1894
123 Ga0068858_100226117 3300005842 Bacteria 1773
124 Ga0068858_100913875 3300005842 Bacteria 858
125 Ga0068860_100023855 3300005843 Bacteria 5914
126 Ga0068860_100065274 3300005843 Bacteria 3457
127 Ga0068860_100392350 3300005843 Bacteria 1372
128 Ga0068862_100195625 3300005844 Bacteria 1821
129 Ga0068862_101275955 3300005844 Bacteria 735
130 Ga0068862_102439150 3300005844 Bacteria 535
131 Ga0081539_10000016 3300005985 Bacteria 381648
132 Ga0081539_10179255 3300005985 Bacteria 995
133 Ga0081539_10256131 3300005985 Bacteria 775
134 Ga0075365_10055881 3300006038 Bacteria 2623
135 Ga0075365_10247229 3300006038 Bacteria 1253
136 Ga0075365_10545795 3300006038 Bacteria 820
137 Ga0075365_10973531 3300006038 Bacteria 598
138 Ga0075365_11032486 3300006038 Bacteria 579
139 Ga0075368_10006328 3300006042 Bacteria 4130
140 Ga0075368_10012958 3300006042 Bacteria 3056
141 Ga0075363_100001611 3300006048 Bacteria 8694
142 Ga0075363_100043677 3300006048 Bacteria 2372
143 Ga0075363_100588424 3300006048 Bacteria 666
144 Ga0075364_10072514 3300006051 Bacteria 2269
145 Ga0075364_10157188 3300006051 Bacteria 1534
146 Ga0075364_11022925 3300006051 Bacteria 561
147 Ga0075362_10158700 3300006177 Bacteria 1088
148 Ga0075362_10162288 3300006177 Bacteria 1076
149 Ga0075362_10402315 3300006177 Bacteria 690
150 Ga0075367_10005985 3300006178 Bacteria 6109
151 Ga0075367_10047413 3300006178 Bacteria 2527
152 Ga0075367_10220457 3300006178 Bacteria 1187
153 Ga0075367_10386795 3300006178 Bacteria 884
154 Ga0075369_10047323 3300006186 Bacteria 1854
155 Ga0075369_10340664 3300006186 Bacteria 703
156 Ga0075366_10009517 3300006195 Bacteria 5425
157 Ga0075366_10027157 3300006195 Bacteria 3358
158 Ga0075366_10132422 3300006195 Bacteria 1505
159 Ga0075366_10775074 3300006195 Bacteria 596
160 Ga0097621_100114636 3300006237 Bacteria 2280
161 Ga0097621_100923523 3300006237 Bacteria 814
162 Ga0075370_10052249 3300006353 Bacteria 2318
163 Ga0075370_10085555 3300006353 Bacteria 1815
164 Ga0068871_100291569 3300006358 Bacteria 1430
165 Ga0068871_100530920 3300006358 Bacteria 1064
166 Ga0068871_100675136 3300006358 Bacteria 945
167 Ga0075428_100057924 3300006844 Bacteria 4242
168 Ga0075428_100124215 3300006844 Bacteria 2809
169 Ga0075431_100991483 3300006847 Bacteria 807
170 Ga0075431_101981159 3300006847 Bacteria 538
171 Ga0075433_10638400 3300006852 Bacteria 934
172 Ga0075434_101351577 3300006871 Bacteria 723
173 Ga0068865_100127010 3300006881 Bacteria 1905
174 Ga0097620_100169410 3300006931 Bacteria 2265
175 Ga0105251_10198545 3300009011 Bacteria 904
176 Ga0105244_10186777 3300009036 Bacteria 981
177 Ga0105240_11292208 3300009093 Bacteria 770
178 Ga0111539_10002972 3300009094 Bacteria 22492
179 Ga0111539_10085412 3300009094 Bacteria 3709
180 Ga0105245_10083658 3300009098 Bacteria 2921
181 Ga0105245_10573752 3300009098 Bacteria 1152
182 Ga0105245_10627849 3300009098 Bacteria 1103
183 Ga0114129_10069655 3300009147 Bacteria 4903
184 Ga0114129_11671415 3300009147 Bacteria 778
185 Ga0114129_11945208 3300009147 Bacteria 712
186 Ga0105243_10071650 3300009148 Bacteria 2803
187 Ga0105243_11008717 3300009148 Bacteria 835
188 Ga0105242_10077074 3300009176 Bacteria 2781
189 Ga0105242_10384139 3300009176 Bacteria 1306
190 Ga0105248_10907257 3300009177 Bacteria 995
191 Ga0105237_10574065 3300009545 Bacteria 1135
192 Ga0105237_12002827 3300009545 Bacteria 588
193 Ga0105237_12404702 3300009545 Bacteria 537
194 Ga0105238_10098403 3300009551 Bacteria 2909
195 Ga0105238_10292580 3300009551 Bacteria 1611
196 Ga0105249_12828147 3300009553 Bacteria 557
197 Ga0105239_10001596 3300010375 Bacteria 29953
198 Ga0105246_10663587 3300011119 Bacteria 909
199 Ga0105246_11630428 3300011119 Bacteria 611
200 Ga0157373_11052053 3300013100 Bacteria 609
201 Ga0157370_10236344 3300013104 Bacteria 1691
202 Ga0157374_10163667 3300013296 Bacteria 2168
203 Ga0157374_10459365 3300013296 Bacteria 1275
204 Ga0157378_10037250 3300013297 Bacteria 4307
205 Ga0157378_10279361 3300013297 Bacteria 1609
206 Ga0157378_11561244 3300013297 Bacteria 705
207 Ga0163162_10267727 3300013306 Bacteria 1840
208 Ga0163162_12289282 3300013306 Bacteria 621
209 Ga0157372_11887182 3300013307 Bacteria 687
210 Ga0157375_10008063 3300013308 Bacteria 9212
211 Ga0157375_10476771 3300013308 Bacteria 1413
212 Ga0157375_11294700 3300013308 Bacteria 857
213 Ga0163163_10009374 3300014325 Bacteria 8738
214 Ga0157380_10015122 3300014326 Bacteria 5663
215 Ga0157380_10030880 3300014326 Bacteria 4108
216 Ga0157380_10043587 3300014326 Bacteria 3513
217 Ga0157380_10733126 3300014326 Bacteria 997
218 Ga0157380_10953154 3300014326 Bacteria 888
219 Ga0157380_11510873 3300014326 Bacteria 725
220 Ga0182008_10259906 3300014497 Bacteria 898
221 Ga0157377_10539219 3300014745 Bacteria 822
222 Ga0157379_10677138 3300014968 Bacteria 967
223 Ga0157379_10738657 3300014968 Bacteria 926
224 Ga0157376_10111683 3300014969 Bacteria 2407
225 Ga0157376_10499007 3300014969 Bacteria 1196
226 Ga0163161_10036021 3300017792 Bacteria 3543
227 Ga0209758_1109977 3300025297 Bacteria 765
228 Ga0209051_1010188 3300025303 Bacteria 4779
229 Ga0207697_10191464 3300025315 Bacteria 898
230 Ga0207713_1150458 3300025735 Bacteria 752
231 Ga0207682_10002754 3300025893 Bacteria 7790
232 Ga0207642_10171105 3300025899 Bacteria 1175
233 Ga0207642_10254815 3300025899 Bacteria 998
234 Ga0207688_10023072 3300025901 Bacteria 3405
235 Ga0207680_10035202 3300025903 Bacteria 2873
236 Ga0207680_10178084 3300025903 Bacteria 1436
237 Ga0207647_10231907 3300025904 Bacteria 1062
238 Ga0207645_10036795 3300025907 Bacteria 3143
239 Ga0207645_10051463 3300025907 Bacteria 2632
240 Ga0207645_10215930 3300025907 Bacteria 1264
241 Ga0207705_10204036 3300025909 Bacteria 1498
242 Ga0207684_10502318 3300025910 Bacteria 1039
243 Ga0207707_10324035 3300025912 Bacteria 1330
244 Ga0207695_10838752 3300025913 Bacteria 799
245 Ga0207671_10819000 3300025914 Bacteria 738
246 Ga0207671_10922295 3300025914 Bacteria 690
247 Ga0207660_11500792 3300025917 Bacteria 545
248 Ga0207662_10580603 3300025918 Bacteria 778
249 Ga0207657_11073102 3300025919 Bacteria 616
250 Ga0207649_10840701 3300025920 Bacteria 718
251 Ga0207646_10204575 3300025922 Bacteria 1783
252 Ga0207681_10166398 3300025923 Bacteria 1667
253 Ga0207681_10171414 3300025923 Bacteria 1645
254 Ga0207681_10266563 3300025923 Bacteria 1343
255 Ga0207681_10470026 3300025923 Bacteria 1026
256 Ga0207694_10847515 3300025924 Bacteria 772
257 Ga0207650_10013430 3300025925 Bacteria 5671
258 Ga0207650_10179524 3300025925 Bacteria 1686
259 Ga0207650_10322089 3300025925 Bacteria 1266
260 Ga0207650_10496885 3300025925 Bacteria 1019
261 Ga0207650_10760609 3300025925 Bacteria 820
262 Ga0207650_11050412 3300025925 Bacteria 693
263 Ga0207659_10129563 3300025926 Bacteria 1945
264 Ga0207659_10140371 3300025926 Bacteria 1875
265 Ga0207659_10193583 3300025926 Bacteria 1619
266 Ga0207659_10223961 3300025926 Bacteria 1514
267 Ga0207687_10585521 3300025927 Bacteria 939
268 Ga0207687_11298813 3300025927 Bacteria 625
