F463257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 556 | 326 | 555 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0040346|Ga0501073_0040346_171_605 |
| Length | 144 |
| Sequence | LPNIHACIGADRGVAIRFTQLYEDAMTYVDGFVVPVPKKKLKAYYAMAKTASKVWRDHGAVEYLECVADDVKKGKWTSFPRSVKLKAAETVIFAYIVYKSRKDRDRVLKAVMKDKRLAAMMDPKKMPFDARRMIYGGFKAVVKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 298 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 299 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 300 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 303 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 309 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 310 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 315 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 317 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 319 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 323 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.45 |
| Nodule | 0.18 |
| Rhizoplane | 3.24 |
| Rhizosphere | 75.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10079763 | 3300002075 | Bacteria | 684 |
| 2 | JGI24742J22300_10010176 | 3300002244 | Bacteria | 1555 |
| 3 | JGI25406J46586_10001293 | 3300003203 | Bacteria | 11776 |
| 4 | Ga0065704_10285897 | 3300005289 | Bacteria | 913 |
| 5 | Ga0065715_10199080 | 3300005293 | Bacteria | 1371 |
| 6 | Ga0065707_10372585 | 3300005295 | Bacteria | 888 |
| 7 | Ga0065707_10630501 | 3300005295 | Bacteria | 674 |
| 8 | Ga0070658_10026704 | 3300005327 | Bacteria | 4634 |
| 9 | Ga0070676_10044304 | 3300005328 | Bacteria | 2589 |
| 10 | Ga0070676_10048407 | 3300005328 | Bacteria | 2485 |
| 11 | Ga0070676_10181155 | 3300005328 | Bacteria | 1370 |
| 12 | Ga0070690_100087579 | 3300005330 | Bacteria | 2045 |
| 13 | Ga0070690_100156573 | 3300005330 | Bacteria | 1558 |
| 14 | Ga0070670_100004813 | 3300005331 | Bacteria | 11336 |
| 15 | Ga0070670_100040299 | 3300005331 | Bacteria | 4017 |
| 16 | Ga0070670_100744677 | 3300005331 | Bacteria | 883 |
| 17 | Ga0070677_10006580 | 3300005333 | Bacteria | 3862 |
| 18 | Ga0068869_100146345 | 3300005334 | Bacteria | 1829 |
| 19 | Ga0068869_100415375 | 3300005334 | Bacteria | 1109 |
| 20 | Ga0070666_10215893 | 3300005335 | Bacteria | 1352 |
| 21 | Ga0070680_100133393 | 3300005336 | Bacteria | 2079 |
| 22 | Ga0070682_100498682 | 3300005337 | Bacteria | 943 |
| 23 | Ga0070682_100695417 | 3300005337 | Bacteria | 815 |
| 24 | Ga0068868_100161991 | 3300005338 | Bacteria | 1848 |
| 25 | Ga0068868_100602253 | 3300005338 | Bacteria | 974 |
| 26 | Ga0068868_101349763 | 3300005338 | Bacteria | 664 |
| 27 | Ga0070660_100216289 | 3300005339 | Bacteria | 1557 |
| 28 | Ga0070660_100673398 | 3300005339 | Bacteria | 867 |
| 29 | Ga0070660_101301510 | 3300005339 | Bacteria | 617 |
| 30 | Ga0070689_100132559 | 3300005340 | Bacteria | 1999 |
| 31 | Ga0070689_100479077 | 3300005340 | Bacteria | 1063 |
| 32 | Ga0070689_101298603 | 3300005340 | Bacteria | 655 |
| 33 | Ga0070689_101980734 | 3300005340 | Bacteria | 532 |
| 34 | Ga0070687_100363521 | 3300005343 | Bacteria | 938 |
| 35 | Ga0070661_100249070 | 3300005344 | Bacteria | 1370 |
| 36 | Ga0070661_101191285 | 3300005344 | Bacteria | 637 |
| 37 | Ga0070692_10853791 | 3300005345 | Bacteria | 626 |
| 38 | Ga0070668_100018714 | 3300005347 | Bacteria | 5201 |
| 39 | Ga0070668_100321066 | 3300005347 | Bacteria | 1304 |
| 40 | Ga0070669_100249621 | 3300005353 | Bacteria | 1412 |
| 41 | Ga0070669_100280047 | 3300005353 | Bacteria | 1336 |
| 42 | Ga0070669_100675155 | 3300005353 | Bacteria | 871 |
| 43 | Ga0070675_100096376 | 3300005354 | Bacteria | 2485 |
| 44 | Ga0070675_100205283 | 3300005354 | Bacteria | 1711 |
| 45 | Ga0070671_100014163 | 3300005355 | Bacteria | 6439 |
| 46 | Ga0070671_100046211 | 3300005355 | Bacteria | 3621 |
| 47 | Ga0070671_100524177 | 3300005355 | Bacteria | 1020 |
| 48 | Ga0070671_100796873 | 3300005355 | Bacteria | 822 |
| 49 | Ga0070674_100037254 | 3300005356 | Bacteria | 3270 |
| 50 | Ga0070674_100188498 | 3300005356 | Bacteria | 1585 |
| 51 | Ga0070674_100295357 | 3300005356 | Bacteria | 1290 |
| 52 | Ga0070674_100317957 | 3300005356 | Bacteria | 1247 |
| 53 | Ga0070674_100642367 | 3300005356 | Bacteria | 901 |
| 54 | Ga0070673_100019735 | 3300005364 | Bacteria | 4845 |
| 55 | Ga0070673_100104198 | 3300005364 | Bacteria | 2342 |
| 56 | Ga0070673_100229692 | 3300005364 | Bacteria | 1609 |
| 57 | Ga0070688_100020065 | 3300005365 | Bacteria | 3881 |
| 58 | Ga0070688_100022928 | 3300005365 | Bacteria | 3665 |
| 59 | Ga0070659_100739425 | 3300005366 | Bacteria | 853 |
| 60 | Ga0070659_101580875 | 3300005366 | Bacteria | 585 |
| 61 | Ga0070667_100193896 | 3300005367 | Bacteria | 1801 |
| 62 | Ga0070667_100286722 | 3300005367 | Bacteria | 1480 |
| 63 | Ga0070701_10107477 | 3300005438 | Bacteria | 1554 |
| 64 | Ga0070701_10227590 | 3300005438 | Bacteria | 1115 |
| 65 | Ga0070700_100365427 | 3300005441 | Bacteria | 1074 |
| 66 | Ga0070700_100541055 | 3300005441 | Bacteria | 903 |
| 67 | Ga0070708_100168325 | 3300005445 | Bacteria | 2045 |
| 68 | Ga0070663_100063389 | 3300005455 | Bacteria | 2669 |
| 69 | Ga0070663_100486514 | 3300005455 | Bacteria | 1022 |
| 70 | Ga0070678_100076855 | 3300005456 | Bacteria | 2517 |
| 71 | Ga0070678_100231485 | 3300005456 | Bacteria | 1541 |
| 72 | Ga0070662_100162997 | 3300005457 | Bacteria | 1745 |
| 73 | Ga0068867_100063416 | 3300005459 | Bacteria | 2746 |
| 74 | Ga0068867_100229962 | 3300005459 | Bacteria | 1499 |
| 75 | Ga0070685_10045269 | 3300005466 | Bacteria | 2523 |
| 76 | Ga0070685_10315486 | 3300005466 | Bacteria | 1058 |
| 77 | Ga0070685_10332225 | 3300005466 | Bacteria | 1034 |
| 78 | Ga0070707_100378842 | 3300005468 | Bacteria | 1374 |
| 79 | Ga0070698_100289629 | 3300005471 | Bacteria | 1569 |
| 80 | Ga0070699_100318381 | 3300005518 | Bacteria | 1398 |
| 81 | Ga0068853_100001086 | 3300005539 | Bacteria | 19242 |
| 82 | Ga0068853_100542210 | 3300005539 | Bacteria | 1101 |
| 83 | Ga0068853_100766640 | 3300005539 | Bacteria | 923 |
| 84 | Ga0070672_100040734 | 3300005543 | Bacteria | 3566 |
| 85 | Ga0070672_100110945 | 3300005543 | Bacteria | 2235 |
| 86 | Ga0070672_100158395 | 3300005543 | Bacteria | 1877 |
| 87 | Ga0070672_100692745 | 3300005543 | Bacteria | 892 |
| 88 | Ga0070686_100006631 | 3300005544 | Bacteria | 6444 |
| 89 | Ga0070695_101017095 | 3300005545 | Bacteria | 675 |
| 90 | Ga0070693_100083992 | 3300005547 | Bacteria | 1904 |
| 91 | Ga0070693_100646475 | 3300005547 | Bacteria | 769 |
| 92 | Ga0070665_100288753 | 3300005548 | Bacteria | 1643 |
| 93 | Ga0070665_100547656 | 3300005548 | Bacteria | 1169 |
| 94 | Ga0070704_101102753 | 3300005549 | Bacteria | 721 |
| 95 | Ga0068855_100058405 | 3300005563 | Bacteria | 4518 |
| 96 | Ga0070664_100525004 | 3300005564 | Bacteria | 1093 |
| 97 | Ga0070664_101238848 | 3300005564 | Bacteria | 704 |
| 98 | Ga0070664_101348717 | 3300005564 | Bacteria | 674 |
| 99 | Ga0068857_100275168 | 3300005577 | Bacteria | 1548 |
| 100 | Ga0068857_100526388 | 3300005577 | Bacteria | 1112 |
| 101 | Ga0068857_100816610 | 3300005577 | Bacteria | 891 |
| 102 | Ga0068854_100509521 | 3300005578 | Bacteria | 1015 |
| 103 | Ga0068854_100551653 | 3300005578 | Bacteria | 977 |
| 104 | Ga0070702_100038593 | 3300005615 | Bacteria | 2661 |
| 105 | Ga0070702_100093099 | 3300005615 | Bacteria | 1832 |
| 106 | Ga0070702_100406950 | 3300005615 | Bacteria | 975 |
| 107 | Ga0068852_100099423 | 3300005616 | Bacteria | 2622 |
| 108 | Ga0068852_102096782 | 3300005616 | Bacteria | 587 |
| 109 | Ga0068852_102590209 | 3300005616 | Unclassified | 527 |
| 110 | Ga0068859_100169406 | 3300005617 | Bacteria | 2265 |
| 111 | Ga0068864_100000918 | 3300005618 | Bacteria | 24714 |
| 112 | Ga0068864_100017967 | 3300005618 | Bacteria | 5901 |
| 113 | Ga0068864_100036622 | 3300005618 | Bacteria | 4183 |
| 114 | Ga0068866_10015940 | 3300005718 | Bacteria | 3349 |
| 115 | Ga0068866_10186634 | 3300005718 | Bacteria | 1229 |
| 116 | Ga0068861_100679586 | 3300005719 | Bacteria | 954 |
| 117 | Ga0068851_10260087 | 3300005834 | Bacteria | 987 |
| 118 | Ga0068851_10457987 | 3300005834 | Bacteria | 759 |
| 119 | Ga0068870_10867494 | 3300005840 | Bacteria | 635 |
| 120 | Ga0068863_100003461 | 3300005841 | Bacteria | 15572 |
| 121 | Ga0068863_100026752 | 3300005841 | Bacteria | 5501 |
| 122 | Ga0068863_100205838 | 3300005841 | Bacteria | 1894 |
| 123 | Ga0068858_100226117 | 3300005842 | Bacteria | 1773 |
| 124 | Ga0068858_100913875 | 3300005842 | Bacteria | 858 |
| 125 | Ga0068860_100023855 | 3300005843 | Bacteria | 5914 |
| 126 | Ga0068860_100065274 | 3300005843 | Bacteria | 3457 |
| 127 | Ga0068860_100392350 | 3300005843 | Bacteria | 1372 |
| 128 | Ga0068862_100195625 | 3300005844 | Bacteria | 1821 |
| 129 | Ga0068862_101275955 | 3300005844 | Bacteria | 735 |
| 130 | Ga0068862_102439150 | 3300005844 | Bacteria | 535 |
| 131 | Ga0081539_10000016 | 3300005985 | Bacteria | 381648 |
| 132 | Ga0081539_10179255 | 3300005985 | Bacteria | 995 |
| 133 | Ga0081539_10256131 | 3300005985 | Bacteria | 775 |
| 134 | Ga0075365_10055881 | 3300006038 | Bacteria | 2623 |
| 135 | Ga0075365_10247229 | 3300006038 | Bacteria | 1253 |
| 136 | Ga0075365_10545795 | 3300006038 | Bacteria | 820 |
| 137 | Ga0075365_10973531 | 3300006038 | Bacteria | 598 |
| 138 | Ga0075365_11032486 | 3300006038 | Bacteria | 579 |
| 139 | Ga0075368_10006328 | 3300006042 | Bacteria | 4130 |
| 140 | Ga0075368_10012958 | 3300006042 | Bacteria | 3056 |
| 141 | Ga0075363_100001611 | 3300006048 | Bacteria | 8694 |
| 142 | Ga0075363_100043677 | 3300006048 | Bacteria | 2372 |
| 143 | Ga0075363_100588424 | 3300006048 | Bacteria | 666 |
| 144 | Ga0075364_10072514 | 3300006051 | Bacteria | 2269 |
| 145 | Ga0075364_10157188 | 3300006051 | Bacteria | 1534 |
| 146 | Ga0075364_11022925 | 3300006051 | Bacteria | 561 |
| 147 | Ga0075362_10158700 | 3300006177 | Bacteria | 1088 |
| 148 | Ga0075362_10162288 | 3300006177 | Bacteria | 1076 |
| 149 | Ga0075362_10402315 | 3300006177 | Bacteria | 690 |
| 150 | Ga0075367_10005985 | 3300006178 | Bacteria | 6109 |
| 151 | Ga0075367_10047413 | 3300006178 | Bacteria | 2527 |
| 152 | Ga0075367_10220457 | 3300006178 | Bacteria | 1187 |
| 153 | Ga0075367_10386795 | 3300006178 | Bacteria | 884 |
| 154 | Ga0075369_10047323 | 3300006186 | Bacteria | 1854 |
| 155 | Ga0075369_10340664 | 3300006186 | Bacteria | 703 |
| 156 | Ga0075366_10009517 | 3300006195 | Bacteria | 5425 |
| 157 | Ga0075366_10027157 | 3300006195 | Bacteria | 3358 |
| 158 | Ga0075366_10132422 | 3300006195 | Bacteria | 1505 |
| 159 | Ga0075366_10775074 | 3300006195 | Bacteria | 596 |
| 160 | Ga0097621_100114636 | 3300006237 | Bacteria | 2280 |
| 161 | Ga0097621_100923523 | 3300006237 | Bacteria | 814 |
| 162 | Ga0075370_10052249 | 3300006353 | Bacteria | 2318 |
| 163 | Ga0075370_10085555 | 3300006353 | Bacteria | 1815 |
| 164 | Ga0068871_100291569 | 3300006358 | Bacteria | 1430 |
| 165 | Ga0068871_100530920 | 3300006358 | Bacteria | 1064 |
| 166 | Ga0068871_100675136 | 3300006358 | Bacteria | 945 |
| 167 | Ga0075428_100057924 | 3300006844 | Bacteria | 4242 |
| 168 | Ga0075428_100124215 | 3300006844 | Bacteria | 2809 |
| 169 | Ga0075431_100991483 | 3300006847 | Bacteria | 807 |
| 170 | Ga0075431_101981159 | 3300006847 | Bacteria | 538 |
| 171 | Ga0075433_10638400 | 3300006852 | Bacteria | 934 |
| 172 | Ga0075434_101351577 | 3300006871 | Bacteria | 723 |
| 173 | Ga0068865_100127010 | 3300006881 | Bacteria | 1905 |
| 174 | Ga0097620_100169410 | 3300006931 | Bacteria | 2265 |
| 175 | Ga0105251_10198545 | 3300009011 | Bacteria | 904 |
| 176 | Ga0105244_10186777 | 3300009036 | Bacteria | 981 |
| 177 | Ga0105240_11292208 | 3300009093 | Bacteria | 770 |
| 178 | Ga0111539_10002972 | 3300009094 | Bacteria | 22492 |
| 179 | Ga0111539_10085412 | 3300009094 | Bacteria | 3709 |
| 180 | Ga0105245_10083658 | 3300009098 | Bacteria | 2921 |
| 181 | Ga0105245_10573752 | 3300009098 | Bacteria | 1152 |
| 182 | Ga0105245_10627849 | 3300009098 | Bacteria | 1103 |
| 183 | Ga0114129_10069655 | 3300009147 | Bacteria | 4903 |
| 184 | Ga0114129_11671415 | 3300009147 | Bacteria | 778 |
| 185 | Ga0114129_11945208 | 3300009147 | Bacteria | 712 |
| 186 | Ga0105243_10071650 | 3300009148 | Bacteria | 2803 |
| 187 | Ga0105243_11008717 | 3300009148 | Bacteria | 835 |
| 188 | Ga0105242_10077074 | 3300009176 | Bacteria | 2781 |
| 189 | Ga0105242_10384139 | 3300009176 | Bacteria | 1306 |
| 190 | Ga0105248_10907257 | 3300009177 | Bacteria | 995 |
| 191 | Ga0105237_10574065 | 3300009545 | Bacteria | 1135 |
| 192 | Ga0105237_12002827 | 3300009545 | Bacteria | 588 |
| 193 | Ga0105237_12404702 | 3300009545 | Bacteria | 537 |
| 194 | Ga0105238_10098403 | 3300009551 | Bacteria | 2909 |
| 195 | Ga0105238_10292580 | 3300009551 | Bacteria | 1611 |
| 196 | Ga0105249_12828147 | 3300009553 | Bacteria | 557 |
| 197 | Ga0105239_10001596 | 3300010375 | Bacteria | 29953 |
| 198 | Ga0105246_10663587 | 3300011119 | Bacteria | 909 |
| 199 | Ga0105246_11630428 | 3300011119 | Bacteria | 611 |
| 200 | Ga0157373_11052053 | 3300013100 | Bacteria | 609 |
| 201 | Ga0157370_10236344 | 3300013104 | Bacteria | 1691 |
| 202 | Ga0157374_10163667 | 3300013296 | Bacteria | 2168 |
| 203 | Ga0157374_10459365 | 3300013296 | Bacteria | 1275 |
| 204 | Ga0157378_10037250 | 3300013297 | Bacteria | 4307 |
| 205 | Ga0157378_10279361 | 3300013297 | Bacteria | 1609 |
| 206 | Ga0157378_11561244 | 3300013297 | Bacteria | 705 |
| 207 | Ga0163162_10267727 | 3300013306 | Bacteria | 1840 |
| 208 | Ga0163162_12289282 | 3300013306 | Bacteria | 621 |
| 209 | Ga0157372_11887182 | 3300013307 | Bacteria | 687 |
| 210 | Ga0157375_10008063 | 3300013308 | Bacteria | 9212 |
| 211 | Ga0157375_10476771 | 3300013308 | Bacteria | 1413 |
| 212 | Ga0157375_11294700 | 3300013308 | Bacteria | 857 |
| 213 | Ga0163163_10009374 | 3300014325 | Bacteria | 8738 |
| 214 | Ga0157380_10015122 | 3300014326 | Bacteria | 5663 |
| 215 | Ga0157380_10030880 | 3300014326 | Bacteria | 4108 |
| 216 | Ga0157380_10043587 | 3300014326 | Bacteria | 3513 |
| 217 | Ga0157380_10733126 | 3300014326 | Bacteria | 997 |
| 218 | Ga0157380_10953154 | 3300014326 | Bacteria | 888 |
| 219 | Ga0157380_11510873 | 3300014326 | Bacteria | 725 |
| 220 | Ga0182008_10259906 | 3300014497 | Bacteria | 898 |
| 221 | Ga0157377_10539219 | 3300014745 | Bacteria | 822 |
| 222 | Ga0157379_10677138 | 3300014968 | Bacteria | 967 |
| 223 | Ga0157379_10738657 | 3300014968 | Bacteria | 926 |
| 224 | Ga0157376_10111683 | 3300014969 | Bacteria | 2407 |
| 225 | Ga0157376_10499007 | 3300014969 | Bacteria | 1196 |
| 226 | Ga0163161_10036021 | 3300017792 | Bacteria | 3543 |
| 227 | Ga0209758_1109977 | 3300025297 | Bacteria | 765 |
| 228 | Ga0209051_1010188 | 3300025303 | Bacteria | 4779 |
| 229 | Ga0207697_10191464 | 3300025315 | Bacteria | 898 |
| 230 | Ga0207713_1150458 | 3300025735 | Bacteria | 752 |
| 231 | Ga0207682_10002754 | 3300025893 | Bacteria | 7790 |
| 232 | Ga0207642_10171105 | 3300025899 | Bacteria | 1175 |
| 233 | Ga0207642_10254815 | 3300025899 | Bacteria | 998 |
| 234 | Ga0207688_10023072 | 3300025901 | Bacteria | 3405 |
| 235 | Ga0207680_10035202 | 3300025903 | Bacteria | 2873 |
| 236 | Ga0207680_10178084 | 3300025903 | Bacteria | 1436 |
| 237 | Ga0207647_10231907 | 3300025904 | Bacteria | 1062 |
| 238 | Ga0207645_10036795 | 3300025907 | Bacteria | 3143 |
| 239 | Ga0207645_10051463 | 3300025907 | Bacteria | 2632 |
| 240 | Ga0207645_10215930 | 3300025907 | Bacteria | 1264 |
| 241 | Ga0207705_10204036 | 3300025909 | Bacteria | 1498 |
| 242 | Ga0207684_10502318 | 3300025910 | Bacteria | 1039 |
| 243 | Ga0207707_10324035 | 3300025912 | Bacteria | 1330 |
| 244 | Ga0207695_10838752 | 3300025913 | Bacteria | 799 |
| 245 | Ga0207671_10819000 | 3300025914 | Bacteria | 738 |
| 246 | Ga0207671_10922295 | 3300025914 | Bacteria | 690 |
| 247 | Ga0207660_11500792 | 3300025917 | Bacteria | 545 |
| 248 | Ga0207662_10580603 | 3300025918 | Bacteria | 778 |
| 249 | Ga0207657_11073102 | 3300025919 | Bacteria | 616 |
| 250 | Ga0207649_10840701 | 3300025920 | Bacteria | 718 |
| 251 | Ga0207646_10204575 | 3300025922 | Bacteria | 1783 |
| 252 | Ga0207681_10166398 | 3300025923 | Bacteria | 1667 |
| 253 | Ga0207681_10171414 | 3300025923 | Bacteria | 1645 |
| 254 | Ga0207681_10266563 | 3300025923 | Bacteria | 1343 |
| 255 | Ga0207681_10470026 | 3300025923 | Bacteria | 1026 |
| 256 | Ga0207694_10847515 | 3300025924 | Bacteria | 772 |
| 257 | Ga0207650_10013430 | 3300025925 | Bacteria | 5671 |
| 258 | Ga0207650_10179524 | 3300025925 | Bacteria | 1686 |
| 259 | Ga0207650_10322089 | 3300025925 | Bacteria | 1266 |
| 260 | Ga0207650_10496885 | 3300025925 | Bacteria | 1019 |
| 261 | Ga0207650_10760609 | 3300025925 | Bacteria | 820 |
| 262 | Ga0207650_11050412 | 3300025925 | Bacteria | 693 |
| 263 | Ga0207659_10129563 | 3300025926 | Bacteria | 1945 |
| 264 | Ga0207659_10140371 | 3300025926 | Bacteria | 1875 |
| 265 | Ga0207659_10193583 | 3300025926 | Bacteria | 1619 |
| 266 | Ga0207659_10223961 | 3300025926 | Bacteria | 1514 |
| 267 | Ga0207687_10585521 | 3300025927 | Bacteria | 939 |
| 268 | Ga0207687_11298813 | 3300025927 | Bacteria | 625 |
| 269 | Ga0207644_10099704 | 3300025931 | Bacteria | 2180 |
| 270 | Ga0207644_10355588 | 3300025931 | Bacteria | 1190 |
| 271 | Ga0207644_10399593 | 3300025931 | Bacteria | 1123 |
| 272 | Ga0207706_10569441 | 3300025933 | Bacteria | 974 |
| 273 | Ga0207706_11019283 | 3300025933 | Bacteria | 695 |
| 274 | Ga0207686_10038004 | 3300025934 | Bacteria | 2909 |
| 275 | Ga0207709_10132657 | 3300025935 | Bacteria | 1700 |
| 276 | Ga0207709_11821730 | 3300025935 | Bacteria | 506 |
| 277 | Ga0207670_10095211 | 3300025936 | Bacteria | 2114 |
| 278 | Ga0207670_10152529 | 3300025936 | Bacteria | 1716 |
| 279 | Ga0207670_11053729 | 3300025936 | Bacteria | 685 |
| 280 | Ga0207669_10005673 | 3300025937 | Bacteria | 5629 |
| 281 | Ga0207669_10044928 | 3300025937 | Bacteria | 2600 |
| 282 | Ga0207669_10244959 | 3300025937 | Bacteria | 1331 |
| 283 | Ga0207669_10259906 | 3300025937 | Bacteria | 1298 |
| 284 | Ga0207669_11170304 | 3300025937 | Bacteria | 651 |
| 285 | Ga0207704_10185410 | 3300025938 | Bacteria | 1508 |
| 286 | Ga0207704_10198871 | 3300025938 | Unclassified | 1465 |
| 287 | Ga0207691_10003897 | 3300025940 | Bacteria | 14494 |
| 288 | Ga0207691_10052634 | 3300025940 | Bacteria | 3719 |
| 289 | Ga0207691_10053251 | 3300025940 | Bacteria | 3695 |
| 290 | Ga0207691_10775875 | 3300025940 | Bacteria | 806 |
| 291 | Ga0207689_10446042 | 3300025942 | Bacteria | 1081 |
| 292 | Ga0207689_10493386 | 3300025942 | Bacteria | 1026 |
| 293 | Ga0207679_10742132 | 3300025945 | Bacteria | 893 |
| 294 | Ga0207679_11032146 | 3300025945 | Bacteria | 754 |
| 295 | Ga0207667_10042319 | 3300025949 | Bacteria | 4842 |
| 296 | Ga0207651_10014774 | 3300025960 | Bacteria | 4519 |
| 297 | Ga0207651_10442664 | 3300025960 | Bacteria | 1113 |
| 298 | Ga0207651_10514704 | 3300025960 | Bacteria | 1036 |
| 299 | Ga0207712_11599869 | 3300025961 | Bacteria | 584 |
| 300 | Ga0207668_10022618 | 3300025972 | Bacteria | 4028 |
| 301 | Ga0207668_10152216 | 3300025972 | Bacteria | 1792 |