269 Ga0207644_10099704 3300025931 Bacteria 2180
270 Ga0207644_10355588 3300025931 Bacteria 1190
271 Ga0207644_10399593 3300025931 Bacteria 1123
272 Ga0207706_10569441 3300025933 Bacteria 974
273 Ga0207706_11019283 3300025933 Bacteria 695
274 Ga0207686_10038004 3300025934 Bacteria 2909
275 Ga0207709_10132657 3300025935 Bacteria 1700
276 Ga0207709_11821730 3300025935 Bacteria 506
277 Ga0207670_10095211 3300025936 Bacteria 2114
278 Ga0207670_10152529 3300025936 Bacteria 1716
279 Ga0207670_11053729 3300025936 Bacteria 685
280 Ga0207669_10005673 3300025937 Bacteria 5629
281 Ga0207669_10044928 3300025937 Bacteria 2600
282 Ga0207669_10244959 3300025937 Bacteria 1331
283 Ga0207669_10259906 3300025937 Bacteria 1298
284 Ga0207669_11170304 3300025937 Bacteria 651
285 Ga0207704_10185410 3300025938 Bacteria 1508
286 Ga0207704_10198871 3300025938 Unclassified 1465
287 Ga0207691_10003897 3300025940 Bacteria 14494
288 Ga0207691_10052634 3300025940 Bacteria 3719
289 Ga0207691_10053251 3300025940 Bacteria 3695
290 Ga0207691_10775875 3300025940 Bacteria 806
291 Ga0207689_10446042 3300025942 Bacteria 1081
292 Ga0207689_10493386 3300025942 Bacteria 1026
293 Ga0207679_10742132 3300025945 Bacteria 893
294 Ga0207679_11032146 3300025945 Bacteria 754
295 Ga0207667_10042319 3300025949 Bacteria 4842
296 Ga0207651_10014774 3300025960 Bacteria 4519
297 Ga0207651_10442664 3300025960 Bacteria 1113
298 Ga0207651_10514704 3300025960 Bacteria 1036
299 Ga0207712_11599869 3300025961 Bacteria 584
300 Ga0207668_10022618 3300025972 Bacteria 4028
301 Ga0207668_10152216 3300025972 Bacteria 1792
302 Ga0207668_11291666 3300025972 Bacteria 657
303 Ga0207668_11492294 3300025972 Bacteria 610
304 Ga0207640_10137351 3300025981 Bacteria 1777
305 Ga0207640_10986611 3300025981 Bacteria 740
306 Ga0207658_10046785 3300025986 Bacteria 3162
307 Ga0207658_10465610 3300025986 Bacteria 1121
308 Ga0207677_10270798 3300026023 Bacteria 1389
309 Ga0207677_10306002 3300026023 Bacteria 1315
310 Ga0207677_11729460 3300026023 Bacteria 580
311 Ga0207703_10200616 3300026035 Bacteria 1773
312 Ga0207703_10582819 3300026035 Bacteria 1057
313 Ga0207639_10014582 3300026041 Bacteria 5534
314 Ga0207639_10347166 3300026041 Bacteria 1324
315 Ga0207639_10888405 3300026041 Bacteria 833
316 Ga0207678_10012948 3300026067 Bacteria 7318
317 Ga0207678_10049096 3300026067 Bacteria 3646
318 Ga0207678_10056858 3300026067 Bacteria 3367
319 Ga0207708_10239026 3300026075 Bacteria 1460
320 Ga0207708_10928107 3300026075 Bacteria 754
321 Ga0207702_10341886 3300026078 Bacteria 1430
322 Ga0207641_10012818 3300026088 Bacteria 6873
323 Ga0207641_12038012 3300026088 Bacteria 575
324 Ga0207648_10006450 3300026089 Bacteria 11658
325 Ga0207648_10028927 3300026089 Bacteria 4912
326 Ga0207676_10095978 3300026095 Bacteria 2446
327 Ga0207676_10099678 3300026095 Bacteria 2405
328 Ga0207676_10459847 3300026095 Bacteria 1201
329 Ga0207674_10018067 3300026116 Bacteria 7679
330 Ga0207675_100432838 3300026118 Bacteria 1301
331 Ga0207683_10005312 3300026121 Bacteria 11046
332 Ga0207683_10673825 3300026121 Bacteria 958
333 Ga0207698_10254466 3300026142 Bacteria 1609
334 Ga0207698_10934651 3300026142 Unclassified 876
335 Ga0209813_10001883 3300027866 Bacteria 4732
336 Ga0207428_10414396 3300027907 Bacteria 985
337 Ga0268266_10000352 3300028379 Bacteria 71552
338 Ga0268266_10095017 3300028379 Bacteria 2618
339 Ga0268265_11532837 3300028380 Bacteria 670
340 Ga0268264_10047966 3300028381 Bacteria 3552
341 Ga0268264_11354562 3300028381 Bacteria 722
342 Ga0307515_10120642 3300028794 Bacteria 2973
343 Ga0307513_10207643 3300031456 Bacteria 1793
344 Ga0307513_10517354 3300031456 Bacteria 909
345 Ga0307408_101428833 3300031548 Unclassified 652
346 Ga0307412_10152481 3300031911 Bacteria 1707
347 Ga0307412_10369498 3300031911 Bacteria 1158
348 Ga0307409_101551166 3300031995 Bacteria 690
349 Ga0373936_0072512 3300035113 Bacteria 1422
350 Ga0373935_0046316 3300035692 Bacteria 2746
351 Ga0373927_0015494 3300035695 Bacteria 5036
352 Ga0373937_0899291 3300036401 Unclassified 834
353 Ga0373925_0013259 3300037068 Bacteria 5965
354 Ga0451793_0292868 3300041452 Bacteria 543
355 Ga0451802_1833640 3300041460 Bacteria 698
356 Ga0451807_1501387 3300041486 Bacteria 793
357 Ga0451807_2660561 3300041486 Bacteria 1588
358 Ga0451849_0759547 3300041505 Bacteria 584
359 Ga0451849_1258175 3300041505 Unclassified 541
360 Ga0451853_0153484 3300041512 Bacteria 667
361 Ga0451853_1674364 3300041512 Bacteria 1230
362 Ga0451853_3100653 3300041512 Bacteria 776
363 Ga0466972_0315410 3300044658 Bacteria 730
364 Ga0466960_0096566 3300044901 Bacteria 1515
365 Ga0466959_0044576 3300045049 Bacteria 3268
366 Ga0495590_0108005 3300046457 Bacteria 992
367 Ga0495629_0255304 3300046459 Bacteria 1206
368 Ga0495638_0006892 3300046460 Bacteria 8203
369 Ga0495638_0033865 3300046460 Bacteria 3263
370 Ga0495638_0052013 3300046460 Bacteria 2553
371 Ga0495650_0114870 3300046471 Bacteria 996
372 Ga0495650_0256485 3300046471 Bacteria 593
373 Ga0495605_0136715 3300046474 Bacteria 1102
374 Ga0495585_0113374 3300046492 Bacteria 1440
375 Ga0495607_0064480 3300046501 Bacteria 2069
376 Ga0495606_0093431 3300046507 Bacteria 1845
377 Ga0495610_0028346 3300046512 Bacteria 2962
378 Ga0495616_0108849 3300046513 Bacteria 1289
379 Ga0495620_0132100 3300046515 Bacteria 979
380 Ga0495631_0024970 3300046518 Bacteria 2755
381 Ga0495632_0157249 3300046519 Bacteria 1048
382 Ga0495637_0021275 3300046520 Bacteria 2976
383 Ga0495643_0042175 3300046522 Bacteria 2486
384 Ga0495648_0025488 3300046524 Bacteria 4002
385 Ga0495663_0363010 3300046525 Bacteria 529
386 Ga0495654_0028398 3300046530 Bacteria 2861
387 Ga0495598_0098349 3300046537 Bacteria 964
388 Ga0495609_0089867 3300046538 Bacteria 1336
389 Ga0495621_0005678 3300046539 Bacteria 3602
390 Ga0495597_0127938 3300046542 Bacteria 1055
391 Ga0495656_0166304 3300046615 Bacteria 1075
392 Ga0495668_0079394 3300046616 Bacteria 1801
393 Ga0495625_0701491 3300046660 Bacteria 598
394 Ga0495661_0049107 3300046665 Bacteria 2560
395 Ga0495661_0296006 3300046665 Bacteria 811
396 Ga0495588_0031460 3300046674 Bacteria 2671
397 Ga0495670_0033565 3300046691 Bacteria 2553
398 Ga0495671_0049346 3300046692 Bacteria 2098
399 Ga0495589_0173429 3300046794 Bacteria 1025
400 Ga0495660_0064470 3300046810 Bacteria 1958
401 Ga0495604_0977059 3300047317 Bacteria 525
402 Ga0495677_0069821 3300047445 Bacteria 1309
403 Ga0495685_030146 3300047447 Bacteria 1866
404 Ga0495681_0079787 3300047470 Bacteria 1463
405 Ga0495686_0027654 3300047472 Bacteria 3701
406 Ga0495626_0067619 3300048091 Bacteria 1613
407 Ga0496100_0830310 3300048903 Bacteria 724
408 Ga0496102_0479835 3300048905 Bacteria 1165
409 Ga0496104_1538005 3300048907 Bacteria 568
410 Ga0496106_0245838 3300048909 Bacteria 1430
411 Ga0496106_1533602 3300048909 Bacteria 512
412 Ga0496108_0348297 3300048911 Bacteria 1293
413 Ga0496110_0737495 3300048913 Bacteria 888
414 Ga0496111_0510903 3300048914 Bacteria 884
415 Ga0496112_0129869 3300048915 Bacteria 2491