| 302 | Ga0207668_11291666 | 3300025972 | Bacteria | 657 |
| 303 | Ga0207668_11492294 | 3300025972 | Bacteria | 610 |
| 304 | Ga0207640_10137351 | 3300025981 | Bacteria | 1777 |
| 305 | Ga0207640_10986611 | 3300025981 | Bacteria | 740 |
| 306 | Ga0207658_10046785 | 3300025986 | Bacteria | 3162 |
| 307 | Ga0207658_10465610 | 3300025986 | Bacteria | 1121 |
| 308 | Ga0207677_10270798 | 3300026023 | Bacteria | 1389 |
| 309 | Ga0207677_10306002 | 3300026023 | Bacteria | 1315 |
| 310 | Ga0207677_11729460 | 3300026023 | Bacteria | 580 |
| 311 | Ga0207703_10200616 | 3300026035 | Bacteria | 1773 |
| 312 | Ga0207703_10582819 | 3300026035 | Bacteria | 1057 |
| 313 | Ga0207639_10014582 | 3300026041 | Bacteria | 5534 |
| 314 | Ga0207639_10347166 | 3300026041 | Bacteria | 1324 |
| 315 | Ga0207639_10888405 | 3300026041 | Bacteria | 833 |
| 316 | Ga0207678_10012948 | 3300026067 | Bacteria | 7318 |
| 317 | Ga0207678_10049096 | 3300026067 | Bacteria | 3646 |
| 318 | Ga0207678_10056858 | 3300026067 | Bacteria | 3367 |
| 319 | Ga0207708_10239026 | 3300026075 | Bacteria | 1460 |
| 320 | Ga0207708_10928107 | 3300026075 | Bacteria | 754 |
| 321 | Ga0207702_10341886 | 3300026078 | Bacteria | 1430 |
| 322 | Ga0207641_10012818 | 3300026088 | Bacteria | 6873 |
| 323 | Ga0207641_12038012 | 3300026088 | Bacteria | 575 |
| 324 | Ga0207648_10006450 | 3300026089 | Bacteria | 11658 |
| 325 | Ga0207648_10028927 | 3300026089 | Bacteria | 4912 |
| 326 | Ga0207676_10095978 | 3300026095 | Bacteria | 2446 |
| 327 | Ga0207676_10099678 | 3300026095 | Bacteria | 2405 |
| 328 | Ga0207676_10459847 | 3300026095 | Bacteria | 1201 |
| 329 | Ga0207674_10018067 | 3300026116 | Bacteria | 7679 |
| 330 | Ga0207675_100432838 | 3300026118 | Bacteria | 1301 |
| 331 | Ga0207683_10005312 | 3300026121 | Bacteria | 11046 |
| 332 | Ga0207683_10673825 | 3300026121 | Bacteria | 958 |
| 333 | Ga0207698_10254466 | 3300026142 | Bacteria | 1609 |
| 334 | Ga0207698_10934651 | 3300026142 | Unclassified | 876 |
| 335 | Ga0209813_10001883 | 3300027866 | Bacteria | 4732 |
| 336 | Ga0207428_10414396 | 3300027907 | Bacteria | 985 |
| 337 | Ga0268266_10000352 | 3300028379 | Bacteria | 71552 |
| 338 | Ga0268266_10095017 | 3300028379 | Bacteria | 2618 |
| 339 | Ga0268265_11532837 | 3300028380 | Bacteria | 670 |
| 340 | Ga0268264_10047966 | 3300028381 | Bacteria | 3552 |
| 341 | Ga0268264_11354562 | 3300028381 | Bacteria | 722 |
| 342 | Ga0307515_10120642 | 3300028794 | Bacteria | 2973 |
| 343 | Ga0307513_10207643 | 3300031456 | Bacteria | 1793 |
| 344 | Ga0307513_10517354 | 3300031456 | Bacteria | 909 |
| 345 | Ga0307408_101428833 | 3300031548 | Unclassified | 652 |
| 346 | Ga0307412_10152481 | 3300031911 | Bacteria | 1707 |
| 347 | Ga0307412_10369498 | 3300031911 | Bacteria | 1158 |
| 348 | Ga0307409_101551166 | 3300031995 | Bacteria | 690 |
| 349 | Ga0373936_0072512 | 3300035113 | Bacteria | 1422 |
| 350 | Ga0373935_0046316 | 3300035692 | Bacteria | 2746 |
| 351 | Ga0373927_0015494 | 3300035695 | Bacteria | 5036 |
| 352 | Ga0373937_0899291 | 3300036401 | Unclassified | 834 |
| 353 | Ga0373925_0013259 | 3300037068 | Bacteria | 5965 |
| 354 | Ga0451793_0292868 | 3300041452 | Bacteria | 543 |
| 355 | Ga0451802_1833640 | 3300041460 | Bacteria | 698 |
| 356 | Ga0451807_1501387 | 3300041486 | Bacteria | 793 |
| 357 | Ga0451807_2660561 | 3300041486 | Bacteria | 1588 |
| 358 | Ga0451849_0759547 | 3300041505 | Bacteria | 584 |
| 359 | Ga0451849_1258175 | 3300041505 | Unclassified | 541 |
| 360 | Ga0451853_0153484 | 3300041512 | Bacteria | 667 |
| 361 | Ga0451853_1674364 | 3300041512 | Bacteria | 1230 |
| 362 | Ga0451853_3100653 | 3300041512 | Bacteria | 776 |
| 363 | Ga0466972_0315410 | 3300044658 | Bacteria | 730 |
| 364 | Ga0466960_0096566 | 3300044901 | Bacteria | 1515 |
| 365 | Ga0466959_0044576 | 3300045049 | Bacteria | 3268 |
| 366 | Ga0495590_0108005 | 3300046457 | Bacteria | 992 |
| 367 | Ga0495629_0255304 | 3300046459 | Bacteria | 1206 |
| 368 | Ga0495638_0006892 | 3300046460 | Bacteria | 8203 |
| 369 | Ga0495638_0033865 | 3300046460 | Bacteria | 3263 |
| 370 | Ga0495638_0052013 | 3300046460 | Bacteria | 2553 |
| 371 | Ga0495650_0114870 | 3300046471 | Bacteria | 996 |
| 372 | Ga0495650_0256485 | 3300046471 | Bacteria | 593 |
| 373 | Ga0495605_0136715 | 3300046474 | Bacteria | 1102 |
| 374 | Ga0495585_0113374 | 3300046492 | Bacteria | 1440 |
| 375 | Ga0495607_0064480 | 3300046501 | Bacteria | 2069 |
| 376 | Ga0495606_0093431 | 3300046507 | Bacteria | 1845 |
| 377 | Ga0495610_0028346 | 3300046512 | Bacteria | 2962 |
| 378 | Ga0495616_0108849 | 3300046513 | Bacteria | 1289 |
| 379 | Ga0495620_0132100 | 3300046515 | Bacteria | 979 |
| 380 | Ga0495631_0024970 | 3300046518 | Bacteria | 2755 |
| 381 | Ga0495632_0157249 | 3300046519 | Bacteria | 1048 |
| 382 | Ga0495637_0021275 | 3300046520 | Bacteria | 2976 |
| 383 | Ga0495643_0042175 | 3300046522 | Bacteria | 2486 |
| 384 | Ga0495648_0025488 | 3300046524 | Bacteria | 4002 |
| 385 | Ga0495663_0363010 | 3300046525 | Bacteria | 529 |
| 386 | Ga0495654_0028398 | 3300046530 | Bacteria | 2861 |
| 387 | Ga0495598_0098349 | 3300046537 | Bacteria | 964 |
| 388 | Ga0495609_0089867 | 3300046538 | Bacteria | 1336 |
| 389 | Ga0495621_0005678 | 3300046539 | Bacteria | 3602 |
| 390 | Ga0495597_0127938 | 3300046542 | Bacteria | 1055 |
| 391 | Ga0495656_0166304 | 3300046615 | Bacteria | 1075 |
| 392 | Ga0495668_0079394 | 3300046616 | Bacteria | 1801 |
| 393 | Ga0495625_0701491 | 3300046660 | Bacteria | 598 |
| 394 | Ga0495661_0049107 | 3300046665 | Bacteria | 2560 |
| 395 | Ga0495661_0296006 | 3300046665 | Bacteria | 811 |
| 396 | Ga0495588_0031460 | 3300046674 | Bacteria | 2671 |
| 397 | Ga0495670_0033565 | 3300046691 | Bacteria | 2553 |
| 398 | Ga0495671_0049346 | 3300046692 | Bacteria | 2098 |
| 399 | Ga0495589_0173429 | 3300046794 | Bacteria | 1025 |
| 400 | Ga0495660_0064470 | 3300046810 | Bacteria | 1958 |
| 401 | Ga0495604_0977059 | 3300047317 | Bacteria | 525 |
| 402 | Ga0495677_0069821 | 3300047445 | Bacteria | 1309 |
| 403 | Ga0495685_030146 | 3300047447 | Bacteria | 1866 |
| 404 | Ga0495681_0079787 | 3300047470 | Bacteria | 1463 |
| 405 | Ga0495686_0027654 | 3300047472 | Bacteria | 3701 |
| 406 | Ga0495626_0067619 | 3300048091 | Bacteria | 1613 |
| 407 | Ga0496100_0830310 | 3300048903 | Bacteria | 724 |
| 408 | Ga0496102_0479835 | 3300048905 | Bacteria | 1165 |
| 409 | Ga0496104_1538005 | 3300048907 | Bacteria | 568 |
| 410 | Ga0496106_0245838 | 3300048909 | Bacteria | 1430 |
| 411 | Ga0496106_1533602 | 3300048909 | Bacteria | 512 |
| 412 | Ga0496108_0348297 | 3300048911 | Bacteria | 1293 |
| 413 | Ga0496110_0737495 | 3300048913 | Bacteria | 888 |
| 414 | Ga0496111_0510903 | 3300048914 | Bacteria | 884 |
| 415 | Ga0496112_0129869 | 3300048915 | Bacteria | 2491 |
| 416 | Ga0496113_0354080 | 3300048916 | Bacteria | 1178 |
| 417 | Ga0496113_1040619 | 3300048916 | Bacteria | 644 |
| 418 | Ga0496113_1122689 | 3300048916 | Bacteria | 616 |
| 419 | Ga0496114_0902141 | 3300048917 | Bacteria | 765 |
| 420 | Ga0496115_0934660 | 3300048918 | Bacteria | 667 |
| 421 | Ga0496117_0056542 | 3300048920 | Bacteria | 2731 |
| 422 | Ga0496118_0001109 | 3300048921 | Bacteria | 41808 |
| 423 | Ga0496118_0182014 | 3300048921 | Bacteria | 1268 |
| 424 | Ga0496119_0150376 | 3300048922 | Bacteria | 1248 |
| 425 | Ga0496119_0182816 | 3300048922 | Bacteria | 1098 |
| 426 | Ga0496120_0023177 | 3300048923 | Bacteria | 3890 |
| 427 | Ga0496121_0044674 | 3300048924 | Bacteria | 3817 |
| 428 | Ga0496122_0144029 | 3300048925 | Bacteria | 1485 |
| 429 | Ga0496123_0045094 | 3300048926 | Bacteria | 3007 |
| 430 | Ga0496124_0399737 | 3300048927 | Bacteria | 954 |
| 431 | Ga0496125_0004101 | 3300048928 | Bacteria | 17031 |
| 432 | Ga0496126_1159357 | 3300048929 | Bacteria | 570 |
| 433 | Ga0501031_0004379 | 3300049568 | Bacteria | 9146 |
| 434 | Ga0501032_0008869 | 3300049569 | Bacteria | 7312 |
| 435 | Ga0501032_0778965 | 3300049569 | Bacteria | 604 |
| 436 | Ga0501033_0000200 | 3300049570 | Bacteria | 57307 |
| 437 | Ga0501033_0001644 | 3300049570 | Bacteria | 19591 |
| 438 | Ga0501034_0006361 | 3300049571 | Bacteria | 12720 |
| 439 | Ga0501036_0048177 | 3300049572 | Bacteria | 3608 |
| 440 | Ga0501037_0000566 | 3300049573 | Bacteria | 29217 |
| 441 | Ga0501038_0000945 | 3300049574 | Bacteria | 25936 |
| 442 | Ga0501040_0464322 | 3300049576 | Bacteria | 912 |
| 443 | Ga0501042_0148863 | 3300049578 | Bacteria | 1688 |
| 444 | Ga0501043_0003348 | 3300049579 | Bacteria | 13203 |
| 445 | Ga0501043_0104302 | 3300049579 | Bacteria | 2228 |
| 446 | Ga0501046_0029297 | 3300049580 | Bacteria | 4475 |
| 447 | Ga0501046_0051265 | 3300049580 | Bacteria | 3257 |
| 448 | Ga0501047_0007649 | 3300049581 | Bacteria | 10174 |
| 449 | Ga0501047_0210030 | 3300049581 | Bacteria | 1805 |
| 450 | Ga0501047_0541133 | 3300049581 | Bacteria | 989 |
| 451 | Ga0501048_0483701 | 3300049582 | Bacteria | 887 |
| 452 | Ga0501067_0082289 | 3300049583 | Bacteria | 1785 |
| 453 | Ga0501067_0665712 | 3300049583 | Bacteria | 585 |
| 454 | Ga0501068_0033124 | 3300049584 | Bacteria | 3076 |
| 455 | Ga0501069_0466290 | 3300049585 | Bacteria | 752 |
| 456 | Ga0501070_0454972 | 3300049586 | Bacteria | 1032 |
| 457 | Ga0501071_1254957 | 3300049587 | Bacteria | 572 |
| 458 | Ga0501072_0270537 | 3300049588 | Bacteria | 1352 |
| 459 | Ga0501073_0003128 | 3300049589 | Bacteria | 12403 |
| 460 | Ga0501073_0040346 | 3300049589 | Bacteria | 3304 |
| 461 | Ga0501073_0062928 | 3300049589 | Bacteria | 2588 |
| 462 | Ga0501073_0082404 | 3300049589 | Bacteria | 2238 |
| 463 | Ga0501073_0519710 | 3300049589 | Bacteria | 823 |
| 464 | Ga0501074_0232740 | 3300049590 | Bacteria | 1311 |
| 465 | Ga0501075_0757798 | 3300049591 | Bacteria | 739 |
| 466 | Ga0501076_0739470 | 3300049592 | Bacteria | 812 |
| 467 | Ga0501079_0114702 | 3300049741 | Bacteria | 2094 |
| 468 | Ga0501080_0021211 | 3300049742 | Bacteria | 6012 |
| 469 | Ga0501080_0097097 | 3300049742 | Bacteria | 2736 |
| 470 | Ga0501080_0169199 | 3300049742 | Bacteria | 2016 |
| 471 | Ga0501080_0358473 | 3300049742 | Bacteria | 1316 |
| 472 | Ga0501080_0396885 | 3300049742 | Bacteria | 1241 |
| 473 | Ga0501081_0685002 | 3300049743 | Bacteria | 769 |
| 474 | Ga0501035_0004394 | 3300049822 | Bacteria | 13380 |
| 475 | Ga0501035_0088135 | 3300049822 | Bacteria | 2735 |
| 476 | Ga0501044_0015290 | 3300049823 | Bacteria | 8264 |
| 477 | Ga0501044_0018437 | 3300049823 | Bacteria | 7477 |
| 478 | Ga0501044_0259771 | 3300049823 | Bacteria | 1675 |
| 479 | Ga0501044_0358801 | 3300049823 | Bacteria | 1376 |
| 480 | nmdc:mga03683_135925_c1 | 3300050489 | Bacteria | 1103 |
| 481 | nmdc:mga03683_166481_c1 | 3300050489 | Bacteria | 1000 |
| 482 | nmdc:mga03683_72547_c1 | 3300050489 | Bacteria | 859 |
| 483 | nmdc:mga03683_99461_c1 | 3300050489 | Bacteria | 1277 |
| 484 | nmdc:mga03n38_11525_c1 | 3300050490 | Bacteria | 3297 |
| 485 | nmdc:mga03n38_228242_c1 | 3300050490 | Bacteria | 975 |
| 486 | nmdc:mga03n38_384_c1 | 3300050490 | Bacteria | 6500 |
| 487 | nmdc:mga00v17_158387_c1 | 3300050491 | Bacteria | 1457 |
| 488 | nmdc:mga00v17_199780_c1 | 3300050491 | Bacteria | 1292 |
| 489 | nmdc:mga0yw44_147266_c1 | 3300050492 | Bacteria | 1534 |
| 490 | nmdc:mga0yw44_184318_c1 | 3300050492 | Bacteria | 1375 |
| 491 | nmdc:mga0yw44_267276_c1 | 3300050492 | Bacteria | 1141 |
| 492 | nmdc:mga0yw44_27688_c1 | 3300050492 | Bacteria | 3251 |
| 493 | nmdc:mga0yw44_48372_c1 | 3300050492 | Bacteria | 2564 |
| 494 | nmdc:mga0k408_688630_c1 | 3300050493 | Bacteria | 599 |
| 495 | nmdc:mga0k408_697879_c1 | 3300050493 | Bacteria | 595 |
| 496 | nmdc:mga06z11_17062_c1 | 3300050494 | Bacteria | 3286 |
| 497 | nmdc:mga04h51_14032_c1 | 3300050495 | Bacteria | 2281 |
| 498 | nmdc:mga04h51_15692_c1 | 3300050495 | Bacteria | 2186 |
| 499 | nmdc:mga07m45_126949_c1 | 3300050496 | Bacteria | 1475 |
| 500 | nmdc:mga07m45_137022_c1 | 3300050496 | Bacteria | 1417 |
| 501 | nmdc:mga07m45_39256_c1 | 3300050496 | Bacteria | 2645 |
| 502 | nmdc:mga05p37_1115446_c1 | 3300050507 | Bacteria | 824 |
| 503 | nmdc:mga05p37_96689_c1 | 3300050507 | Bacteria | 3638 |
| 504 | nmdc:mga06r32_249527_c1 | 3300050510 | Bacteria | 1762 |
| 505 | nmdc:mga08y16_144158_c1 | 3300050511 | Bacteria | 2476 |
| 506 | nmdc:mga08y16_552234_c1 | 3300050511 | Bacteria | 1165 |
| 507 | nmdc:mga08y16_607874_c1 | 3300050511 | Bacteria | 1101 |
| 508 | nmdc:mga0n895_2145012_c1 | 3300050512 | Bacteria | 515 |
| 509 | nmdc:mga0a205_714356_c1 | 3300050515 | Bacteria | 852 |
| 510 | nmdc:mga0sz30_33644_c1 | 3300050516 | Bacteria | 1247 |
| 511 | nmdc:mga0sz30_450723_c1 | 3300050516 | Bacteria | 578 |
| 512 | Ga0500610_0437028 | 3300053079 | Bacteria | 518 |
| 513 | Ga0500578_0245287 | 3300053086 | Bacteria | 1081 |
| 514 | Ga0500643_027031 | 3300053087 | Bacteria | 1789 |
| 515 | Ga0500644_0041965 | 3300053088 | Bacteria | 1522 |
| 516 | Ga0500644_0314341 | 3300053088 | Bacteria | 672 |
| 517 | Ga0500581_162047 | 3300053089 | Bacteria | 1037 |
| 518 | Ga0500646_0088706 | 3300053090 | Bacteria | 954 |
| 519 | Ga0500646_0179243 | 3300053090 | Bacteria | 717 |
| 520 | Ga0500583_0524954 | 3300053092 | Bacteria | 553 |
| 521 | Ga0500651_0075990 | 3300053093 | Bacteria | 2086 |
| 522 | Ga0500566_0000748 | 3300053094 | Bacteria | 18276 |
| 523 | Ga0500641_0009093 | 3300053096 | Bacteria | 3563 |
| 524 | Ga0500641_0010726 | 3300053096 | Bacteria | 3318 |
| 525 | Ga0500641_0130267 | 3300053096 | Bacteria | 1085 |
| 526 | Ga0500650_0022536 | 3300053098 | Bacteria | 2788 |
| 527 | Ga0500554_135733 | 3300053102 | Bacteria | 831 |
| 528 | Ga0500556_0000051 | 3300053104 | Bacteria | 119031 |
| 529 | Ga0500562_021545 | 3300053108 | Bacteria | 1677 |
| 530 | Ga0500569_064470 | 3300053109 | Bacteria | 1138 |
| 531 | Ga0500592_011519 | 3300053116 | Bacteria | 1414 |
| 532 | Ga0500593_079511 | 3300053117 | Bacteria | 1408 |
| 533 | Ga0500594_0007599 | 3300053118 | Bacteria | 2454 |
| 534 | Ga0500595_019433 | 3300053119 | Bacteria | 2465 |
| 535 | Ga0500608_003839 | 3300053122 | Bacteria | 5722 |
| 536 | Ga0500642_0000041 | 3300053130 | Bacteria | 89564 |
| 537 | Ga0500652_000015 | 3300053131 | Bacteria | 131012 |
| 538 | Ga0500658_0159505 | 3300053134 | Bacteria | 1020 |
| 539 | Ga0500559_0000188 | 3300053136 | Bacteria | 49358 |
| 540 | Ga0500564_164527 | 3300053138 | Bacteria | 937 |
| 541 | Ga0500568_0154255 | 3300053139 | Bacteria | 849 |
| 542 | Ga0500588_0029782 | 3300053146 | Bacteria | 1560 |
| 543 | Ga0500588_0243784 | 3300053146 | Bacteria | 674 |
| 544 | Ga0500604_0008743 | 3300053151 | Bacteria | 2690 |
| 545 | Ga0500604_0162957 | 3300053151 | Bacteria | 760 |
| 546 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 547 | Ga0500619_081608 | 3300053154 | Bacteria | 1086 |
| 548 | Ga0500622_0009784 | 3300053156 | Bacteria | 5292 |
| 549 | Ga0500627_0051387 | 3300053158 | Bacteria | 1797 |
| 550 | Ga0500633_0036255 | 3300053160 | Bacteria | 1629 |
| 551 | Ga0500636_0031063 | 3300053177 | Bacteria | 3161 |
| 552 | Ga0500611_014010 | 3300053727 | Bacteria | 1390 |
| 553 | Ga0500645_019029 | 3300053730 | Bacteria | 2139 |
| 554 | Ga0501084_1089379 | 3300054114 | Bacteria | 671 |
| 555 | Ga0501082_0661886 | 3300060353 | Bacteria | 914 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025910 | Ga0207684_10502318 | Ga0207684_105023182 | 105 |
| 2 | 3300002244 | JGI24742J22300_10010176 | JGI24742J22300_100101762 | 110 |
| 3 | 3300005293 | Ga0065715_10199080 | Ga0065715_101990802 | 110 |
| 4 | 3300005328 | Ga0070676_10044304 | Ga0070676_100443042 | 110 |
| 5 | 3300005330 | Ga0070690_100087579 | Ga0070690_1000875794 | 110 |
| 6 | 3300005333 | Ga0070677_10006580 | Ga0070677_100065805 | 110 |
| 7 | 3300005335 | Ga0070666_10215893 | Ga0070666_102158932 | 110 |
| 8 | 3300005338 | Ga0068868_100602253 | Ga0068868_1006022532 | 110 |
| 9 | 3300005339 | Ga0070660_100673398 | Ga0070660_1006733982 | 110 |
| 10 | 3300005343 | Ga0070687_100363521 | Ga0070687_1003635212 | 110 |
| 11 | 3300005353 | Ga0070669_100249621 | Ga0070669_1002496212 | 110 |
| 12 | 3300005354 | Ga0070675_100096376 | Ga0070675_1000963762 | 110 |
| 13 | 3300005355 | Ga0070671_100046211 | Ga0070671_1000462113 | 110 |
| 14 | 3300005356 | Ga0070674_100037254 | Ga0070674_1000372542 | 110 |
| 15 | 3300005364 | Ga0070673_100229692 | Ga0070673_1002296923 | 110 |
| 16 | 3300005365 | Ga0070688_100022928 | Ga0070688_1000229284 | 110 |
| 17 | 3300005367 | Ga0070667_100193896 | Ga0070667_1001938963 | 110 |
| 18 | 3300005438 | Ga0070701_10107477 | Ga0070701_101074772 | 110 |
| 19 | 3300005456 | Ga0070678_100076855 | Ga0070678_1000768552 | 110 |
| 20 | 3300005457 | Ga0070662_100162997 | Ga0070662_1001629973 | 110 |
| 21 | 3300005459 | Ga0068867_100063416 | Ga0068867_1000634164 | 110 |
| 22 | 3300005466 | Ga0070685_10045269 | Ga0070685_100452692 | 110 |
| 23 | 3300005543 | Ga0070672_100110945 | Ga0070672_1001109452 | 110 |
| 24 | 3300005544 | Ga0070686_100006631 | Ga0070686_1000066314 | 110 |
| 25 | 3300005548 | Ga0070665_100288753 | Ga0070665_1002887532 | 110 |
| 26 | 3300005564 | Ga0070664_101348717 | Ga0070664_1013487172 | 110 |
| 27 | 3300005615 | Ga0070702_100093099 | Ga0070702_1000930993 | 110 |
| 28 | 3300005718 | Ga0068866_10015940 | Ga0068866_100159402 | 110 |
| 29 | 3300005843 | Ga0068860_100392350 | Ga0068860_1003923502 | 110 |
| 30 | 3300006237 | Ga0097621_100114636 | Ga0097621_1001146363 | 110 |
| 31 | 3300006358 | Ga0068871_100291569 | Ga0068871_1002915692 | 110 |
| 32 | 3300006881 | Ga0068865_100127010 | Ga0068865_1001270102 | 110 |
| 33 | 3300009094 | Ga0111539_10085412 | Ga0111539_100854122 | 110 |
| 34 | 3300009148 | Ga0105243_11008717 | Ga0105243_110087172 | 110 |
| 35 | 3300009176 | Ga0105242_10384139 | Ga0105242_103841392 | 110 |
| 36 | 3300011119 | Ga0105246_11630428 | Ga0105246_116304282 | 110 |
| 37 | 3300013296 | Ga0157374_10163667 | Ga0157374_101636674 | 110 |
| 38 | 3300013297 | Ga0157378_10037250 | Ga0157378_100372504 | 110 |
| 39 | 3300013306 | Ga0163162_12289282 | Ga0163162_122892821 | 110 |
| 40 | 3300013308 | Ga0157375_10476771 | Ga0157375_104767712 | 110 |
| 41 | 3300014326 | Ga0157380_10030880 | Ga0157380_100308802 | 110 |
| 42 | 3300014969 | Ga0157376_10499007 | Ga0157376_104990072 | 110 |
| 43 | 3300025315 | Ga0207697_10191464 | Ga0207697_101914642 | 110 |
| 44 | 3300025893 | Ga0207682_10002754 | Ga0207682_1000275413 | 110 |
| 45 | 3300025899 | Ga0207642_10254815 | Ga0207642_102548152 | 110 |
| 46 | 3300025901 | Ga0207688_10023072 | Ga0207688_100230724 | 110 |
| 47 | 3300025903 | Ga0207680_10035202 | Ga0207680_100352024 | 110 |
| 48 | 3300025907 | Ga0207645_10051463 | Ga0207645_100514634 | 110 |
| 49 | 3300025918 | Ga0207662_10580603 | Ga0207662_105806032 | 110 |
| 50 | 3300025923 | Ga0207681_10166398 | Ga0207681_101663983 | 110 |
| 51 | 3300025925 | Ga0207650_10760609 | Ga0207650_107606092 | 110 |
| 52 | 3300025926 | Ga0207659_10140371 | Ga0207659_101403712 | 110 |
| 53 | 3300025933 | Ga0207706_10569441 | Ga0207706_105694412 | 110 |
| 54 | 3300025936 | Ga0207670_10152529 | Ga0207670_101525292 | 110 |