416 Ga0496113_0354080 3300048916 Bacteria 1178
417 Ga0496113_1040619 3300048916 Bacteria 644
418 Ga0496113_1122689 3300048916 Bacteria 616
419 Ga0496114_0902141 3300048917 Bacteria 765
420 Ga0496115_0934660 3300048918 Bacteria 667
421 Ga0496117_0056542 3300048920 Bacteria 2731
422 Ga0496118_0001109 3300048921 Bacteria 41808
423 Ga0496118_0182014 3300048921 Bacteria 1268
424 Ga0496119_0150376 3300048922 Bacteria 1248
425 Ga0496119_0182816 3300048922 Bacteria 1098
426 Ga0496120_0023177 3300048923 Bacteria 3890
427 Ga0496121_0044674 3300048924 Bacteria 3817
428 Ga0496122_0144029 3300048925 Bacteria 1485
429 Ga0496123_0045094 3300048926 Bacteria 3007
430 Ga0496124_0399737 3300048927 Bacteria 954
431 Ga0496125_0004101 3300048928 Bacteria 17031
432 Ga0496126_1159357 3300048929 Bacteria 570
433 Ga0501031_0004379 3300049568 Bacteria 9146
434 Ga0501032_0008869 3300049569 Bacteria 7312
435 Ga0501032_0778965 3300049569 Bacteria 604
436 Ga0501033_0000200 3300049570 Bacteria 57307
437 Ga0501033_0001644 3300049570 Bacteria 19591
438 Ga0501034_0006361 3300049571 Bacteria 12720
439 Ga0501036_0048177 3300049572 Bacteria 3608
440 Ga0501037_0000566 3300049573 Bacteria 29217
441 Ga0501038_0000945 3300049574 Bacteria 25936
442 Ga0501040_0464322 3300049576 Bacteria 912
443 Ga0501042_0148863 3300049578 Bacteria 1688
444 Ga0501043_0003348 3300049579 Bacteria 13203
445 Ga0501043_0104302 3300049579 Bacteria 2228
446 Ga0501046_0029297 3300049580 Bacteria 4475
447 Ga0501046_0051265 3300049580 Bacteria 3257
448 Ga0501047_0007649 3300049581 Bacteria 10174
449 Ga0501047_0210030 3300049581 Bacteria 1805
450 Ga0501047_0541133 3300049581 Bacteria 989
451 Ga0501048_0483701 3300049582 Bacteria 887
452 Ga0501067_0082289 3300049583 Bacteria 1785
453 Ga0501067_0665712 3300049583 Bacteria 585
454 Ga0501068_0033124 3300049584 Bacteria 3076
455 Ga0501069_0466290 3300049585 Bacteria 752
456 Ga0501070_0454972 3300049586 Bacteria 1032
457 Ga0501071_1254957 3300049587 Bacteria 572
458 Ga0501072_0270537 3300049588 Bacteria 1352
459 Ga0501073_0003128 3300049589 Bacteria 12403
460 Ga0501073_0040346 3300049589 Bacteria 3304
461 Ga0501073_0062928 3300049589 Bacteria 2588
462 Ga0501073_0082404 3300049589 Bacteria 2238
463 Ga0501073_0519710 3300049589 Bacteria 823
464 Ga0501074_0232740 3300049590 Bacteria 1311
465 Ga0501075_0757798 3300049591 Bacteria 739
466 Ga0501076_0739470 3300049592 Bacteria 812
467 Ga0501079_0114702 3300049741 Bacteria 2094
468 Ga0501080_0021211 3300049742 Bacteria 6012
469 Ga0501080_0097097 3300049742 Bacteria 2736
470 Ga0501080_0169199 3300049742 Bacteria 2016
471 Ga0501080_0358473 3300049742 Bacteria 1316
472 Ga0501080_0396885 3300049742 Bacteria 1241
473 Ga0501081_0685002 3300049743 Bacteria 769
474 Ga0501035_0004394 3300049822 Bacteria 13380
475 Ga0501035_0088135 3300049822 Bacteria 2735
476 Ga0501044_0015290 3300049823 Bacteria 8264
477 Ga0501044_0018437 3300049823 Bacteria 7477
478 Ga0501044_0259771 3300049823 Bacteria 1675
479 Ga0501044_0358801 3300049823 Bacteria 1376
480 nmdc:mga03683_135925_c1 3300050489 Bacteria 1103
481 nmdc:mga03683_166481_c1 3300050489 Bacteria 1000
482 nmdc:mga03683_72547_c1 3300050489 Bacteria 859
483 nmdc:mga03683_99461_c1 3300050489 Bacteria 1277
484 nmdc:mga03n38_11525_c1 3300050490 Bacteria 3297
485 nmdc:mga03n38_228242_c1 3300050490 Bacteria 975
486 nmdc:mga03n38_384_c1 3300050490 Bacteria 6500
487 nmdc:mga00v17_158387_c1 3300050491 Bacteria 1457
488 nmdc:mga00v17_199780_c1 3300050491 Bacteria 1292
489 nmdc:mga0yw44_147266_c1 3300050492 Bacteria 1534
490 nmdc:mga0yw44_184318_c1 3300050492 Bacteria 1375
491 nmdc:mga0yw44_267276_c1 3300050492 Bacteria 1141
492 nmdc:mga0yw44_27688_c1 3300050492 Bacteria 3251
493 nmdc:mga0yw44_48372_c1 3300050492 Bacteria 2564
494 nmdc:mga0k408_688630_c1 3300050493 Bacteria 599
495 nmdc:mga0k408_697879_c1 3300050493 Bacteria 595
496 nmdc:mga06z11_17062_c1 3300050494 Bacteria 3286
497 nmdc:mga04h51_14032_c1 3300050495 Bacteria 2281
498 nmdc:mga04h51_15692_c1 3300050495 Bacteria 2186
499 nmdc:mga07m45_126949_c1 3300050496 Bacteria 1475
500 nmdc:mga07m45_137022_c1 3300050496 Bacteria 1417
501 nmdc:mga07m45_39256_c1 3300050496 Bacteria 2645
502 nmdc:mga05p37_1115446_c1 3300050507 Bacteria 824
503 nmdc:mga05p37_96689_c1 3300050507 Bacteria 3638
504 nmdc:mga06r32_249527_c1 3300050510 Bacteria 1762
505 nmdc:mga08y16_144158_c1 3300050511 Bacteria 2476
506 nmdc:mga08y16_552234_c1 3300050511 Bacteria 1165
507 nmdc:mga08y16_607874_c1 3300050511 Bacteria 1101
508 nmdc:mga0n895_2145012_c1 3300050512 Bacteria 515
509 nmdc:mga0a205_714356_c1 3300050515 Bacteria 852
510 nmdc:mga0sz30_33644_c1 3300050516 Bacteria 1247
511 nmdc:mga0sz30_450723_c1 3300050516 Bacteria 578
512 Ga0500610_0437028 3300053079 Bacteria 518
513 Ga0500578_0245287 3300053086 Bacteria 1081
514 Ga0500643_027031 3300053087 Bacteria 1789
515 Ga0500644_0041965 3300053088 Bacteria 1522
516 Ga0500644_0314341 3300053088 Bacteria 672
517 Ga0500581_162047 3300053089 Bacteria 1037
518 Ga0500646_0088706 3300053090 Bacteria 954
519 Ga0500646_0179243 3300053090 Bacteria 717
520 Ga0500583_0524954 3300053092 Bacteria 553
521 Ga0500651_0075990 3300053093 Bacteria 2086
522 Ga0500566_0000748 3300053094 Bacteria 18276
523 Ga0500641_0009093 3300053096 Bacteria 3563
524 Ga0500641_0010726 3300053096 Bacteria 3318
525 Ga0500641_0130267 3300053096 Bacteria 1085
526 Ga0500650_0022536 3300053098 Bacteria 2788
527 Ga0500554_135733 3300053102 Bacteria 831
528 Ga0500556_0000051 3300053104 Bacteria 119031
529 Ga0500562_021545 3300053108 Bacteria 1677
530 Ga0500569_064470 3300053109 Bacteria 1138
531 Ga0500592_011519 3300053116 Bacteria 1414
532 Ga0500593_079511 3300053117 Bacteria 1408
533 Ga0500594_0007599 3300053118 Bacteria 2454
534 Ga0500595_019433 3300053119 Bacteria 2465
535 Ga0500608_003839 3300053122 Bacteria 5722
536 Ga0500642_0000041 3300053130 Bacteria 89564
537 Ga0500652_000015 3300053131 Bacteria 131012
538 Ga0500658_0159505 3300053134 Bacteria 1020
539 Ga0500559_0000188 3300053136 Bacteria 49358
540 Ga0500564_164527 3300053138 Bacteria 937
541 Ga0500568_0154255 3300053139 Bacteria 849
542 Ga0500588_0029782 3300053146 Bacteria 1560
543 Ga0500588_0243784 3300053146 Bacteria 674
544 Ga0500604_0008743 3300053151 Bacteria 2690
545 Ga0500604_0162957 3300053151 Bacteria 760
546 Ga0500616_0000150 3300053153 Bacteria 117918
547 Ga0500619_081608 3300053154 Bacteria 1086
548 Ga0500622_0009784 3300053156 Bacteria 5292
549 Ga0500627_0051387 3300053158 Bacteria 1797
550 Ga0500633_0036255 3300053160 Bacteria 1629
551 Ga0500636_0031063 3300053177 Bacteria 3161
552 Ga0500611_014010 3300053727 Bacteria 1390
553 Ga0500645_019029 3300053730 Bacteria 2139
554 Ga0501084_1089379 3300054114 Bacteria 671
555 Ga0501082_0661886 3300060353 Bacteria 914

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10502318 Ga0207684_105023182 105
2 3300002244 JGI24742J22300_10010176 JGI24742J22300_100101762 110
3 3300005293 Ga0065715_10199080 Ga0065715_101990802 110
4 3300005328 Ga0070676_10044304 Ga0070676_100443042 110
5 3300005330 Ga0070690_100087579 Ga0070690_1000875794 110
6 3300005333 Ga0070677_10006580 Ga0070677_100065805 110
7 3300005335 Ga0070666_10215893 Ga0070666_102158932 110
8 3300005338 Ga0068868_100602253 Ga0068868_1006022532 110
9 3300005339 Ga0070660_100673398 Ga0070660_1006733982 110
10 3300005343 Ga0070687_100363521 Ga0070687_1003635212 110
11 3300005353 Ga0070669_100249621 Ga0070669_1002496212 110
12 3300005354 Ga0070675_100096376 Ga0070675_1000963762 110
13 3300005355 Ga0070671_100046211 Ga0070671_1000462113 110
14 3300005356 Ga0070674_100037254 Ga0070674_1000372542 110
15 3300005364 Ga0070673_100229692 Ga0070673_1002296923 110
16 3300005365 Ga0070688_100022928 Ga0070688_1000229284 110
17 3300005367 Ga0070667_100193896 Ga0070667_1001938963 110
18 3300005438 Ga0070701_10107477 Ga0070701_101074772 110
19 3300005456 Ga0070678_100076855 Ga0070678_1000768552 110
20 3300005457 Ga0070662_100162997 Ga0070662_1001629973 110
21 3300005459 Ga0068867_100063416 Ga0068867_1000634164 110
22 3300005466 Ga0070685_10045269 Ga0070685_100452692 110
23 3300005543 Ga0070672_100110945 Ga0070672_1001109452 110
24 3300005544 Ga0070686_100006631 Ga0070686_1000066314 110
25 3300005548 Ga0070665_100288753 Ga0070665_1002887532 110
26 3300005564 Ga0070664_101348717 Ga0070664_1013487172 110
27 3300005615 Ga0070702_100093099 Ga0070702_1000930993 110
28 3300005718 Ga0068866_10015940 Ga0068866_100159402 110
29 3300005843 Ga0068860_100392350 Ga0068860_1003923502 110
30 3300006237 Ga0097621_100114636 Ga0097621_1001146363 110
31 3300006358 Ga0068871_100291569 Ga0068871_1002915692 110
32 3300006881 Ga0068865_100127010 Ga0068865_1001270102 110
33 3300009094 Ga0111539_10085412 Ga0111539_100854122 110
34 3300009148 Ga0105243_11008717 Ga0105243_110087172 110
35 3300009176 Ga0105242_10384139 Ga0105242_103841392 110
36 3300011119 Ga0105246_11630428 Ga0105246_116304282 110
37 3300013296 Ga0157374_10163667 Ga0157374_101636674 110
38 3300013297 Ga0157378_10037250 Ga0157378_100372504 110
39 3300013306 Ga0163162_12289282 Ga0163162_122892821 110
40 3300013308 Ga0157375_10476771 Ga0157375_104767712 110
41 3300014326 Ga0157380_10030880 Ga0157380_100308802 110
42 3300014969 Ga0157376_10499007 Ga0157376_104990072 110
43 3300025315 Ga0207697_10191464 Ga0207697_101914642 110
44 3300025893 Ga0207682_10002754 Ga0207682_1000275413 110
45 3300025899 Ga0207642_10254815 Ga0207642_102548152 110
46 3300025901 Ga0207688_10023072 Ga0207688_100230724 110
47 3300025903 Ga0207680_10035202 Ga0207680_100352024 110
48 3300025907 Ga0207645_10051463 Ga0207645_100514634 110
49 3300025918 Ga0207662_10580603 Ga0207662_105806032 110
50 3300025923 Ga0207681_10166398 Ga0207681_101663983 110
51 3300025925 Ga0207650_10760609 Ga0207650_107606092 110
52 3300025926 Ga0207659_10140371 Ga0207659_101403712 110
53 3300025933 Ga0207706_10569441 Ga0207706_105694412 110
54 3300025936 Ga0207670_10152529 Ga0207670_101525292 110
55 3300025937 Ga0207669_10005673 Ga0207669_100056736 110
56 3300025938 Ga0207704_10185410 Ga0207704_101854102 110
57 3300025940 Ga0207691_10053251 Ga0207691_100532513 110
58 3300025960 Ga0207651_10442664 Ga0207651_104426642 110
59 3300025961 Ga0207712_11599869 Ga0207712_115998692 110
60 3300025972 Ga0207668_11291666 Ga0207668_112916662 110
61 3300025986 Ga0207658_10046785 Ga0207658_100467852 110
62 3300026023 Ga0207677_11729460 Ga0207677_117294602 110
63 3300026089 Ga0207648_10006450 Ga0207648_100064506 110
64 3300026118 Ga0207675_100432838 Ga0207675_1004328381 110
65 3300026121 Ga0207683_10005312 Ga0207683_100053122 110
66 3300046525 Ga0495663_0363010 Ga0495663_0363010_32_391 110
67 3300046537 Ga0495598_0098349 Ga0495598_0098349_32_391 110
68 3300046539 Ga0495621_0005678 Ga0495621_0005678_2874_3233 110
69 3300046615 Ga0495656_0166304 Ga0495656_0166304_413_772 110
70 3300047447 Ga0495685_030146 Ga0495685_030146_1364_1723 110
71 3300049587 Ga0501071_1254957 Ga0501071_1254957_10_342 110
72 3300050511 nmdc:mga08y16_607874_c1 nmdc:mga08y16_607874_c1_494_853 110
73 3300049743 Ga0501081_0685002 Ga0501081_0685002_23_358 111
74 3300005327 Ga0070658_10026704 Ga0070658_100267042 115
75 3300005337 Ga0070682_100695417 Ga0070682_1006954171 115
76 3300005339 Ga0070660_100216289 Ga0070660_1002162893 115
77 3300005344 Ga0070661_100249070 Ga0070661_1002490702 115
78 3300005366 Ga0070659_100739425 Ga0070659_1007394251 115
79 3300005455 Ga0070663_100063389 Ga0070663_1000633894 115
80 3300005539 Ga0068853_100766640 Ga0068853_1007666401 115
81 3300005547 Ga0070693_100646475 Ga0070693_1006464752 115
82 3300005578 Ga0068854_100551653 Ga0068854_1005516532 115
83 3300005616 Ga0068852_100099423 Ga0068852_1000994234 115
84 3300006038 Ga0075365_10545795 Ga0075365_105457952 115
85 3300009545 Ga0105237_12002827 Ga0105237_120028271 115
86 3300013104 Ga0157370_10236344 Ga0157370_102363444 115
87 3300025909 Ga0207705_10204036 Ga0207705_102040363 115
88 3300025981 Ga0207640_10137351 Ga0207640_101373512 115
89 3300026041 Ga0207639_10347166 Ga0207639_103471662 115
90 3300026067 Ga0207678_10056858 Ga0207678_100568585 115
91 3300026078 Ga0207702_10341886 Ga0207702_103418861 115
92 3300026142 Ga0207698_10254466 Ga0207698_102544661 115
93 3300041460 Ga0451802_1833640 Ga0451802_1833640_288_650 115
94 3300041486 Ga0451807_1501387 Ga0451807_1501387_95_457 115
95 3300047317 Ga0495604_0977059 Ga0495604_0977059_11_373 115
96 3300050492 nmdc:mga0yw44_267276_c1 nmdc:mga0yw44_267276_c1_395_760 115
97 3300050516 nmdc:mga0sz30_33644_c1 nmdc:mga0sz30_33644_c1_147_512 115
98 iso_pu_bacteria 8056681323 8056688030 115
99 3300006195 Ga0075366_10775074 Ga0075366_107750741 116
100 3300050493 nmdc:mga0k408_697879_c1 nmdc:mga0k408_697879_c1_82_432 116
101 3300005445 Ga0070708_100168325 Ga0070708_1001683253 117
102 3300005468 Ga0070707_100378842 Ga0070707_1003788422 117
103 3300005471 Ga0070698_100289629 Ga0070698_1002896292 117
104 3300005518 Ga0070699_100318381 Ga0070699_1003183812 117
105 3300005539 Ga0068853_100001086 Ga0068853_1000010868 117
106 3300005563 Ga0068855_100058405 Ga0068855_1000584052 117
107 3300005577 Ga0068857_100526388 Ga0068857_1005263882 117
108 3300005834 Ga0068851_10260087 Ga0068851_102600871 117
109 3300009545 Ga0105237_10574065 Ga0105237_105740651 117
110 3300009553 Ga0105249_12828147 Ga0105249_128281472 117
111 3300010375 Ga0105239_10001596 Ga0105239_1000159622 117
112 3300013100 Ga0157373_11052053 Ga0157373_110520532 117
113 3300014968 Ga0157379_10738657 Ga0157379_107386572 117
114 3300025303 Ga0209051_1010188 Ga0209051_10101883 117
115 3300025904 Ga0207647_10231907 Ga0207647_102319072 117
116 3300025914 Ga0207671_10819000 Ga0207671_108190001 117
117 3300025922 Ga0207646_10204575 Ga0207646_102045753 117
118 3300025949 Ga0207667_10042319 Ga0207667_100423196 117
119 3300026041 Ga0207639_10014582 Ga0207639_100145826 117
120 3300026116 Ga0207674_10018067 Ga0207674_100180674 117
121 3300031548 Ga0307408_101428833 Ga0307408_1014288332 117
122 3300031911 Ga0307412_10369498 Ga0307412_103694981 117
123 3300041512 Ga0451853_0153484 Ga0451853_0153484_41_445 117