| 55 | 3300025937 | Ga0207669_10005673 | Ga0207669_100056736 | 110 |
| 56 | 3300025938 | Ga0207704_10185410 | Ga0207704_101854102 | 110 |
| 57 | 3300025940 | Ga0207691_10053251 | Ga0207691_100532513 | 110 |
| 58 | 3300025960 | Ga0207651_10442664 | Ga0207651_104426642 | 110 |
| 59 | 3300025961 | Ga0207712_11599869 | Ga0207712_115998692 | 110 |
| 60 | 3300025972 | Ga0207668_11291666 | Ga0207668_112916662 | 110 |
| 61 | 3300025986 | Ga0207658_10046785 | Ga0207658_100467852 | 110 |
| 62 | 3300026023 | Ga0207677_11729460 | Ga0207677_117294602 | 110 |
| 63 | 3300026089 | Ga0207648_10006450 | Ga0207648_100064506 | 110 |
| 64 | 3300026118 | Ga0207675_100432838 | Ga0207675_1004328381 | 110 |
| 65 | 3300026121 | Ga0207683_10005312 | Ga0207683_100053122 | 110 |
| 66 | 3300046525 | Ga0495663_0363010 | Ga0495663_0363010_32_391 | 110 |
| 67 | 3300046537 | Ga0495598_0098349 | Ga0495598_0098349_32_391 | 110 |
| 68 | 3300046539 | Ga0495621_0005678 | Ga0495621_0005678_2874_3233 | 110 |
| 69 | 3300046615 | Ga0495656_0166304 | Ga0495656_0166304_413_772 | 110 |
| 70 | 3300047447 | Ga0495685_030146 | Ga0495685_030146_1364_1723 | 110 |
| 71 | 3300049587 | Ga0501071_1254957 | Ga0501071_1254957_10_342 | 110 |
| 72 | 3300050511 | nmdc:mga08y16_607874_c1 | nmdc:mga08y16_607874_c1_494_853 | 110 |
| 73 | 3300049743 | Ga0501081_0685002 | Ga0501081_0685002_23_358 | 111 |
| 74 | 3300005327 | Ga0070658_10026704 | Ga0070658_100267042 | 115 |
| 75 | 3300005337 | Ga0070682_100695417 | Ga0070682_1006954171 | 115 |
| 76 | 3300005339 | Ga0070660_100216289 | Ga0070660_1002162893 | 115 |
| 77 | 3300005344 | Ga0070661_100249070 | Ga0070661_1002490702 | 115 |
| 78 | 3300005366 | Ga0070659_100739425 | Ga0070659_1007394251 | 115 |
| 79 | 3300005455 | Ga0070663_100063389 | Ga0070663_1000633894 | 115 |
| 80 | 3300005539 | Ga0068853_100766640 | Ga0068853_1007666401 | 115 |
| 81 | 3300005547 | Ga0070693_100646475 | Ga0070693_1006464752 | 115 |
| 82 | 3300005578 | Ga0068854_100551653 | Ga0068854_1005516532 | 115 |
| 83 | 3300005616 | Ga0068852_100099423 | Ga0068852_1000994234 | 115 |
| 84 | 3300006038 | Ga0075365_10545795 | Ga0075365_105457952 | 115 |
| 85 | 3300009545 | Ga0105237_12002827 | Ga0105237_120028271 | 115 |
| 86 | 3300013104 | Ga0157370_10236344 | Ga0157370_102363444 | 115 |
| 87 | 3300025909 | Ga0207705_10204036 | Ga0207705_102040363 | 115 |
| 88 | 3300025981 | Ga0207640_10137351 | Ga0207640_101373512 | 115 |
| 89 | 3300026041 | Ga0207639_10347166 | Ga0207639_103471662 | 115 |
| 90 | 3300026067 | Ga0207678_10056858 | Ga0207678_100568585 | 115 |
| 91 | 3300026078 | Ga0207702_10341886 | Ga0207702_103418861 | 115 |
| 92 | 3300026142 | Ga0207698_10254466 | Ga0207698_102544661 | 115 |
| 93 | 3300041460 | Ga0451802_1833640 | Ga0451802_1833640_288_650 | 115 |
| 94 | 3300041486 | Ga0451807_1501387 | Ga0451807_1501387_95_457 | 115 |
| 95 | 3300047317 | Ga0495604_0977059 | Ga0495604_0977059_11_373 | 115 |
| 96 | 3300050492 | nmdc:mga0yw44_267276_c1 | nmdc:mga0yw44_267276_c1_395_760 | 115 |
| 97 | 3300050516 | nmdc:mga0sz30_33644_c1 | nmdc:mga0sz30_33644_c1_147_512 | 115 |
| 98 | iso_pu_bacteria | 8056681323 | 8056688030 | 115 |
| 99 | 3300006195 | Ga0075366_10775074 | Ga0075366_107750741 | 116 |
| 100 | 3300050493 | nmdc:mga0k408_697879_c1 | nmdc:mga0k408_697879_c1_82_432 | 116 |
| 101 | 3300005445 | Ga0070708_100168325 | Ga0070708_1001683253 | 117 |
| 102 | 3300005468 | Ga0070707_100378842 | Ga0070707_1003788422 | 117 |
| 103 | 3300005471 | Ga0070698_100289629 | Ga0070698_1002896292 | 117 |
| 104 | 3300005518 | Ga0070699_100318381 | Ga0070699_1003183812 | 117 |
| 105 | 3300005539 | Ga0068853_100001086 | Ga0068853_1000010868 | 117 |
| 106 | 3300005563 | Ga0068855_100058405 | Ga0068855_1000584052 | 117 |
| 107 | 3300005577 | Ga0068857_100526388 | Ga0068857_1005263882 | 117 |
| 108 | 3300005834 | Ga0068851_10260087 | Ga0068851_102600871 | 117 |
| 109 | 3300009545 | Ga0105237_10574065 | Ga0105237_105740651 | 117 |
| 110 | 3300009553 | Ga0105249_12828147 | Ga0105249_128281472 | 117 |
| 111 | 3300010375 | Ga0105239_10001596 | Ga0105239_1000159622 | 117 |
| 112 | 3300013100 | Ga0157373_11052053 | Ga0157373_110520532 | 117 |
| 113 | 3300014968 | Ga0157379_10738657 | Ga0157379_107386572 | 117 |
| 114 | 3300025303 | Ga0209051_1010188 | Ga0209051_10101883 | 117 |
| 115 | 3300025904 | Ga0207647_10231907 | Ga0207647_102319072 | 117 |
| 116 | 3300025914 | Ga0207671_10819000 | Ga0207671_108190001 | 117 |
| 117 | 3300025922 | Ga0207646_10204575 | Ga0207646_102045753 | 117 |
| 118 | 3300025949 | Ga0207667_10042319 | Ga0207667_100423196 | 117 |
| 119 | 3300026041 | Ga0207639_10014582 | Ga0207639_100145826 | 117 |
| 120 | 3300026116 | Ga0207674_10018067 | Ga0207674_100180674 | 117 |
| 121 | 3300031548 | Ga0307408_101428833 | Ga0307408_1014288332 | 117 |
| 122 | 3300031911 | Ga0307412_10369498 | Ga0307412_103694981 | 117 |
| 123 | 3300041512 | Ga0451853_0153484 | Ga0451853_0153484_41_445 | 117 |
| 124 | 3300045049 | Ga0466959_0044576 | Ga0466959_0044576_1796_2149 | 117 |
| 125 | 3300048909 | Ga0496106_0245838 | Ga0496106_0245838_894_1253 | 117 |
| 126 | 3300048917 | Ga0496114_0902141 | Ga0496114_0902141_394_753 | 117 |
| 127 | 3300048921 | Ga0496118_0001109 | Ga0496118_0001109_26918_27271 | 117 |
| 128 | 3300049568 | Ga0501031_0004379 | Ga0501031_0004379_7291_7644 | 117 |
| 129 | 3300049569 | Ga0501032_0008869 | Ga0501032_0008869_6390_6743 | 117 |
| 130 | 3300049570 | Ga0501033_0001644 | Ga0501033_0001644_7148_7501 | 117 |
| 131 | 3300049571 | Ga0501034_0006361 | Ga0501034_0006361_12133_12486 | 117 |
| 132 | 3300049572 | Ga0501036_0048177 | Ga0501036_0048177_687_1040 | 117 |
| 133 | 3300049573 | Ga0501037_0000566 | Ga0501037_0000566_21794_22147 | 117 |
| 134 | 3300049574 | Ga0501038_0000945 | Ga0501038_0000945_13131_13484 | 117 |
| 135 | 3300049579 | Ga0501043_0003348 | Ga0501043_0003348_11873_12226 | 117 |
| 136 | 3300049580 | Ga0501046_0029297 | Ga0501046_0029297_2920_3273 | 117 |
| 137 | 3300049581 | Ga0501047_0007649 | Ga0501047_0007649_5024_5377 | 117 |
| 138 | 3300049583 | Ga0501067_0082289 | Ga0501067_0082289_774_1127 | 117 |
| 139 | 3300049584 | Ga0501068_0033124 | Ga0501068_0033124_1391_1744 | 117 |
| 140 | 3300049588 | Ga0501072_0270537 | Ga0501072_0270537_179_532 | 117 |
| 141 | 3300049589 | Ga0501073_0003128 | Ga0501073_0003128_3763_4116 | 117 |
| 142 | 3300049591 | Ga0501075_0757798 | Ga0501075_0757798_28_381 | 117 |
| 143 | 3300049742 | Ga0501080_0021211 | Ga0501080_0021211_1000_1353 | 117 |
| 144 | 3300049822 | Ga0501035_0004394 | Ga0501035_0004394_8049_8402 | 117 |
| 145 | 3300049823 | Ga0501044_0018437 | Ga0501044_0018437_4011_4364 | 117 |
| 146 | 3300054114 | Ga0501084_1089379 | Ga0501084_1089379_222_575 | 117 |
| 147 | 3300003203 | JGI25406J46586_10001293 | JGI25406J46586_100012934 | 118 |
| 148 | 3300005843 | Ga0068860_100065274 | Ga0068860_1000652742 | 118 |
| 149 | 3300005985 | Ga0081539_10000016 | Ga0081539_1000001610 | 118 |
| 150 | 3300028381 | Ga0268264_10047966 | Ga0268264_100479664 | 118 |
| 151 | 3300035113 | Ga0373936_0072512 | Ga0373936_0072512_632_988 | 118 |
| 152 | 3300044658 | Ga0466972_0315410 | Ga0466972_0315410_322_681 | 118 |
| 153 | 3300044901 | Ga0466960_0096566 | Ga0466960_0096566_64_423 | 118 |
| 154 | 3300049586 | Ga0501070_0454972 | Ga0501070_0454972_438_794 | 118 |
| 155 | 3300049589 | Ga0501073_0062928 | Ga0501073_0062928_1205_1561 | 118 |
| 156 | 3300049590 | Ga0501074_0232740 | Ga0501074_0232740_401_757 | 118 |
| 157 | 3300049592 | Ga0501076_0739470 | Ga0501076_0739470_288_650 | 118 |
| 158 | 3300049741 | Ga0501079_0114702 | Ga0501079_0114702_1562_1918 | 118 |
| 159 | 3300049742 | Ga0501080_0097097 | Ga0501080_0097097_1717_2073 | 118 |
| 160 | 3300049742 | Ga0501080_0396885 | Ga0501080_0396885_81_437 | 118 |
| 161 | 3300050489 | nmdc:mga03683_99461_c1 | nmdc:mga03683_99461_c1_821_1177 | 118 |
| 162 | 3300053119 | Ga0500595_019433 | Ga0500595_019433_2068_2427 | 118 |
| 163 | 3300053131 | Ga0500652_000015 | Ga0500652_000015_77018_77377 | 118 |
| 164 | 3300053177 | Ga0500636_0031063 | Ga0500636_0031063_1587_1946 | 118 |
| 165 | 3300002075 | JGI24738J21930_10079763 | JGI24738J21930_100797632 | 119 |
| 166 | 3300005289 | Ga0065704_10285897 | Ga0065704_102858972 | 119 |
| 167 | 3300005295 | Ga0065707_10372585 | Ga0065707_103725851 | 119 |
| 168 | 3300005295 | Ga0065707_10630501 | Ga0065707_106305012 | 119 |
| 169 | 3300005328 | Ga0070676_10048407 | Ga0070676_100484073 | 119 |
| 170 | 3300005328 | Ga0070676_10181155 | Ga0070676_101811552 | 119 |
| 171 | 3300005330 | Ga0070690_100156573 | Ga0070690_1001565732 | 119 |
| 172 | 3300005331 | Ga0070670_100004813 | Ga0070670_10000481312 | 119 |
| 173 | 3300005331 | Ga0070670_100040299 | Ga0070670_1000402994 | 119 |
| 174 | 3300005331 | Ga0070670_100744677 | Ga0070670_1007446772 | 119 |
| 175 | 3300005334 | Ga0068869_100146345 | Ga0068869_1001463451 | 119 |
| 176 | 3300005334 | Ga0068869_100415375 | Ga0068869_1004153752 | 119 |
| 177 | 3300005336 | Ga0070680_100133393 | Ga0070680_1001333932 | 119 |
| 178 | 3300005337 | Ga0070682_100498682 | Ga0070682_1004986821 | 119 |
| 179 | 3300005338 | Ga0068868_100161991 | Ga0068868_1001619913 | 119 |
| 180 | 3300005338 | Ga0068868_101349763 | Ga0068868_1013497632 | 119 |
| 181 | 3300005339 | Ga0070660_101301510 | Ga0070660_1013015101 | 119 |
| 182 | 3300005340 | Ga0070689_100132559 | Ga0070689_1001325593 | 119 |
| 183 | 3300005340 | Ga0070689_100479077 | Ga0070689_1004790772 | 119 |
| 184 | 3300005340 | Ga0070689_101298603 | Ga0070689_1012986031 | 119 |
| 185 | 3300005340 | Ga0070689_101980734 | Ga0070689_1019807341 | 119 |
| 186 | 3300005344 | Ga0070661_101191285 | Ga0070661_1011912851 | 119 |
| 187 | 3300005345 | Ga0070692_10853791 | Ga0070692_108537912 | 119 |
| 188 | 3300005347 | Ga0070668_100018714 | Ga0070668_1000187144 | 119 |
| 189 | 3300005347 | Ga0070668_100321066 | Ga0070668_1003210662 | 119 |
| 190 | 3300005353 | Ga0070669_100280047 | Ga0070669_1002800472 | 119 |
| 191 | 3300005353 | Ga0070669_100675155 | Ga0070669_1006751551 | 119 |
| 192 | 3300005354 | Ga0070675_100205283 | Ga0070675_1002052832 | 119 |
| 193 | 3300005355 | Ga0070671_100014163 | Ga0070671_1000141639 | 119 |
| 194 | 3300005355 | Ga0070671_100524177 | Ga0070671_1005241771 | 119 |
| 195 | 3300005355 | Ga0070671_100796873 | Ga0070671_1007968732 | 119 |
| 196 | 3300005356 | Ga0070674_100188498 | Ga0070674_1001884982 | 119 |
| 197 | 3300005356 | Ga0070674_100295357 | Ga0070674_1002953572 | 119 |
| 198 | 3300005356 | Ga0070674_100317957 | Ga0070674_1003179572 | 119 |
| 199 | 3300005356 | Ga0070674_100642367 | Ga0070674_1006423671 | 119 |
| 200 | 3300005364 | Ga0070673_100019735 | Ga0070673_1000197357 | 119 |
| 201 | 3300005364 | Ga0070673_100104198 | Ga0070673_1001041984 | 119 |
| 202 | 3300005365 | Ga0070688_100020065 | Ga0070688_1000200656 | 119 |
| 203 | 3300005366 | Ga0070659_101580875 | Ga0070659_1015808751 | 119 |
| 204 | 3300005367 | Ga0070667_100286722 | Ga0070667_1002867223 | 119 |
| 205 | 3300005438 | Ga0070701_10227590 | Ga0070701_102275902 | 119 |
| 206 | 3300005441 | Ga0070700_100365427 | Ga0070700_1003654272 | 119 |
| 207 | 3300005441 | Ga0070700_100541055 | Ga0070700_1005410551 | 119 |
| 208 | 3300005455 | Ga0070663_100486514 | Ga0070663_1004865142 | 119 |
| 209 | 3300005456 | Ga0070678_100231485 | Ga0070678_1002314851 | 119 |
| 210 | 3300005459 | Ga0068867_100229962 | Ga0068867_1002299622 | 119 |
| 211 | 3300005466 | Ga0070685_10315486 | Ga0070685_103154862 | 119 |
| 212 | 3300005466 | Ga0070685_10332225 | Ga0070685_103322251 | 119 |
| 213 | 3300005539 | Ga0068853_100542210 | Ga0068853_1005422102 | 119 |
| 214 | 3300005543 | Ga0070672_100040734 | Ga0070672_1000407344 | 119 |
| 215 | 3300005543 | Ga0070672_100158395 | Ga0070672_1001583952 | 119 |
| 216 | 3300005543 | Ga0070672_100692745 | Ga0070672_1006927451 | 119 |
| 217 | 3300005545 | Ga0070695_101017095 | Ga0070695_1010170952 | 119 |
| 218 | 3300005547 | Ga0070693_100083992 | Ga0070693_1000839923 | 119 |
| 219 | 3300005548 | Ga0070665_100547656 | Ga0070665_1005476561 | 119 |
| 220 | 3300005549 | Ga0070704_101102753 | Ga0070704_1011027531 | 119 |
| 221 | 3300005564 | Ga0070664_100525004 | Ga0070664_1005250042 | 119 |
| 222 | 3300005564 | Ga0070664_101238848 | Ga0070664_1012388482 | 119 |
| 223 | 3300005577 | Ga0068857_100275168 | Ga0068857_1002751682 | 119 |
| 224 | 3300005577 | Ga0068857_100816610 | Ga0068857_1008166102 | 119 |
| 225 | 3300005578 | Ga0068854_100509521 | Ga0068854_1005095212 | 119 |
| 226 | 3300005615 | Ga0070702_100038593 | Ga0070702_1000385932 | 119 |
| 227 | 3300005615 | Ga0070702_100406950 | Ga0070702_1004069502 | 119 |
| 228 | 3300005616 | Ga0068852_102096782 | Ga0068852_1020967821 | 119 |
| 229 | 3300005616 | Ga0068852_102590209 | Ga0068852_1025902091 | 119 |
| 230 | 3300005617 | Ga0068859_100169406 | Ga0068859_1001694063 | 119 |
| 231 | 3300005618 | Ga0068864_100000918 | Ga0068864_1000009183 | 119 |
| 232 | 3300005618 | Ga0068864_100017967 | Ga0068864_1000179674 | 119 |
| 233 | 3300005618 | Ga0068864_100036622 | Ga0068864_1000366222 | 119 |
| 234 | 3300005718 | Ga0068866_10186634 | Ga0068866_101866342 | 119 |
| 235 | 3300005719 | Ga0068861_100679586 | Ga0068861_1006795862 | 119 |
| 236 | 3300005834 | Ga0068851_10457987 | Ga0068851_104579871 | 119 |
| 237 | 3300005840 | Ga0068870_10867494 | Ga0068870_108674942 | 119 |
| 238 | 3300005841 | Ga0068863_100003461 | Ga0068863_10000346124 | 119 |
| 239 | 3300005841 | Ga0068863_100026752 | Ga0068863_1000267526 | 119 |
| 240 | 3300005841 | Ga0068863_100205838 | Ga0068863_1002058382 | 119 |
| 241 | 3300005842 | Ga0068858_100226117 | Ga0068858_1002261174 | 119 |
| 242 | 3300005842 | Ga0068858_100913875 | Ga0068858_1009138752 | 119 |
| 243 | 3300005843 | Ga0068860_100023855 | Ga0068860_1000238559 | 119 |
| 244 | 3300005844 | Ga0068862_100195625 | Ga0068862_1001956253 | 119 |
| 245 | 3300005844 | Ga0068862_101275955 | Ga0068862_1012759552 | 119 |
| 246 | 3300005844 | Ga0068862_102439150 | Ga0068862_1024391501 | 119 |
| 247 | 3300005985 | Ga0081539_10179255 | Ga0081539_101792552 | 119 |
| 248 | 3300005985 | Ga0081539_10256131 | Ga0081539_102561311 | 119 |
| 249 | 3300006038 | Ga0075365_10055881 | Ga0075365_100558812 | 119 |
| 250 | 3300006038 | Ga0075365_10247229 | Ga0075365_102472291 | 119 |
| 251 | 3300006038 | Ga0075365_10973531 | Ga0075365_109735312 | 119 |
| 252 | 3300006038 | Ga0075365_11032486 | Ga0075365_110324862 | 119 |
| 253 | 3300006042 | Ga0075368_10006328 | Ga0075368_100063283 | 119 |
| 254 | 3300006042 | Ga0075368_10012958 | Ga0075368_100129584 | 119 |
| 255 | 3300006048 | Ga0075363_100001611 | Ga0075363_1000016118 | 119 |
| 256 | 3300006048 | Ga0075363_100043677 | Ga0075363_1000436773 | 119 |
| 257 | 3300006048 | Ga0075363_100588424 | Ga0075363_1005884242 | 119 |
| 258 | 3300006051 | Ga0075364_10072514 | Ga0075364_100725145 | 119 |
| 259 | 3300006051 | Ga0075364_10157188 | Ga0075364_101571882 | 119 |
| 260 | 3300006051 | Ga0075364_11022925 | Ga0075364_110229252 | 119 |
| 261 | 3300006177 | Ga0075362_10158700 | Ga0075362_101587002 | 119 |
| 262 | 3300006177 | Ga0075362_10162288 | Ga0075362_101622881 | 119 |
| 263 | 3300006177 | Ga0075362_10402315 | Ga0075362_104023151 | 119 |
| 264 | 3300006178 | Ga0075367_10005985 | Ga0075367_100059855 | 119 |
| 265 | 3300006178 | Ga0075367_10047413 | Ga0075367_100474135 | 119 |
| 266 | 3300006178 | Ga0075367_10220457 | Ga0075367_102204572 | 119 |
| 267 | 3300006178 | Ga0075367_10386795 | Ga0075367_103867951 | 119 |
| 268 | 3300006186 | Ga0075369_10047323 | Ga0075369_100473233 | 119 |
| 269 | 3300006186 | Ga0075369_10340664 | Ga0075369_103406642 | 119 |
| 270 | 3300006195 | Ga0075366_10009517 | Ga0075366_100095172 | 119 |
| 271 | 3300006195 | Ga0075366_10027157 | Ga0075366_100271573 | 119 |
| 272 | 3300006195 | Ga0075366_10132422 | Ga0075366_101324222 | 119 |
| 273 | 3300006237 | Ga0097621_100923523 | Ga0097621_1009235232 | 119 |
| 274 | 3300006353 | Ga0075370_10052249 | Ga0075370_100522492 | 119 |
| 275 | 3300006353 | Ga0075370_10085555 | Ga0075370_100855552 | 119 |
| 276 | 3300006358 | Ga0068871_100530920 | Ga0068871_1005309202 | 119 |
| 277 | 3300006358 | Ga0068871_100675136 | Ga0068871_1006751362 | 119 |
| 278 | 3300006844 | Ga0075428_100057924 | Ga0075428_1000579243 | 119 |
| 279 | 3300006844 | Ga0075428_100124215 | Ga0075428_1001242153 | 119 |
| 280 | 3300006847 | Ga0075431_100991483 | Ga0075431_1009914832 | 119 |
| 281 | 3300006847 | Ga0075431_101981159 | Ga0075431_1019811591 | 119 |
| 282 | 3300006852 | Ga0075433_10638400 | Ga0075433_106384001 | 119 |
| 283 | 3300006871 | Ga0075434_101351577 | Ga0075434_1013515772 | 119 |
| 284 | 3300006931 | Ga0097620_100169410 | Ga0097620_1001694103 | 119 |
| 285 | 3300009011 | Ga0105251_10198545 | Ga0105251_101985452 | 119 |
| 286 | 3300009036 | Ga0105244_10186777 | Ga0105244_101867771 | 119 |
| 287 | 3300009093 | Ga0105240_11292208 | Ga0105240_112922082 | 119 |
| 288 | 3300009094 | Ga0111539_10002972 | Ga0111539_1000297219 | 119 |
| 289 | 3300009098 | Ga0105245_10083658 | Ga0105245_100836582 | 119 |
| 290 | 3300009098 | Ga0105245_10573752 | Ga0105245_105737522 | 119 |
| 291 | 3300009098 | Ga0105245_10627849 | Ga0105245_106278492 | 119 |
| 292 | 3300009147 | Ga0114129_10069655 | Ga0114129_100696558 | 119 |
| 293 | 3300009147 | Ga0114129_11671415 | Ga0114129_116714152 | 119 |
| 294 | 3300009147 | Ga0114129_11945208 | Ga0114129_119452082 | 119 |
| 295 | 3300009148 | Ga0105243_10071650 | Ga0105243_100716504 | 119 |
| 296 | 3300009176 | Ga0105242_10077074 | Ga0105242_100770744 | 119 |
| 297 | 3300009177 | Ga0105248_10907257 | Ga0105248_109072572 | 119 |
| 298 | 3300009545 | Ga0105237_12404702 | Ga0105237_124047021 | 119 |
| 299 | 3300009551 | Ga0105238_10098403 | Ga0105238_100984034 | 119 |
| 300 | 3300009551 | Ga0105238_10292580 | Ga0105238_102925803 | 119 |
| 301 | 3300011119 | Ga0105246_10663587 | Ga0105246_106635872 | 119 |
| 302 | 3300013296 | Ga0157374_10459365 | Ga0157374_104593651 | 119 |
| 303 | 3300013297 | Ga0157378_10279361 | Ga0157378_102793613 | 119 |
| 304 | 3300013297 | Ga0157378_11561244 | Ga0157378_115612442 | 119 |
| 305 | 3300013306 | Ga0163162_10267727 | Ga0163162_102677272 | 119 |
| 306 | 3300013307 | Ga0157372_11887182 | Ga0157372_118871822 | 119 |
| 307 | 3300013308 | Ga0157375_10008063 | Ga0157375_1000806311 | 119 |
| 308 | 3300013308 | Ga0157375_11294700 | Ga0157375_112947001 | 119 |
| 309 | 3300014325 | Ga0163163_10009374 | Ga0163163_100093744 | 119 |
| 310 | 3300014326 | Ga0157380_10015122 | Ga0157380_100151224 | 119 |
| 311 | 3300014326 | Ga0157380_10043587 | Ga0157380_100435873 | 119 |
| 312 | 3300014326 | Ga0157380_10733126 | Ga0157380_107331262 | 119 |
| 313 | 3300014326 | Ga0157380_10953154 | Ga0157380_109531542 | 119 |
| 314 | 3300014326 | Ga0157380_11510873 | Ga0157380_115108731 | 119 |
| 315 | 3300014497 | Ga0182008_10259906 | Ga0182008_102599062 | 119 |
| 316 | 3300014745 | Ga0157377_10539219 | Ga0157377_105392192 | 119 |
| 317 | 3300014968 | Ga0157379_10677138 | Ga0157379_106771381 | 119 |
| 318 | 3300014969 | Ga0157376_10111683 | Ga0157376_101116833 | 119 |
| 319 | 3300017792 | Ga0163161_10036021 | Ga0163161_100360214 | 119 |