124 3300045049 Ga0466959_0044576 Ga0466959_0044576_1796_2149 117
125 3300048909 Ga0496106_0245838 Ga0496106_0245838_894_1253 117
126 3300048917 Ga0496114_0902141 Ga0496114_0902141_394_753 117
127 3300048921 Ga0496118_0001109 Ga0496118_0001109_26918_27271 117
128 3300049568 Ga0501031_0004379 Ga0501031_0004379_7291_7644 117
129 3300049569 Ga0501032_0008869 Ga0501032_0008869_6390_6743 117
130 3300049570 Ga0501033_0001644 Ga0501033_0001644_7148_7501 117
131 3300049571 Ga0501034_0006361 Ga0501034_0006361_12133_12486 117
132 3300049572 Ga0501036_0048177 Ga0501036_0048177_687_1040 117
133 3300049573 Ga0501037_0000566 Ga0501037_0000566_21794_22147 117
134 3300049574 Ga0501038_0000945 Ga0501038_0000945_13131_13484 117
135 3300049579 Ga0501043_0003348 Ga0501043_0003348_11873_12226 117
136 3300049580 Ga0501046_0029297 Ga0501046_0029297_2920_3273 117
137 3300049581 Ga0501047_0007649 Ga0501047_0007649_5024_5377 117
138 3300049583 Ga0501067_0082289 Ga0501067_0082289_774_1127 117
139 3300049584 Ga0501068_0033124 Ga0501068_0033124_1391_1744 117
140 3300049588 Ga0501072_0270537 Ga0501072_0270537_179_532 117
141 3300049589 Ga0501073_0003128 Ga0501073_0003128_3763_4116 117
142 3300049591 Ga0501075_0757798 Ga0501075_0757798_28_381 117
143 3300049742 Ga0501080_0021211 Ga0501080_0021211_1000_1353 117
144 3300049822 Ga0501035_0004394 Ga0501035_0004394_8049_8402 117
145 3300049823 Ga0501044_0018437 Ga0501044_0018437_4011_4364 117
146 3300054114 Ga0501084_1089379 Ga0501084_1089379_222_575 117
147 3300003203 JGI25406J46586_10001293 JGI25406J46586_100012934 118
148 3300005843 Ga0068860_100065274 Ga0068860_1000652742 118
149 3300005985 Ga0081539_10000016 Ga0081539_1000001610 118
150 3300028381 Ga0268264_10047966 Ga0268264_100479664 118
151 3300035113 Ga0373936_0072512 Ga0373936_0072512_632_988 118
152 3300044658 Ga0466972_0315410 Ga0466972_0315410_322_681 118
153 3300044901 Ga0466960_0096566 Ga0466960_0096566_64_423 118
154 3300049586 Ga0501070_0454972 Ga0501070_0454972_438_794 118
155 3300049589 Ga0501073_0062928 Ga0501073_0062928_1205_1561 118
156 3300049590 Ga0501074_0232740 Ga0501074_0232740_401_757 118
157 3300049592 Ga0501076_0739470 Ga0501076_0739470_288_650 118
158 3300049741 Ga0501079_0114702 Ga0501079_0114702_1562_1918 118
159 3300049742 Ga0501080_0097097 Ga0501080_0097097_1717_2073 118
160 3300049742 Ga0501080_0396885 Ga0501080_0396885_81_437 118
161 3300050489 nmdc:mga03683_99461_c1 nmdc:mga03683_99461_c1_821_1177 118
162 3300053119 Ga0500595_019433 Ga0500595_019433_2068_2427 118
163 3300053131 Ga0500652_000015 Ga0500652_000015_77018_77377 118
164 3300053177 Ga0500636_0031063 Ga0500636_0031063_1587_1946 118
165 3300002075 JGI24738J21930_10079763 JGI24738J21930_100797632 119
166 3300005289 Ga0065704_10285897 Ga0065704_102858972 119
167 3300005295 Ga0065707_10372585 Ga0065707_103725851 119
168 3300005295 Ga0065707_10630501 Ga0065707_106305012 119
169 3300005328 Ga0070676_10048407 Ga0070676_100484073 119
170 3300005328 Ga0070676_10181155 Ga0070676_101811552 119
171 3300005330 Ga0070690_100156573 Ga0070690_1001565732 119
172 3300005331 Ga0070670_100004813 Ga0070670_10000481312 119
173 3300005331 Ga0070670_100040299 Ga0070670_1000402994 119
174 3300005331 Ga0070670_100744677 Ga0070670_1007446772 119
175 3300005334 Ga0068869_100146345 Ga0068869_1001463451 119
176 3300005334 Ga0068869_100415375 Ga0068869_1004153752 119
177 3300005336 Ga0070680_100133393 Ga0070680_1001333932 119
178 3300005337 Ga0070682_100498682 Ga0070682_1004986821 119
179 3300005338 Ga0068868_100161991 Ga0068868_1001619913 119
180 3300005338 Ga0068868_101349763 Ga0068868_1013497632 119
181 3300005339 Ga0070660_101301510 Ga0070660_1013015101 119
182 3300005340 Ga0070689_100132559 Ga0070689_1001325593 119
183 3300005340 Ga0070689_100479077 Ga0070689_1004790772 119
184 3300005340 Ga0070689_101298603 Ga0070689_1012986031 119
185 3300005340 Ga0070689_101980734 Ga0070689_1019807341 119
186 3300005344 Ga0070661_101191285 Ga0070661_1011912851 119
187 3300005345 Ga0070692_10853791 Ga0070692_108537912 119
188 3300005347 Ga0070668_100018714 Ga0070668_1000187144 119
189 3300005347 Ga0070668_100321066 Ga0070668_1003210662 119
190 3300005353 Ga0070669_100280047 Ga0070669_1002800472 119
191 3300005353 Ga0070669_100675155 Ga0070669_1006751551 119
192 3300005354 Ga0070675_100205283 Ga0070675_1002052832 119
193 3300005355 Ga0070671_100014163 Ga0070671_1000141639 119
194 3300005355 Ga0070671_100524177 Ga0070671_1005241771 119
195 3300005355 Ga0070671_100796873 Ga0070671_1007968732 119
196 3300005356 Ga0070674_100188498 Ga0070674_1001884982 119
197 3300005356 Ga0070674_100295357 Ga0070674_1002953572 119
198 3300005356 Ga0070674_100317957 Ga0070674_1003179572 119
199 3300005356 Ga0070674_100642367 Ga0070674_1006423671 119
200 3300005364 Ga0070673_100019735 Ga0070673_1000197357 119
201 3300005364 Ga0070673_100104198 Ga0070673_1001041984 119
202 3300005365 Ga0070688_100020065 Ga0070688_1000200656 119
203 3300005366 Ga0070659_101580875 Ga0070659_1015808751 119
204 3300005367 Ga0070667_100286722 Ga0070667_1002867223 119
205 3300005438 Ga0070701_10227590 Ga0070701_102275902 119
206 3300005441 Ga0070700_100365427 Ga0070700_1003654272 119
207 3300005441 Ga0070700_100541055 Ga0070700_1005410551 119
208 3300005455 Ga0070663_100486514 Ga0070663_1004865142 119
209 3300005456 Ga0070678_100231485 Ga0070678_1002314851 119
210 3300005459 Ga0068867_100229962 Ga0068867_1002299622 119
211 3300005466 Ga0070685_10315486 Ga0070685_103154862 119
212 3300005466 Ga0070685_10332225 Ga0070685_103322251 119
213 3300005539 Ga0068853_100542210 Ga0068853_1005422102 119
214 3300005543 Ga0070672_100040734 Ga0070672_1000407344 119
215 3300005543 Ga0070672_100158395 Ga0070672_1001583952 119
216 3300005543 Ga0070672_100692745 Ga0070672_1006927451 119
217 3300005545 Ga0070695_101017095 Ga0070695_1010170952 119
218 3300005547 Ga0070693_100083992 Ga0070693_1000839923 119
219 3300005548 Ga0070665_100547656 Ga0070665_1005476561 119
220 3300005549 Ga0070704_101102753 Ga0070704_1011027531 119
221 3300005564 Ga0070664_100525004 Ga0070664_1005250042 119
222 3300005564 Ga0070664_101238848 Ga0070664_1012388482 119
223 3300005577 Ga0068857_100275168 Ga0068857_1002751682 119
224 3300005577 Ga0068857_100816610 Ga0068857_1008166102 119
225 3300005578 Ga0068854_100509521 Ga0068854_1005095212 119
226 3300005615 Ga0070702_100038593 Ga0070702_1000385932 119
227 3300005615 Ga0070702_100406950 Ga0070702_1004069502 119
228 3300005616 Ga0068852_102096782 Ga0068852_1020967821 119
229 3300005616 Ga0068852_102590209 Ga0068852_1025902091 119
230 3300005617 Ga0068859_100169406 Ga0068859_1001694063 119
231 3300005618 Ga0068864_100000918 Ga0068864_1000009183 119
232 3300005618 Ga0068864_100017967 Ga0068864_1000179674 119
233 3300005618 Ga0068864_100036622 Ga0068864_1000366222 119
234 3300005718 Ga0068866_10186634 Ga0068866_101866342 119
235 3300005719 Ga0068861_100679586 Ga0068861_1006795862 119
236 3300005834 Ga0068851_10457987 Ga0068851_104579871 119
237 3300005840 Ga0068870_10867494 Ga0068870_108674942 119
238 3300005841 Ga0068863_100003461 Ga0068863_10000346124 119
239 3300005841 Ga0068863_100026752 Ga0068863_1000267526 119
240 3300005841 Ga0068863_100205838 Ga0068863_1002058382 119
241 3300005842 Ga0068858_100226117 Ga0068858_1002261174 119
242 3300005842 Ga0068858_100913875 Ga0068858_1009138752 119
243 3300005843 Ga0068860_100023855 Ga0068860_1000238559 119
244 3300005844 Ga0068862_100195625 Ga0068862_1001956253 119
245 3300005844 Ga0068862_101275955 Ga0068862_1012759552 119
246 3300005844 Ga0068862_102439150 Ga0068862_1024391501 119
247 3300005985 Ga0081539_10179255 Ga0081539_101792552 119
248 3300005985 Ga0081539_10256131 Ga0081539_102561311 119
249 3300006038 Ga0075365_10055881 Ga0075365_100558812 119
250 3300006038 Ga0075365_10247229 Ga0075365_102472291 119
251 3300006038 Ga0075365_10973531 Ga0075365_109735312 119
252 3300006038 Ga0075365_11032486 Ga0075365_110324862 119
253 3300006042 Ga0075368_10006328 Ga0075368_100063283 119
254 3300006042 Ga0075368_10012958 Ga0075368_100129584 119
255 3300006048 Ga0075363_100001611 Ga0075363_1000016118 119
256 3300006048 Ga0075363_100043677 Ga0075363_1000436773 119
257 3300006048 Ga0075363_100588424 Ga0075363_1005884242 119
258 3300006051 Ga0075364_10072514 Ga0075364_100725145 119
259 3300006051 Ga0075364_10157188 Ga0075364_101571882 119
260 3300006051 Ga0075364_11022925 Ga0075364_110229252 119
261 3300006177 Ga0075362_10158700 Ga0075362_101587002 119
262 3300006177 Ga0075362_10162288 Ga0075362_101622881 119
263 3300006177 Ga0075362_10402315 Ga0075362_104023151 119
264 3300006178 Ga0075367_10005985 Ga0075367_100059855 119
265 3300006178 Ga0075367_10047413 Ga0075367_100474135 119
266 3300006178 Ga0075367_10220457 Ga0075367_102204572 119
267 3300006178 Ga0075367_10386795 Ga0075367_103867951 119
268 3300006186 Ga0075369_10047323 Ga0075369_100473233 119
269 3300006186 Ga0075369_10340664 Ga0075369_103406642 119
270 3300006195 Ga0075366_10009517 Ga0075366_100095172 119
271 3300006195 Ga0075366_10027157 Ga0075366_100271573 119
272 3300006195 Ga0075366_10132422 Ga0075366_101324222 119
273 3300006237 Ga0097621_100923523 Ga0097621_1009235232 119
274 3300006353 Ga0075370_10052249 Ga0075370_100522492 119
275 3300006353 Ga0075370_10085555 Ga0075370_100855552 119
276 3300006358 Ga0068871_100530920 Ga0068871_1005309202 119
277 3300006358 Ga0068871_100675136 Ga0068871_1006751362 119
278 3300006844 Ga0075428_100057924 Ga0075428_1000579243 119
279 3300006844 Ga0075428_100124215 Ga0075428_1001242153 119
280 3300006847 Ga0075431_100991483 Ga0075431_1009914832 119
281 3300006847 Ga0075431_101981159 Ga0075431_1019811591 119
282 3300006852 Ga0075433_10638400 Ga0075433_106384001 119
283 3300006871 Ga0075434_101351577 Ga0075434_1013515772 119
284 3300006931 Ga0097620_100169410 Ga0097620_1001694103 119
285 3300009011 Ga0105251_10198545 Ga0105251_101985452 119
286 3300009036 Ga0105244_10186777 Ga0105244_101867771 119
287 3300009093 Ga0105240_11292208 Ga0105240_112922082 119
288 3300009094 Ga0111539_10002972 Ga0111539_1000297219 119
289 3300009098 Ga0105245_10083658 Ga0105245_100836582 119
290 3300009098 Ga0105245_10573752 Ga0105245_105737522 119
291 3300009098 Ga0105245_10627849 Ga0105245_106278492 119
292 3300009147 Ga0114129_10069655 Ga0114129_100696558 119
293 3300009147 Ga0114129_11671415 Ga0114129_116714152 119
294 3300009147 Ga0114129_11945208 Ga0114129_119452082 119
295 3300009148 Ga0105243_10071650 Ga0105243_100716504 119
296 3300009176 Ga0105242_10077074 Ga0105242_100770744 119
297 3300009177 Ga0105248_10907257 Ga0105248_109072572 119
298 3300009545 Ga0105237_12404702 Ga0105237_124047021 119
299 3300009551 Ga0105238_10098403 Ga0105238_100984034 119
300 3300009551 Ga0105238_10292580 Ga0105238_102925803 119
301 3300011119 Ga0105246_10663587 Ga0105246_106635872 119
302 3300013296 Ga0157374_10459365 Ga0157374_104593651 119
303 3300013297 Ga0157378_10279361 Ga0157378_102793613 119
304 3300013297 Ga0157378_11561244 Ga0157378_115612442 119
305 3300013306 Ga0163162_10267727 Ga0163162_102677272 119
306 3300013307 Ga0157372_11887182 Ga0157372_118871822 119
307 3300013308 Ga0157375_10008063 Ga0157375_1000806311 119
308 3300013308 Ga0157375_11294700 Ga0157375_112947001 119
309 3300014325 Ga0163163_10009374 Ga0163163_100093744 119
310 3300014326 Ga0157380_10015122 Ga0157380_100151224 119
311 3300014326 Ga0157380_10043587 Ga0157380_100435873 119
312 3300014326 Ga0157380_10733126 Ga0157380_107331262 119
313 3300014326 Ga0157380_10953154 Ga0157380_109531542 119
314 3300014326 Ga0157380_11510873 Ga0157380_115108731 119
315 3300014497 Ga0182008_10259906 Ga0182008_102599062 119
316 3300014745 Ga0157377_10539219 Ga0157377_105392192 119
317 3300014968 Ga0157379_10677138 Ga0157379_106771381 119
318 3300014969 Ga0157376_10111683 Ga0157376_101116833 119
319 3300017792 Ga0163161_10036021 Ga0163161_100360214 119
320 3300025297 Ga0209758_1109977 Ga0209758_11099772 119
321 3300025735 Ga0207713_1150458 Ga0207713_11504582 119
322 3300025899 Ga0207642_10171105 Ga0207642_101711052 119
323 3300025903 Ga0207680_10178084 Ga0207680_101780841 119
324 3300025907 Ga0207645_10036795 Ga0207645_100367954 119
325 3300025907 Ga0207645_10215930 Ga0207645_102159302 119
326 3300025912 Ga0207707_10324035 Ga0207707_103240352 119
327 3300025913 Ga0207695_10838752 Ga0207695_108387522 119
328 3300025914 Ga0207671_10922295 Ga0207671_109222952 119
329 3300025917 Ga0207660_11500792 Ga0207660_115007921 119
330 3300025919 Ga0207657_11073102 Ga0207657_110731021 119
331 3300025920 Ga0207649_10840701 Ga0207649_108407011 119
332 3300025923 Ga0207681_10171414 Ga0207681_101714144 119
333 3300025923 Ga0207681_10266563 Ga0207681_102665633 119
334 3300025923 Ga0207681_10470026 Ga0207681_104700262 119
335 3300025924 Ga0207694_10847515 Ga0207694_108475152 119
336 3300025925 Ga0207650_10013430 Ga0207650_100134307 119
337 3300025925 Ga0207650_10179524 Ga0207650_101795242 119
338 3300025925 Ga0207650_10322089 Ga0207650_103220892 119
339 3300025925 Ga0207650_10496885 Ga0207650_104968852 119
340 3300025925 Ga0207650_11050412 Ga0207650_110504121 119
341 3300025926 Ga0207659_10129563 Ga0207659_101295632 119
342 3300025926 Ga0207659_10193583 Ga0207659_101935832 119
343 3300025926 Ga0207659_10223961 Ga0207659_102239612 119
344 3300025927 Ga0207687_10585521 Ga0207687_105855212 119
345 3300025927 Ga0207687_11298813 Ga0207687_112988132 119
346 3300025931 Ga0207644_10099704 Ga0207644_100997041 119
347 3300025931 Ga0207644_10355588 Ga0207644_103555881 119
348 3300025931 Ga0207644_10399593 Ga0207644_103995931 119
349 3300025933 Ga0207706_11019283 Ga0207706_110192832 119
350 3300025934 Ga0207686_10038004 Ga0207686_100380043 119
351 3300025935 Ga0207709_10132657 Ga0207709_101326572 119
352 3300025935 Ga0207709_11821730 Ga0207709_118217301 119
353 3300025936 Ga0207670_10095211 Ga0207670_100952112 119
354 3300025936 Ga0207670_11053729 Ga0207670_110537292 119
355 3300025937 Ga0207669_10044928 Ga0207669_100449282 119
356 3300025937 Ga0207669_10244959 Ga0207669_102449592 119
357 3300025937 Ga0207669_10259906 Ga0207669_102599062 119
358 3300025937 Ga0207669_11170304 Ga0207669_111703041 119
359 3300025938 Ga0207704_10198871 Ga0207704_101988712 119
360 3300025940 Ga0207691_10003897 Ga0207691_100038974 119
361 3300025940 Ga0207691_10052634 Ga0207691_100526342 119
362 3300025940 Ga0207691_10775875 Ga0207691_107758752 119
363 3300025942 Ga0207689_10446042 Ga0207689_104460422 119
364 3300025942 Ga0207689_10493386 Ga0207689_104933862 119
365 3300025945 Ga0207679_10742132 Ga0207679_107421322 119
366 3300025945 Ga0207679_11032146 Ga0207679_110321461 119
367 3300025960 Ga0207651_10014774 Ga0207651_100147746 119
368 3300025960 Ga0207651_10514704 Ga0207651_105147042 119
369 3300025972 Ga0207668_10022618 Ga0207668_100226187 119
370 3300025972 Ga0207668_10152216 Ga0207668_101522162 119
371 3300025972 Ga0207668_11492294 Ga0207668_114922941 119
372 3300025981 Ga0207640_10986611 Ga0207640_109866111 119
373 3300025986 Ga0207658_10465610 Ga0207658_104656102 119
374 3300026023 Ga0207677_10270798 Ga0207677_102707982 119
375 3300026023 Ga0207677_10306002 Ga0207677_103060023 119
376 3300026035 Ga0207703_10200616 Ga0207703_102006164 119
377 3300026035 Ga0207703_10582819 Ga0207703_105828192 119
378 3300026041 Ga0207639_10888405 Ga0207639_108884052 119
379 3300026067 Ga0207678_10012948 Ga0207678_100129489 119
380 3300026067 Ga0207678_10049096 Ga0207678_100490964 119
381 3300026075 Ga0207708_10239026 Ga0207708_102390262 119
382 3300026075 Ga0207708_10928107 Ga0207708_109281072 119
383 3300026088 Ga0207641_10012818 Ga0207641_100128184 119
384 3300026088 Ga0207641_12038012 Ga0207641_120380121 119
385 3300026089 Ga0207648_10028927 Ga0207648_100289272 119
386 3300026095 Ga0207676_10095978 Ga0207676_100959783 119
387 3300026095 Ga0207676_10099678 Ga0207676_100996782 119
388 3300026095 Ga0207676_10459847 Ga0207676_104598471 119
389 3300026121 Ga0207683_10673825 Ga0207683_106738252 119
390 3300026142 Ga0207698_10934651 Ga0207698_109346511 119
391 3300027866 Ga0209813_10001883 Ga0209813_100018838 119
392 3300027907 Ga0207428_10414396 Ga0207428_104143961 119
393 3300028379 Ga0268266_10000352 Ga0268266_100003528 119
394 3300028379 Ga0268266_10095017 Ga0268266_100950174 119
395 3300028380 Ga0268265_11532837 Ga0268265_115328371 119
396 3300028381 Ga0268264_11354562 Ga0268264_113545621 119
397 3300028794 Ga0307515_10120642 Ga0307515_101206422 119
398 3300031456 Ga0307513_10207643 Ga0307513_102076432 119
399 3300031456 Ga0307513_10517354 Ga0307513_105173542 119
400 3300031911 Ga0307412_10152481 Ga0307412_101524813 119
401 3300031995 Ga0307409_101551166 Ga0307409_1015511661 119
402 3300035692 Ga0373935_0046316 Ga0373935_0046316_397_756 119
403 3300035695 Ga0373927_0015494 Ga0373927_0015494_203_562 119
404 3300036401 Ga0373937_0899291 Ga0373937_0899291_110_469 119
405 3300037068 Ga0373925_0013259 Ga0373925_0013259_2687_3046 119
406 3300041452 Ga0451793_0292868 Ga0451793_0292868_78_437 119
407 3300041486 Ga0451807_2660561 Ga0451807_2660561_816_1178 119
408 3300041505 Ga0451849_0759547 Ga0451849_0759547_167_529 119
409 3300041505 Ga0451849_1258175 Ga0451849_1258175_50_412 119
410 3300041512 Ga0451853_1674364 Ga0451853_1674364_714_1079 119
411 3300041512 Ga0451853_3100653 Ga0451853_3100653_305_664 119
412 3300046457 Ga0495590_0108005 Ga0495590_0108005_388_747 119
413 3300046459 Ga0495629_0255304 Ga0495629_0255304_669_1028 119
414 3300046460 Ga0495638_0006892 Ga0495638_0006892_1518_1877 119
415 3300046460 Ga0495638_0033865 Ga0495638_0033865_2098_2457 119
416 3300046460 Ga0495638_0052013 Ga0495638_0052013_1816_2175 119
417 3300046471 Ga0495650_0114870 Ga0495650_0114870_14_376 119
418 3300046471 Ga0495650_0256485 Ga0495650_0256485_27_389 119
419 3300046474 Ga0495605_0136715 Ga0495605_0136715_200_559 119
420 3300046492 Ga0495585_0113374 Ga0495585_0113374_456_815 119
421 3300046501 Ga0495607_0064480 Ga0495607_0064480_416_775 119
422 3300046507 Ga0495606_0093431 Ga0495606_0093431_884_1243 119
423 3300046512 Ga0495610_0028346 Ga0495610_0028346_1970_2329 119
424 3300046513 Ga0495616_0108849 Ga0495616_0108849_284_643 119
425 3300046515 Ga0495620_0132100 Ga0495620_0132100_565_924 119
426 3300046518 Ga0495631_0024970 Ga0495631_0024970_1114_1473 119
427 3300046519 Ga0495632_0157249 Ga0495632_0157249_443_802 119
428 3300046520 Ga0495637_0021275 Ga0495637_0021275_1437_1796 119
429 3300046522 Ga0495643_0042175 Ga0495643_0042175_1775_2134 119
430 3300046524 Ga0495648_0025488 Ga0495648_0025488_1955_2314 119
431 3300046530 Ga0495654_0028398 Ga0495654_0028398_1598_1957 119
432 3300046538 Ga0495609_0089867 Ga0495609_0089867_597_956 119
433 3300046542 Ga0495597_0127938 Ga0495597_0127938_683_1042 119
434 3300046616 Ga0495668_0079394 Ga0495668_0079394_347_706 119
435 3300046660 Ga0495625_0701491 Ga0495625_0701491_164_523 119
436 3300046665 Ga0495661_0049107 Ga0495661_0049107_401_760 119
437 3300046665 Ga0495661_0296006 Ga0495661_0296006_22_381 119
438 3300046674 Ga0495588_0031460 Ga0495588_0031460_193_552 119
439 3300046691 Ga0495670_0033565 Ga0495670_0033565_1879_2238 119
440 3300046692 Ga0495671_0049346 Ga0495671_0049346_683_1042 119
441 3300046794 Ga0495589_0173429 Ga0495589_0173429_435_794 119
442 3300046810 Ga0495660_0064470 Ga0495660_0064470_774_1133 119
443 3300047445 Ga0495677_0069821 Ga0495677_0069821_623_982 119
444 3300047470 Ga0495681_0079787 Ga0495681_0079787_407_766 119
445 3300047472 Ga0495686_0027654 Ga0495686_0027654_1840_2199 119
446 3300048091 Ga0495626_0067619 Ga0495626_0067619_1092_1451 119
447 3300048903 Ga0496100_0830310 Ga0496100_0830310_338_697 119
448 3300048905 Ga0496102_0479835 Ga0496102_0479835_731_1090 119
449 3300048907 Ga0496104_1538005 Ga0496104_1538005_48_407 119
450 3300048909 Ga0496106_1533602 Ga0496106_1533602_81_440 119
451 3300048911 Ga0496108_0348297 Ga0496108_0348297_264_626 119
452 3300048913 Ga0496110_0737495 Ga0496110_0737495_153_512 119
453 3300048914 Ga0496111_0510903 Ga0496111_0510903_223_585 119
454 3300048915 Ga0496112_0129869 Ga0496112_0129869_608_970 119
455 3300048916 Ga0496113_0354080 Ga0496113_0354080_638_1000 119
456 3300048916 Ga0496113_1040619 Ga0496113_1040619_110_469 119
457 3300048916 Ga0496113_1122689 Ga0496113_1122689_18_377 119
458 3300048918 Ga0496115_0934660 Ga0496115_0934660_60_425 119
459 3300048920 Ga0496117_0056542 Ga0496117_0056542_1714_2073 119
460 3300048921 Ga0496118_0182014 Ga0496118_0182014_779_1138 119
461 3300048922 Ga0496119_0150376 Ga0496119_0150376_407_766 119
462 3300048922 Ga0496119_0182816 Ga0496119_0182816_228_587 119
463 3300048923 Ga0496120_0023177 Ga0496120_0023177_2223_2582 119
464 3300048924 Ga0496121_0044674 Ga0496121_0044674_880_1239 119
465 3300048925 Ga0496122_0144029 Ga0496122_0144029_724_1083 119
466 3300048926 Ga0496123_0045094 Ga0496123_0045094_1842_2201 119
467 3300048927 Ga0496124_0399737 Ga0496124_0399737_530_889 119
468 3300048928 Ga0496125_0004101 Ga0496125_0004101_8351_8710 119
469 3300048929 Ga0496126_1159357 Ga0496126_1159357_178_537 119
470 3300049569 Ga0501032_0778965 Ga0501032_0778965_120_482 119
471 3300049570 Ga0501033_0000200 Ga0501033_0000200_44640_45002 119
472 3300049576 Ga0501040_0464322 Ga0501040_0464322_130_492 119
473 3300049578 Ga0501042_0148863 Ga0501042_0148863_1142_1504 119
474 3300049579 Ga0501043_0104302 Ga0501043_0104302_523_885 119
475 3300049580 Ga0501046_0051265 Ga0501046_0051265_988_1350 119
476 3300049581 Ga0501047_0210030 Ga0501047_0210030_141_503 119
477 3300049581 Ga0501047_0541133 Ga0501047_0541133_202_564 119
478 3300049582 Ga0501048_0483701 Ga0501048_0483701_394_756 119
479 3300049583 Ga0501067_0665712 Ga0501067_0665712_173_532 119
480 3300049585 Ga0501069_0466290 Ga0501069_0466290_312_674 119
481 3300049589 Ga0501073_0040346 Ga0501073_0040346_171_605 119
482 3300049589 Ga0501073_0082404 Ga0501073_0082404_1044_1409 119
483 3300049589 Ga0501073_0519710 Ga0501073_0519710_42_401 119
484 3300049742 Ga0501080_0169199 Ga0501080_0169199_723_1085 119
485 3300049742 Ga0501080_0358473 Ga0501080_0358473_682_1041 119
486 3300049822 Ga0501035_0088135 Ga0501035_0088135_415_777 119
487 3300049823 Ga0501044_0015290 Ga0501044_0015290_3733_4095 119
488 3300049823 Ga0501044_0259771 Ga0501044_0259771_23_385 119
489 3300049823 Ga0501044_0358801 Ga0501044_0358801_81_440 119
490 3300050489 nmdc:mga03683_135925_c1 nmdc:mga03683_135925_c1_308_670 119
491 3300050489 nmdc:mga03683_166481_c1 nmdc:mga03683_166481_c1_223_582 119
492 3300050489 nmdc:mga03683_72547_c1 nmdc:mga03683_72547_c1_60_533 119
493 3300050490 nmdc:mga03n38_11525_c1 nmdc:mga03n38_11525_c1_1537_1899 119
494 3300050490 nmdc:mga03n38_228242_c1 nmdc:mga03n38_228242_c1_273_632 119
495 3300050490 nmdc:mga03n38_384_c1 nmdc:mga03n38_384_c1_182_541 119
496 3300050491 nmdc:mga00v17_158387_c1 nmdc:mga00v17_158387_c1_875_1237 119
497 3300050491 nmdc:mga00v17_199780_c1 nmdc:mga00v17_199780_c1_164_523 119
498 3300050492 nmdc:mga0yw44_147266_c1 nmdc:mga0yw44_147266_c1_160_519 119
499 3300050492 nmdc:mga0yw44_184318_c1 nmdc:mga0yw44_184318_c1_724_1083 119
500 3300050492 nmdc:mga0yw44_27688_c1 nmdc:mga0yw44_27688_c1_420_782 119
501 3300050492 nmdc:mga0yw44_48372_c1 nmdc:mga0yw44_48372_c1_232_591 119
502 3300050493 nmdc:mga0k408_688630_c1 nmdc:mga0k408_688630_c1_50_409 119
503 3300050494 nmdc:mga06z11_17062_c1 nmdc:mga06z11_17062_c1_2097_2456 119
504 3300050495 nmdc:mga04h51_14032_c1 nmdc:mga04h51_14032_c1_1073_1435 119
505 3300050495 nmdc:mga04h51_15692_c1 nmdc:mga04h51_15692_c1_1137_1496 119
506 3300050496 nmdc:mga07m45_126949_c1 nmdc:mga07m45_126949_c1_66_425 119
507 3300050496 nmdc:mga07m45_137022_c1 nmdc:mga07m45_137022_c1_59_421 119
508 3300050496 nmdc:mga07m45_39256_c1 nmdc:mga07m45_39256_c1_1471_1830 119
509 3300050507 nmdc:mga05p37_1115446_c1 nmdc:mga05p37_1115446_c1_135_500 119
510 3300050507 nmdc:mga05p37_96689_c1 nmdc:mga05p37_96689_c1_2207_2566 119
511 3300050510 nmdc:mga06r32_249527_c1 nmdc:mga06r32_249527_c1_1280_1642 119
512 3300050511 nmdc:mga08y16_144158_c1 nmdc:mga08y16_144158_c1_1515_1877 119
513 3300050511 nmdc:mga08y16_552234_c1 nmdc:mga08y16_552234_c1_482_841 119
514 3300050512 nmdc:mga0n895_2145012_c1 nmdc:mga0n895_2145012_c1_69_434 119
515 3300050515 nmdc:mga0a205_714356_c1 nmdc:mga0a205_714356_c1_30_395 119
516 3300050516 nmdc:mga0sz30_450723_c1 nmdc:mga0sz30_450723_c1_104_466 119
517 3300053079 Ga0500610_0437028 Ga0500610_0437028_14_373 119
518 3300053086 Ga0500578_0245287 Ga0500578_0245287_43_402 119
519 3300053087 Ga0500643_027031 Ga0500643_027031_145_504 119
520 3300053088 Ga0500644_0041965 Ga0500644_0041965_400_759 119
521 3300053088 Ga0500644_0314341 Ga0500644_0314341_81_440 119
522 3300053089 Ga0500581_162047 Ga0500581_162047_403_762 119
523 3300053090 Ga0500646_0088706 Ga0500646_0088706_173_532 119
524 3300053090 Ga0500646_0179243 Ga0500646_0179243_229_588 119
525 3300053092 Ga0500583_0524954 Ga0500583_0524954_28_387 119
526 3300053093 Ga0500651_0075990 Ga0500651_0075990_772_1131 119
527 3300053094 Ga0500566_0000748 Ga0500566_0000748_6641_7027 119
528 3300053096 Ga0500641_0009093 Ga0500641_0009093_230_589 119
529 3300053096 Ga0500641_0010726 Ga0500641_0010726_1084_1446 119
530 3300053096 Ga0500641_0130267 Ga0500641_0130267_172_531 119
531 3300053098 Ga0500650_0022536 Ga0500650_0022536_540_899 119
532 3300053102 Ga0500554_135733 Ga0500554_135733_16_402 119
533 3300053104 Ga0500556_0000051 Ga0500556_0000051_91292_91651 119
534 3300053108 Ga0500562_021545 Ga0500562_021545_923_1282 119
535 3300053109 Ga0500569_064470 Ga0500569_064470_69_428 119
536 3300053116 Ga0500592_011519 Ga0500592_011519_623_982 119
537 3300053117 Ga0500593_079511 Ga0500593_079511_772_1131 119
538 3300053118 Ga0500594_0007599 Ga0500594_0007599_1542_1901 119
539 3300053122 Ga0500608_003839 Ga0500608_003839_3896_4255 119
540 3300053130 Ga0500642_0000041 Ga0500642_0000041_58348_58707 119
541 3300053134 Ga0500658_0159505 Ga0500658_0159505_34_393 119
542 3300053136 Ga0500559_0000188 Ga0500559_0000188_8187_8546 119
543 3300053138 Ga0500564_164527 Ga0500564_164527_167_553 119
544 3300053139 Ga0500568_0154255 Ga0500568_0154255_158_517 119
545 3300053146 Ga0500588_0029782 Ga0500588_0029782_91_450 119
546 3300053146 Ga0500588_0243784 Ga0500588_0243784_73_432 119
547 3300053151 Ga0500604_0008743 Ga0500604_0008743_58_417 119
548 3300053151 Ga0500604_0162957 Ga0500604_0162957_26_385 119
549 3300053153 Ga0500616_0000150 Ga0500616_0000150_90430_90789 119
550 3300053154 Ga0500619_081608 Ga0500619_081608_290_649 119
551 3300053156 Ga0500622_0009784 Ga0500622_0009784_4324_4683 119
552 3300053158 Ga0500627_0051387 Ga0500627_0051387_1280_1639 119
553 3300053160 Ga0500633_0036255 Ga0500633_0036255_389_748 119
554 3300053727 Ga0500611_014010 Ga0500611_014010_200_559 119
555 3300053730 Ga0500645_019029 Ga0500645_019029_643_1002 119
556 3300060353 Ga0501082_0661886 Ga0501082_0661886_352_717 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

27

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9538 1 117
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9526 1 119
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9151 1 117
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8748 1 119
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.7639 2 119
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9487 1 119 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.941 1 119 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7639 2 119 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7345 3 116 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7304 2 119 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6P2ET28-F1-model_v4 RNA signal recognition particle 0.9938 1 119
AF-A0A2S2DD96-F1-model_v4 DUF1428 domain-containing protein 0.9925 1 119
AF-Q07H21-F1-model_v4 DUF1428 domain-containing protein 0.9915 1 119
AF-A0A2A6NUV3-F1-model_v4 RNA signal recognition particle 0.9906 1 119
AF-A0A1Q4BAH8-F1-model_v4 RNA signal recognition particle 0.9903 4 90

Feature Viewer

pLDDT pTM Quality
93.54 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map