| 320 | 3300025297 | Ga0209758_1109977 | Ga0209758_11099772 | 119 |
| 321 | 3300025735 | Ga0207713_1150458 | Ga0207713_11504582 | 119 |
| 322 | 3300025899 | Ga0207642_10171105 | Ga0207642_101711052 | 119 |
| 323 | 3300025903 | Ga0207680_10178084 | Ga0207680_101780841 | 119 |
| 324 | 3300025907 | Ga0207645_10036795 | Ga0207645_100367954 | 119 |
| 325 | 3300025907 | Ga0207645_10215930 | Ga0207645_102159302 | 119 |
| 326 | 3300025912 | Ga0207707_10324035 | Ga0207707_103240352 | 119 |
| 327 | 3300025913 | Ga0207695_10838752 | Ga0207695_108387522 | 119 |
| 328 | 3300025914 | Ga0207671_10922295 | Ga0207671_109222952 | 119 |
| 329 | 3300025917 | Ga0207660_11500792 | Ga0207660_115007921 | 119 |
| 330 | 3300025919 | Ga0207657_11073102 | Ga0207657_110731021 | 119 |
| 331 | 3300025920 | Ga0207649_10840701 | Ga0207649_108407011 | 119 |
| 332 | 3300025923 | Ga0207681_10171414 | Ga0207681_101714144 | 119 |
| 333 | 3300025923 | Ga0207681_10266563 | Ga0207681_102665633 | 119 |
| 334 | 3300025923 | Ga0207681_10470026 | Ga0207681_104700262 | 119 |
| 335 | 3300025924 | Ga0207694_10847515 | Ga0207694_108475152 | 119 |
| 336 | 3300025925 | Ga0207650_10013430 | Ga0207650_100134307 | 119 |
| 337 | 3300025925 | Ga0207650_10179524 | Ga0207650_101795242 | 119 |
| 338 | 3300025925 | Ga0207650_10322089 | Ga0207650_103220892 | 119 |
| 339 | 3300025925 | Ga0207650_10496885 | Ga0207650_104968852 | 119 |
| 340 | 3300025925 | Ga0207650_11050412 | Ga0207650_110504121 | 119 |
| 341 | 3300025926 | Ga0207659_10129563 | Ga0207659_101295632 | 119 |
| 342 | 3300025926 | Ga0207659_10193583 | Ga0207659_101935832 | 119 |
| 343 | 3300025926 | Ga0207659_10223961 | Ga0207659_102239612 | 119 |
| 344 | 3300025927 | Ga0207687_10585521 | Ga0207687_105855212 | 119 |
| 345 | 3300025927 | Ga0207687_11298813 | Ga0207687_112988132 | 119 |
| 346 | 3300025931 | Ga0207644_10099704 | Ga0207644_100997041 | 119 |
| 347 | 3300025931 | Ga0207644_10355588 | Ga0207644_103555881 | 119 |
| 348 | 3300025931 | Ga0207644_10399593 | Ga0207644_103995931 | 119 |
| 349 | 3300025933 | Ga0207706_11019283 | Ga0207706_110192832 | 119 |
| 350 | 3300025934 | Ga0207686_10038004 | Ga0207686_100380043 | 119 |
| 351 | 3300025935 | Ga0207709_10132657 | Ga0207709_101326572 | 119 |
| 352 | 3300025935 | Ga0207709_11821730 | Ga0207709_118217301 | 119 |
| 353 | 3300025936 | Ga0207670_10095211 | Ga0207670_100952112 | 119 |
| 354 | 3300025936 | Ga0207670_11053729 | Ga0207670_110537292 | 119 |
| 355 | 3300025937 | Ga0207669_10044928 | Ga0207669_100449282 | 119 |
| 356 | 3300025937 | Ga0207669_10244959 | Ga0207669_102449592 | 119 |
| 357 | 3300025937 | Ga0207669_10259906 | Ga0207669_102599062 | 119 |
| 358 | 3300025937 | Ga0207669_11170304 | Ga0207669_111703041 | 119 |
| 359 | 3300025938 | Ga0207704_10198871 | Ga0207704_101988712 | 119 |
| 360 | 3300025940 | Ga0207691_10003897 | Ga0207691_100038974 | 119 |
| 361 | 3300025940 | Ga0207691_10052634 | Ga0207691_100526342 | 119 |
| 362 | 3300025940 | Ga0207691_10775875 | Ga0207691_107758752 | 119 |
| 363 | 3300025942 | Ga0207689_10446042 | Ga0207689_104460422 | 119 |
| 364 | 3300025942 | Ga0207689_10493386 | Ga0207689_104933862 | 119 |
| 365 | 3300025945 | Ga0207679_10742132 | Ga0207679_107421322 | 119 |
| 366 | 3300025945 | Ga0207679_11032146 | Ga0207679_110321461 | 119 |
| 367 | 3300025960 | Ga0207651_10014774 | Ga0207651_100147746 | 119 |
| 368 | 3300025960 | Ga0207651_10514704 | Ga0207651_105147042 | 119 |
| 369 | 3300025972 | Ga0207668_10022618 | Ga0207668_100226187 | 119 |
| 370 | 3300025972 | Ga0207668_10152216 | Ga0207668_101522162 | 119 |
| 371 | 3300025972 | Ga0207668_11492294 | Ga0207668_114922941 | 119 |
| 372 | 3300025981 | Ga0207640_10986611 | Ga0207640_109866111 | 119 |
| 373 | 3300025986 | Ga0207658_10465610 | Ga0207658_104656102 | 119 |
| 374 | 3300026023 | Ga0207677_10270798 | Ga0207677_102707982 | 119 |
| 375 | 3300026023 | Ga0207677_10306002 | Ga0207677_103060023 | 119 |
| 376 | 3300026035 | Ga0207703_10200616 | Ga0207703_102006164 | 119 |
| 377 | 3300026035 | Ga0207703_10582819 | Ga0207703_105828192 | 119 |
| 378 | 3300026041 | Ga0207639_10888405 | Ga0207639_108884052 | 119 |
| 379 | 3300026067 | Ga0207678_10012948 | Ga0207678_100129489 | 119 |
| 380 | 3300026067 | Ga0207678_10049096 | Ga0207678_100490964 | 119 |
| 381 | 3300026075 | Ga0207708_10239026 | Ga0207708_102390262 | 119 |
| 382 | 3300026075 | Ga0207708_10928107 | Ga0207708_109281072 | 119 |
| 383 | 3300026088 | Ga0207641_10012818 | Ga0207641_100128184 | 119 |
| 384 | 3300026088 | Ga0207641_12038012 | Ga0207641_120380121 | 119 |
| 385 | 3300026089 | Ga0207648_10028927 | Ga0207648_100289272 | 119 |
| 386 | 3300026095 | Ga0207676_10095978 | Ga0207676_100959783 | 119 |
| 387 | 3300026095 | Ga0207676_10099678 | Ga0207676_100996782 | 119 |
| 388 | 3300026095 | Ga0207676_10459847 | Ga0207676_104598471 | 119 |
| 389 | 3300026121 | Ga0207683_10673825 | Ga0207683_106738252 | 119 |
| 390 | 3300026142 | Ga0207698_10934651 | Ga0207698_109346511 | 119 |
| 391 | 3300027866 | Ga0209813_10001883 | Ga0209813_100018838 | 119 |
| 392 | 3300027907 | Ga0207428_10414396 | Ga0207428_104143961 | 119 |
| 393 | 3300028379 | Ga0268266_10000352 | Ga0268266_100003528 | 119 |
| 394 | 3300028379 | Ga0268266_10095017 | Ga0268266_100950174 | 119 |
| 395 | 3300028380 | Ga0268265_11532837 | Ga0268265_115328371 | 119 |
| 396 | 3300028381 | Ga0268264_11354562 | Ga0268264_113545621 | 119 |
| 397 | 3300028794 | Ga0307515_10120642 | Ga0307515_101206422 | 119 |
| 398 | 3300031456 | Ga0307513_10207643 | Ga0307513_102076432 | 119 |
| 399 | 3300031456 | Ga0307513_10517354 | Ga0307513_105173542 | 119 |
| 400 | 3300031911 | Ga0307412_10152481 | Ga0307412_101524813 | 119 |
| 401 | 3300031995 | Ga0307409_101551166 | Ga0307409_1015511661 | 119 |
| 402 | 3300035692 | Ga0373935_0046316 | Ga0373935_0046316_397_756 | 119 |
| 403 | 3300035695 | Ga0373927_0015494 | Ga0373927_0015494_203_562 | 119 |
| 404 | 3300036401 | Ga0373937_0899291 | Ga0373937_0899291_110_469 | 119 |
| 405 | 3300037068 | Ga0373925_0013259 | Ga0373925_0013259_2687_3046 | 119 |
| 406 | 3300041452 | Ga0451793_0292868 | Ga0451793_0292868_78_437 | 119 |
| 407 | 3300041486 | Ga0451807_2660561 | Ga0451807_2660561_816_1178 | 119 |
| 408 | 3300041505 | Ga0451849_0759547 | Ga0451849_0759547_167_529 | 119 |
| 409 | 3300041505 | Ga0451849_1258175 | Ga0451849_1258175_50_412 | 119 |
| 410 | 3300041512 | Ga0451853_1674364 | Ga0451853_1674364_714_1079 | 119 |
| 411 | 3300041512 | Ga0451853_3100653 | Ga0451853_3100653_305_664 | 119 |
| 412 | 3300046457 | Ga0495590_0108005 | Ga0495590_0108005_388_747 | 119 |
| 413 | 3300046459 | Ga0495629_0255304 | Ga0495629_0255304_669_1028 | 119 |
| 414 | 3300046460 | Ga0495638_0006892 | Ga0495638_0006892_1518_1877 | 119 |
| 415 | 3300046460 | Ga0495638_0033865 | Ga0495638_0033865_2098_2457 | 119 |
| 416 | 3300046460 | Ga0495638_0052013 | Ga0495638_0052013_1816_2175 | 119 |
| 417 | 3300046471 | Ga0495650_0114870 | Ga0495650_0114870_14_376 | 119 |
| 418 | 3300046471 | Ga0495650_0256485 | Ga0495650_0256485_27_389 | 119 |
| 419 | 3300046474 | Ga0495605_0136715 | Ga0495605_0136715_200_559 | 119 |
| 420 | 3300046492 | Ga0495585_0113374 | Ga0495585_0113374_456_815 | 119 |
| 421 | 3300046501 | Ga0495607_0064480 | Ga0495607_0064480_416_775 | 119 |
| 422 | 3300046507 | Ga0495606_0093431 | Ga0495606_0093431_884_1243 | 119 |
| 423 | 3300046512 | Ga0495610_0028346 | Ga0495610_0028346_1970_2329 | 119 |
| 424 | 3300046513 | Ga0495616_0108849 | Ga0495616_0108849_284_643 | 119 |
| 425 | 3300046515 | Ga0495620_0132100 | Ga0495620_0132100_565_924 | 119 |
| 426 | 3300046518 | Ga0495631_0024970 | Ga0495631_0024970_1114_1473 | 119 |
| 427 | 3300046519 | Ga0495632_0157249 | Ga0495632_0157249_443_802 | 119 |
| 428 | 3300046520 | Ga0495637_0021275 | Ga0495637_0021275_1437_1796 | 119 |
| 429 | 3300046522 | Ga0495643_0042175 | Ga0495643_0042175_1775_2134 | 119 |
| 430 | 3300046524 | Ga0495648_0025488 | Ga0495648_0025488_1955_2314 | 119 |
| 431 | 3300046530 | Ga0495654_0028398 | Ga0495654_0028398_1598_1957 | 119 |
| 432 | 3300046538 | Ga0495609_0089867 | Ga0495609_0089867_597_956 | 119 |
| 433 | 3300046542 | Ga0495597_0127938 | Ga0495597_0127938_683_1042 | 119 |
| 434 | 3300046616 | Ga0495668_0079394 | Ga0495668_0079394_347_706 | 119 |
| 435 | 3300046660 | Ga0495625_0701491 | Ga0495625_0701491_164_523 | 119 |
| 436 | 3300046665 | Ga0495661_0049107 | Ga0495661_0049107_401_760 | 119 |
| 437 | 3300046665 | Ga0495661_0296006 | Ga0495661_0296006_22_381 | 119 |
| 438 | 3300046674 | Ga0495588_0031460 | Ga0495588_0031460_193_552 | 119 |
| 439 | 3300046691 | Ga0495670_0033565 | Ga0495670_0033565_1879_2238 | 119 |
| 440 | 3300046692 | Ga0495671_0049346 | Ga0495671_0049346_683_1042 | 119 |
| 441 | 3300046794 | Ga0495589_0173429 | Ga0495589_0173429_435_794 | 119 |
| 442 | 3300046810 | Ga0495660_0064470 | Ga0495660_0064470_774_1133 | 119 |
| 443 | 3300047445 | Ga0495677_0069821 | Ga0495677_0069821_623_982 | 119 |
| 444 | 3300047470 | Ga0495681_0079787 | Ga0495681_0079787_407_766 | 119 |
| 445 | 3300047472 | Ga0495686_0027654 | Ga0495686_0027654_1840_2199 | 119 |
| 446 | 3300048091 | Ga0495626_0067619 | Ga0495626_0067619_1092_1451 | 119 |
| 447 | 3300048903 | Ga0496100_0830310 | Ga0496100_0830310_338_697 | 119 |
| 448 | 3300048905 | Ga0496102_0479835 | Ga0496102_0479835_731_1090 | 119 |
| 449 | 3300048907 | Ga0496104_1538005 | Ga0496104_1538005_48_407 | 119 |
| 450 | 3300048909 | Ga0496106_1533602 | Ga0496106_1533602_81_440 | 119 |
| 451 | 3300048911 | Ga0496108_0348297 | Ga0496108_0348297_264_626 | 119 |
| 452 | 3300048913 | Ga0496110_0737495 | Ga0496110_0737495_153_512 | 119 |
| 453 | 3300048914 | Ga0496111_0510903 | Ga0496111_0510903_223_585 | 119 |
| 454 | 3300048915 | Ga0496112_0129869 | Ga0496112_0129869_608_970 | 119 |
| 455 | 3300048916 | Ga0496113_0354080 | Ga0496113_0354080_638_1000 | 119 |
| 456 | 3300048916 | Ga0496113_1040619 | Ga0496113_1040619_110_469 | 119 |
| 457 | 3300048916 | Ga0496113_1122689 | Ga0496113_1122689_18_377 | 119 |
| 458 | 3300048918 | Ga0496115_0934660 | Ga0496115_0934660_60_425 | 119 |
| 459 | 3300048920 | Ga0496117_0056542 | Ga0496117_0056542_1714_2073 | 119 |
| 460 | 3300048921 | Ga0496118_0182014 | Ga0496118_0182014_779_1138 | 119 |
| 461 | 3300048922 | Ga0496119_0150376 | Ga0496119_0150376_407_766 | 119 |
| 462 | 3300048922 | Ga0496119_0182816 | Ga0496119_0182816_228_587 | 119 |
| 463 | 3300048923 | Ga0496120_0023177 | Ga0496120_0023177_2223_2582 | 119 |
| 464 | 3300048924 | Ga0496121_0044674 | Ga0496121_0044674_880_1239 | 119 |
| 465 | 3300048925 | Ga0496122_0144029 | Ga0496122_0144029_724_1083 | 119 |
| 466 | 3300048926 | Ga0496123_0045094 | Ga0496123_0045094_1842_2201 | 119 |
| 467 | 3300048927 | Ga0496124_0399737 | Ga0496124_0399737_530_889 | 119 |
| 468 | 3300048928 | Ga0496125_0004101 | Ga0496125_0004101_8351_8710 | 119 |
| 469 | 3300048929 | Ga0496126_1159357 | Ga0496126_1159357_178_537 | 119 |
| 470 | 3300049569 | Ga0501032_0778965 | Ga0501032_0778965_120_482 | 119 |
| 471 | 3300049570 | Ga0501033_0000200 | Ga0501033_0000200_44640_45002 | 119 |
| 472 | 3300049576 | Ga0501040_0464322 | Ga0501040_0464322_130_492 | 119 |
| 473 | 3300049578 | Ga0501042_0148863 | Ga0501042_0148863_1142_1504 | 119 |
| 474 | 3300049579 | Ga0501043_0104302 | Ga0501043_0104302_523_885 | 119 |
| 475 | 3300049580 | Ga0501046_0051265 | Ga0501046_0051265_988_1350 | 119 |
| 476 | 3300049581 | Ga0501047_0210030 | Ga0501047_0210030_141_503 | 119 |
| 477 | 3300049581 | Ga0501047_0541133 | Ga0501047_0541133_202_564 | 119 |
| 478 | 3300049582 | Ga0501048_0483701 | Ga0501048_0483701_394_756 | 119 |
| 479 | 3300049583 | Ga0501067_0665712 | Ga0501067_0665712_173_532 | 119 |
| 480 | 3300049585 | Ga0501069_0466290 | Ga0501069_0466290_312_674 | 119 |
| 481 | 3300049589 | Ga0501073_0040346 | Ga0501073_0040346_171_605 | 119 |
| 482 | 3300049589 | Ga0501073_0082404 | Ga0501073_0082404_1044_1409 | 119 |
| 483 | 3300049589 | Ga0501073_0519710 | Ga0501073_0519710_42_401 | 119 |
| 484 | 3300049742 | Ga0501080_0169199 | Ga0501080_0169199_723_1085 | 119 |
| 485 | 3300049742 | Ga0501080_0358473 | Ga0501080_0358473_682_1041 | 119 |
| 486 | 3300049822 | Ga0501035_0088135 | Ga0501035_0088135_415_777 | 119 |
| 487 | 3300049823 | Ga0501044_0015290 | Ga0501044_0015290_3733_4095 | 119 |
| 488 | 3300049823 | Ga0501044_0259771 | Ga0501044_0259771_23_385 | 119 |
| 489 | 3300049823 | Ga0501044_0358801 | Ga0501044_0358801_81_440 | 119 |
| 490 | 3300050489 | nmdc:mga03683_135925_c1 | nmdc:mga03683_135925_c1_308_670 | 119 |
| 491 | 3300050489 | nmdc:mga03683_166481_c1 | nmdc:mga03683_166481_c1_223_582 | 119 |
| 492 | 3300050489 | nmdc:mga03683_72547_c1 | nmdc:mga03683_72547_c1_60_533 | 119 |
| 493 | 3300050490 | nmdc:mga03n38_11525_c1 | nmdc:mga03n38_11525_c1_1537_1899 | 119 |
| 494 | 3300050490 | nmdc:mga03n38_228242_c1 | nmdc:mga03n38_228242_c1_273_632 | 119 |
| 495 | 3300050490 | nmdc:mga03n38_384_c1 | nmdc:mga03n38_384_c1_182_541 | 119 |
| 496 | 3300050491 | nmdc:mga00v17_158387_c1 | nmdc:mga00v17_158387_c1_875_1237 | 119 |
| 497 | 3300050491 | nmdc:mga00v17_199780_c1 | nmdc:mga00v17_199780_c1_164_523 | 119 |
| 498 | 3300050492 | nmdc:mga0yw44_147266_c1 | nmdc:mga0yw44_147266_c1_160_519 | 119 |
| 499 | 3300050492 | nmdc:mga0yw44_184318_c1 | nmdc:mga0yw44_184318_c1_724_1083 | 119 |
| 500 | 3300050492 | nmdc:mga0yw44_27688_c1 | nmdc:mga0yw44_27688_c1_420_782 | 119 |
| 501 | 3300050492 | nmdc:mga0yw44_48372_c1 | nmdc:mga0yw44_48372_c1_232_591 | 119 |
| 502 | 3300050493 | nmdc:mga0k408_688630_c1 | nmdc:mga0k408_688630_c1_50_409 | 119 |
| 503 | 3300050494 | nmdc:mga06z11_17062_c1 | nmdc:mga06z11_17062_c1_2097_2456 | 119 |
| 504 | 3300050495 | nmdc:mga04h51_14032_c1 | nmdc:mga04h51_14032_c1_1073_1435 | 119 |
| 505 | 3300050495 | nmdc:mga04h51_15692_c1 | nmdc:mga04h51_15692_c1_1137_1496 | 119 |
| 506 | 3300050496 | nmdc:mga07m45_126949_c1 | nmdc:mga07m45_126949_c1_66_425 | 119 |
| 507 | 3300050496 | nmdc:mga07m45_137022_c1 | nmdc:mga07m45_137022_c1_59_421 | 119 |
| 508 | 3300050496 | nmdc:mga07m45_39256_c1 | nmdc:mga07m45_39256_c1_1471_1830 | 119 |
| 509 | 3300050507 | nmdc:mga05p37_1115446_c1 | nmdc:mga05p37_1115446_c1_135_500 | 119 |
| 510 | 3300050507 | nmdc:mga05p37_96689_c1 | nmdc:mga05p37_96689_c1_2207_2566 | 119 |
| 511 | 3300050510 | nmdc:mga06r32_249527_c1 | nmdc:mga06r32_249527_c1_1280_1642 | 119 |
| 512 | 3300050511 | nmdc:mga08y16_144158_c1 | nmdc:mga08y16_144158_c1_1515_1877 | 119 |
| 513 | 3300050511 | nmdc:mga08y16_552234_c1 | nmdc:mga08y16_552234_c1_482_841 | 119 |
| 514 | 3300050512 | nmdc:mga0n895_2145012_c1 | nmdc:mga0n895_2145012_c1_69_434 | 119 |
| 515 | 3300050515 | nmdc:mga0a205_714356_c1 | nmdc:mga0a205_714356_c1_30_395 | 119 |
| 516 | 3300050516 | nmdc:mga0sz30_450723_c1 | nmdc:mga0sz30_450723_c1_104_466 | 119 |
| 517 | 3300053079 | Ga0500610_0437028 | Ga0500610_0437028_14_373 | 119 |
| 518 | 3300053086 | Ga0500578_0245287 | Ga0500578_0245287_43_402 | 119 |
| 519 | 3300053087 | Ga0500643_027031 | Ga0500643_027031_145_504 | 119 |
| 520 | 3300053088 | Ga0500644_0041965 | Ga0500644_0041965_400_759 | 119 |
| 521 | 3300053088 | Ga0500644_0314341 | Ga0500644_0314341_81_440 | 119 |
| 522 | 3300053089 | Ga0500581_162047 | Ga0500581_162047_403_762 | 119 |
| 523 | 3300053090 | Ga0500646_0088706 | Ga0500646_0088706_173_532 | 119 |
| 524 | 3300053090 | Ga0500646_0179243 | Ga0500646_0179243_229_588 | 119 |
| 525 | 3300053092 | Ga0500583_0524954 | Ga0500583_0524954_28_387 | 119 |
| 526 | 3300053093 | Ga0500651_0075990 | Ga0500651_0075990_772_1131 | 119 |
| 527 | 3300053094 | Ga0500566_0000748 | Ga0500566_0000748_6641_7027 | 119 |
| 528 | 3300053096 | Ga0500641_0009093 | Ga0500641_0009093_230_589 | 119 |
| 529 | 3300053096 | Ga0500641_0010726 | Ga0500641_0010726_1084_1446 | 119 |
| 530 | 3300053096 | Ga0500641_0130267 | Ga0500641_0130267_172_531 | 119 |
| 531 | 3300053098 | Ga0500650_0022536 | Ga0500650_0022536_540_899 | 119 |
| 532 | 3300053102 | Ga0500554_135733 | Ga0500554_135733_16_402 | 119 |
| 533 | 3300053104 | Ga0500556_0000051 | Ga0500556_0000051_91292_91651 | 119 |
| 534 | 3300053108 | Ga0500562_021545 | Ga0500562_021545_923_1282 | 119 |
| 535 | 3300053109 | Ga0500569_064470 | Ga0500569_064470_69_428 | 119 |
| 536 | 3300053116 | Ga0500592_011519 | Ga0500592_011519_623_982 | 119 |
| 537 | 3300053117 | Ga0500593_079511 | Ga0500593_079511_772_1131 | 119 |
| 538 | 3300053118 | Ga0500594_0007599 | Ga0500594_0007599_1542_1901 | 119 |
| 539 | 3300053122 | Ga0500608_003839 | Ga0500608_003839_3896_4255 | 119 |
| 540 | 3300053130 | Ga0500642_0000041 | Ga0500642_0000041_58348_58707 | 119 |
| 541 | 3300053134 | Ga0500658_0159505 | Ga0500658_0159505_34_393 | 119 |
| 542 | 3300053136 | Ga0500559_0000188 | Ga0500559_0000188_8187_8546 | 119 |
| 543 | 3300053138 | Ga0500564_164527 | Ga0500564_164527_167_553 | 119 |
| 544 | 3300053139 | Ga0500568_0154255 | Ga0500568_0154255_158_517 | 119 |
| 545 | 3300053146 | Ga0500588_0029782 | Ga0500588_0029782_91_450 | 119 |
| 546 | 3300053146 | Ga0500588_0243784 | Ga0500588_0243784_73_432 | 119 |
| 547 | 3300053151 | Ga0500604_0008743 | Ga0500604_0008743_58_417 | 119 |
| 548 | 3300053151 | Ga0500604_0162957 | Ga0500604_0162957_26_385 | 119 |
| 549 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_90430_90789 | 119 |
| 550 | 3300053154 | Ga0500619_081608 | Ga0500619_081608_290_649 | 119 |
| 551 | 3300053156 | Ga0500622_0009784 | Ga0500622_0009784_4324_4683 | 119 |
| 552 | 3300053158 | Ga0500627_0051387 | Ga0500627_0051387_1280_1639 | 119 |
| 553 | 3300053160 | Ga0500633_0036255 | Ga0500633_0036255_389_748 | 119 |
| 554 | 3300053727 | Ga0500611_014010 | Ga0500611_014010_200_559 | 119 |
| 555 | 3300053730 | Ga0500645_019029 | Ga0500645_019029_643_1002 | 119 |
| 556 | 3300060353 | Ga0501082_0661886 | Ga0501082_0661886_352_717 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9538 | 1 | 117 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9526 | 1 | 119 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9151 | 1 | 117 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8748 | 1 | 119 |
| 3kg1-assembly3.cif.gz_A-2 | crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a | 0.7639 | 2 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9487 | 1 | 119 | 3.30.70.100 |
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.941 | 1 | 119 | 3.30.70.100 |
| 3kg1A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7639 | 2 | 119 | 3.30.70.100 |
| 5ixuA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7345 | 3 | 116 | 3.30.70.100 |
| 3kg1A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7304 | 2 | 119 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2ET28-F1-model_v4 | RNA signal recognition particle | 0.9938 | 1 | 119 |
|
| AF-A0A2S2DD96-F1-model_v4 | DUF1428 domain-containing protein | 0.9925 | 1 | 119 |
|
| AF-Q07H21-F1-model_v4 | DUF1428 domain-containing protein | 0.9915 | 1 | 119 |
|
| AF-A0A2A6NUV3-F1-model_v4 | RNA signal recognition particle | 0.9906 | 1 | 119 |
|
| AF-A0A1Q4BAH8-F1-model_v4 | RNA signal recognition particle | 0.9903 | 4 | 90 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar