F463151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 266 | 555 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0048841|Ga0501031_0048841_771_1511 |
| Length | 246 |
| Sequence | MEQRIRFCTTPDGVRLAYATSGKGPPLVRASVARRHPAAKAVTFRAMKPAYHDGMRRLQDRFDSRALADXXXERLSRREFTAEDRAFIESRRLFFLASADAEGQPDCSYKGGDPGFVRVTAADELAFPSYDGNGMFRSLGNVLVNPAVALLFIDFEQPRRLRVNGRASIADDDPLLAAFTGAQVMVRVRAERIFPNCPRYIPRMSIAEVSQYVPRAGCTPPVPKWKTNEAFNEVLPRGDPAKTKKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 190 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 98.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10003987 | 3300005293 | Bacteria | 6653 |
| 2 | Ga0065707_10102385 | 3300005295 | Bacteria | 2809 |
| 3 | Ga0070658_10804171 | 3300005327 | Bacteria | 817 |
| 4 | Ga0070690_100087630 | 3300005330 | Bacteria | 2045 |
| 5 | Ga0070690_100130640 | 3300005330 | Bacteria | 1696 |
| 6 | Ga0070670_100116738 | 3300005331 | Bacteria | 2301 |
| 7 | Ga0070677_10353802 | 3300005333 | Bacteria | 762 |
| 8 | Ga0068869_100005372 | 3300005334 | Bacteria | 8049 |
| 9 | Ga0068869_100744620 | 3300005334 | Bacteria | 839 |
| 10 | Ga0070666_10005295 | 3300005335 | Bacteria | 7904 |
| 11 | Ga0070666_10265066 | 3300005335 | Bacteria | 1219 |
| 12 | Ga0070680_100047216 | 3300005336 | Bacteria | 3505 |
| 13 | Ga0070680_100156120 | 3300005336 | Bacteria | 1917 |
| 14 | Ga0068868_100005931 | 3300005338 | Bacteria | 8619 |
| 15 | Ga0068868_100027304 | 3300005338 | Bacteria | 4355 |
| 16 | Ga0070689_100804621 | 3300005340 | Bacteria | 827 |
| 17 | Ga0070689_101190369 | 3300005340 | Bacteria | 684 |
| 18 | Ga0070687_100073931 | 3300005343 | Bacteria | 1839 |
| 19 | Ga0070661_100052696 | 3300005344 | Bacteria | 2978 |
| 20 | Ga0070692_10026184 | 3300005345 | Bacteria | 2880 |
| 21 | Ga0070692_10046708 | 3300005345 | Bacteria | 2239 |
| 22 | Ga0070668_100000332 | 3300005347 | Bacteria | 31100 |
| 23 | Ga0070669_100000950 | 3300005353 | Bacteria | 21138 |
| 24 | Ga0070669_100028821 | 3300005353 | Bacteria | 3999 |
| 25 | Ga0070669_100476026 | 3300005353 | Bacteria | 1033 |
| 26 | Ga0070675_100003748 | 3300005354 | Bacteria | 11546 |
| 27 | Ga0070675_100021734 | 3300005354 | Bacteria | 5126 |
| 28 | Ga0070671_100012508 | 3300005355 | Bacteria | 6835 |
| 29 | Ga0070671_100015021 | 3300005355 | Bacteria | 6253 |
| 30 | Ga0070671_100367410 | 3300005355 | Unclassified | 1229 |
| 31 | Ga0070674_100002766 | 3300005356 | Bacteria | 9697 |
| 32 | Ga0070674_100117056 | 3300005356 | Unclassified | 1967 |
| 33 | Ga0070673_100006099 | 3300005364 | Bacteria | 7810 |
| 34 | Ga0070673_100126353 | 3300005364 | Bacteria | 2140 |
| 35 | Ga0070688_100147183 | 3300005365 | Bacteria | 1606 |
| 36 | Ga0070659_100254311 | 3300005366 | Bacteria | 1456 |
| 37 | Ga0070667_100004997 | 3300005367 | Bacteria | 11107 |
| 38 | Ga0070667_100283900 | 3300005367 | Unclassified | 1487 |
| 39 | Ga0070667_100845792 | 3300005367 | Bacteria | 851 |
| 40 | Ga0070703_10002969 | 3300005406 | Bacteria | 4848 |
| 41 | Ga0070709_10755978 | 3300005434 | Bacteria | 760 |
| 42 | Ga0070714_100008968 | 3300005435 | Bacteria | 7831 |
| 43 | Ga0070714_100561293 | 3300005435 | Bacteria | 1094 |
| 44 | Ga0070701_10016655 | 3300005438 | Bacteria | 3422 |
| 45 | Ga0070705_100056657 | 3300005440 | Bacteria | 2309 |
| 46 | Ga0070705_100161743 | 3300005440 | Bacteria | 1497 |
| 47 | Ga0070705_100254304 | 3300005440 | Bacteria | 1235 |
| 48 | Ga0070705_100317857 | 3300005440 | Bacteria | 1123 |
| 49 | Ga0070705_100509810 | 3300005440 | Bacteria | 915 |
| 50 | Ga0070700_100004257 | 3300005441 | Bacteria | 7471 |
| 51 | Ga0070700_100100323 | 3300005441 | Bacteria | 1906 |
| 52 | Ga0070694_100038005 | 3300005444 | Bacteria | 3196 |
| 53 | Ga0070694_100162342 | 3300005444 | Bacteria | 1640 |
| 54 | Ga0070694_100516275 | 3300005444 | Bacteria | 953 |
| 55 | Ga0070708_100046870 | 3300005445 | Bacteria | 3816 |
| 56 | Ga0070708_100687731 | 3300005445 | Bacteria | 963 |
| 57 | Ga0070663_100026998 | 3300005455 | Bacteria | 3894 |
| 58 | Ga0070663_100217322 | 3300005455 | Unclassified | 1499 |
| 59 | Ga0070678_100057728 | 3300005456 | Bacteria | 2845 |
| 60 | Ga0070678_100102152 | 3300005456 | Bacteria | 2224 |
| 61 | Ga0070678_100223481 | 3300005456 | Bacteria | 1566 |
| 62 | Ga0070662_100001231 | 3300005457 | Bacteria | 15727 |
| 63 | Ga0070662_100070608 | 3300005457 | Bacteria | 2573 |
| 64 | Ga0070662_100563012 | 3300005457 | Bacteria | 956 |
| 65 | Ga0070681_10025566 | 3300005458 | Bacteria | 5940 |
| 66 | Ga0070681_10039177 | 3300005458 | Bacteria | 4751 |
| 67 | Ga0070681_10098815 | 3300005458 | Bacteria | 2865 |
| 68 | Ga0068867_100005647 | 3300005459 | Bacteria | 8867 |
| 69 | Ga0068867_100094045 | 3300005459 | Bacteria | 2279 |
| 70 | Ga0068867_100170513 | 3300005459 | Bacteria | 1723 |
| 71 | Ga0068867_100434576 | 3300005459 | Bacteria | 1115 |
| 72 | Ga0068867_100593770 | 3300005459 | Bacteria | 965 |
| 73 | Ga0070685_10324796 | 3300005466 | Bacteria | 1044 |
| 74 | Ga0070706_100543298 | 3300005467 | Bacteria | 1081 |
| 75 | Ga0070707_100254889 | 3300005468 | Bacteria | 1707 |
| 76 | Ga0070707_100453719 | 3300005468 | Bacteria | 1243 |
| 77 | Ga0070698_100005029 | 3300005471 | Bacteria | 14484 |
| 78 | Ga0070698_100365492 | 3300005471 | Bacteria | 1375 |
| 79 | Ga0070698_100849800 | 3300005471 | Bacteria | 857 |
| 80 | Ga0070699_100018485 | 3300005518 | Bacteria | 5986 |
| 81 | Ga0070699_100558360 | 3300005518 | Bacteria | 1042 |
| 82 | Ga0070679_100140166 | 3300005530 | Bacteria | 2398 |
| 83 | Ga0070679_100175238 | 3300005530 | Bacteria | 2117 |
| 84 | Ga0070679_100751922 | 3300005530 | Bacteria | 918 |
| 85 | Ga0070697_100247936 | 3300005536 | Bacteria | 1522 |
| 86 | Ga0068853_100038903 | 3300005539 | Bacteria | 4054 |
| 87 | Ga0068853_100064855 | 3300005539 | Bacteria | 3168 |
| 88 | Ga0068853_100409884 | 3300005539 | Bacteria | 1270 |
| 89 | Ga0068853_100766476 | 3300005539 | Bacteria | 923 |
| 90 | Ga0068853_100888899 | 3300005539 | Unclassified | 855 |
| 91 | Ga0070672_100001876 | 3300005543 | Bacteria | 13148 |
| 92 | Ga0070672_100014880 | 3300005543 | Bacteria | 5524 |
| 93 | Ga0070672_100038870 | 3300005543 | Bacteria | 3640 |
| 94 | Ga0070672_100051107 | 3300005543 | Bacteria | 3222 |
| 95 | Ga0070672_100078033 | 3300005543 | Bacteria | 2649 |
| 96 | Ga0070672_100078980 | 3300005543 | Bacteria | 2633 |
| 97 | Ga0070672_100152168 | 3300005543 | Bacteria | 1914 |
| 98 | Ga0070672_100205319 | 3300005543 | Bacteria | 1649 |
| 99 | Ga0070672_100206118 | 3300005543 | Bacteria | 1645 |
| 100 | Ga0070695_100002311 | 3300005545 | Bacteria | 10931 |
| 101 | Ga0070695_100033929 | 3300005545 | Bacteria | 3195 |
| 102 | Ga0070695_100164841 | 3300005545 | Bacteria | 1559 |
| 103 | Ga0070695_101069200 | 3300005545 | Bacteria | 659 |
| 104 | Ga0070696_100254971 | 3300005546 | Bacteria | 1328 |
| 105 | Ga0070696_100406806 | 3300005546 | Bacteria | 1066 |
| 106 | Ga0070693_100369884 | 3300005547 | Bacteria | 986 |
| 107 | Ga0070693_100435490 | 3300005547 | Bacteria | 917 |
| 108 | Ga0070665_100347379 | 3300005548 | Bacteria | 1488 |
| 109 | Ga0070665_101325077 | 3300005548 | Bacteria | 730 |
| 110 | Ga0070704_100000613 | 3300005549 | Bacteria | 17180 |
| 111 | Ga0070704_100026341 | 3300005549 | Bacteria | 3840 |
| 112 | Ga0070704_100167527 | 3300005549 | Bacteria | 1744 |
| 113 | Ga0068855_100075269 | 3300005563 | Bacteria | 3921 |
| 114 | Ga0068855_100104224 | 3300005563 | Bacteria | 3263 |
| 115 | Ga0070664_100017520 | 3300005564 | Bacteria | 5885 |
| 116 | Ga0070664_100340199 | 3300005564 | Bacteria | 1363 |
| 117 | Ga0070664_100757459 | 3300005564 | Bacteria | 907 |
| 118 | Ga0068857_100002520 | 3300005577 | Bacteria | 14995 |
| 119 | Ga0068857_100045138 | 3300005577 | Bacteria | 3909 |
| 120 | Ga0068857_100065261 | 3300005577 | Bacteria | 3236 |
| 121 | Ga0068857_100088417 | 3300005577 | Bacteria | 2772 |
| 122 | Ga0068857_100154375 | 3300005577 | Bacteria | 2081 |
| 123 | Ga0068854_100314158 | 3300005578 | Bacteria | 1271 |
| 124 | Ga0068856_100011081 | 3300005614 | Bacteria | 8756 |
| 125 | Ga0068852_100031495 | 3300005616 | Bacteria | 4377 |
| 126 | Ga0068852_100200383 | 3300005616 | Bacteria | 1889 |
| 127 | Ga0068859_100026239 | 3300005617 | Bacteria | 5842 |
| 128 | Ga0068859_100026644 | 3300005617 | Bacteria | 5797 |
| 129 | Ga0068859_100033758 | 3300005617 | Bacteria | 5137 |
| 130 | Ga0068859_100182735 | 3300005617 | Bacteria | 2180 |
| 131 | Ga0068859_101337531 | 3300005617 | Bacteria | 790 |
| 132 | Ga0068864_100001428 | 3300005618 | Bacteria | 19722 |
| 133 | Ga0068864_100024342 | 3300005618 | Bacteria | 5093 |
| 134 | Ga0068866_10001483 | 3300005718 | Bacteria | 9995 |
| 135 | Ga0068861_100000426 | 3300005719 | Bacteria | 24509 |
| 136 | Ga0068861_100317967 | 3300005719 | Bacteria | 1355 |
| 137 | Ga0068851_10004147 | 3300005834 | Bacteria | 6523 |
| 138 | Ga0068851_10063663 | 3300005834 | Bacteria | 1894 |
| 139 | Ga0068851_10282498 | 3300005834 | Bacteria | 950 |
| 140 | Ga0068870_10114659 | 3300005840 | Bacteria | 1544 |
| 141 | Ga0068870_10173438 | 3300005840 | Bacteria | 1289 |
| 142 | Ga0068863_100001953 | 3300005841 | Bacteria | 20472 |
| 143 | Ga0068863_100162558 | 3300005841 | Bacteria | 2140 |
| 144 | Ga0068863_100211152 | 3300005841 | Bacteria | 1869 |
| 145 | Ga0068863_100359631 | 3300005841 | Bacteria | 1419 |
| 146 | Ga0068863_100523878 | 3300005841 | Bacteria | 1169 |
| 147 | Ga0068858_100001000 | 3300005842 | Bacteria | 29221 |
| 148 | Ga0068858_100789672 | 3300005842 | Unclassified | 926 |
| 149 | Ga0068860_100001048 | 3300005843 | Bacteria | 30480 |
| 150 | Ga0068860_100062489 | 3300005843 | Bacteria | 3538 |
| 151 | Ga0068860_100074490 | 3300005843 | Bacteria | 3228 |
| 152 | Ga0068860_100153687 | 3300005843 | Bacteria | 2217 |
| 153 | Ga0068860_100217624 | 3300005843 | Bacteria | 1854 |
| 154 | Ga0068860_101716961 | 3300005843 | Bacteria | 650 |
| 155 | Ga0068862_100005035 | 3300005844 | Bacteria | 11122 |
| 156 | Ga0068862_100098828 | 3300005844 | Bacteria | 2550 |
| 157 | Ga0068862_100105584 | 3300005844 | Bacteria | 2468 |
| 158 | Ga0068862_100382222 | 3300005844 | Bacteria | 1313 |
| 159 | Ga0068862_100482282 | 3300005844 | Bacteria | 1174 |
| 160 | Ga0075432_10037521 | 3300006058 | Bacteria | 1687 |
| 161 | Ga0075366_10027341 | 3300006195 | Bacteria | 3346 |
| 162 | Ga0075366_10225245 | 3300006195 | Bacteria | 1142 |
| 163 | Ga0097621_100026552 | 3300006237 | Bacteria | 4544 |
| 164 | Ga0097621_100130435 | 3300006237 | Bacteria | 2139 |
| 165 | Ga0068871_100352182 | 3300006358 | Bacteria | 1303 |
| 166 | Ga0068871_100604616 | 3300006358 | Bacteria | 997 |
| 167 | Ga0075428_100000828 | 3300006844 | Bacteria | 32366 |
| 168 | Ga0075428_100018021 | 3300006844 | Bacteria | 7803 |
| 169 | Ga0075428_100025930 | 3300006844 | Bacteria | 6491 |
| 170 | Ga0075428_100034331 | 3300006844 | Bacteria | 5596 |
| 171 | Ga0075430_100000127 | 3300006846 | Bacteria | 48027 |
| 172 | Ga0075431_100006196 | 3300006847 | Bacteria | 11874 |
| 173 | Ga0075431_100040114 | 3300006847 | Bacteria | 4824 |
| 174 | Ga0075431_100047352 | 3300006847 | Bacteria | 4432 |
| 175 | Ga0075431_100105217 | 3300006847 | Bacteria | 2912 |
| 176 | Ga0075431_100240629 | 3300006847 | Bacteria | 1841 |
| 177 | Ga0075433_10530058 | 3300006852 | Bacteria | 1036 |
| 178 | Ga0075429_100000075 | 3300006880 | Bacteria | 49848 |
| 179 | Ga0075429_100000762 | 3300006880 | Bacteria | 25370 |
| 180 | Ga0075429_100019307 | 3300006880 | Bacteria | 5903 |
| 181 | Ga0075429_100057422 | 3300006880 | Bacteria | 3389 |
| 182 | Ga0068865_100002225 | 3300006881 | Bacteria | 11426 |
| 183 | Ga0068865_100313460 | 3300006881 | Bacteria | 1259 |
| 184 | Ga0097620_100026240 | 3300006931 | Bacteria | 5842 |
| 185 | Ga0097620_100026645 | 3300006931 | Bacteria | 5797 |
| 186 | Ga0097620_100033755 | 3300006931 | Bacteria | 5137 |
| 187 | Ga0097620_100182723 | 3300006931 | Bacteria | 2180 |
| 188 | Ga0097620_101337223 | 3300006931 | Bacteria | 790 |
| 189 | Ga0099794_10002719 | 3300007265 | Bacteria | 6591 |
| 190 | Ga0105240_10323099 | 3300009093 | Bacteria | 1758 |
| 191 | Ga0105240_10590580 | 3300009093 | Bacteria | 1224 |
| 192 | Ga0111539_10000275 | 3300009094 | Bacteria | 61397 |
| 193 | Ga0111539_10066518 | 3300009094 | Bacteria | 4257 |
| 194 | Ga0111539_10366001 | 3300009094 | Bacteria | 1678 |
| 195 | Ga0111539_11030207 | 3300009094 | Unclassified | 957 |
| 196 | Ga0114129_10002034 | 3300009147 | Bacteria | 27730 |
| 197 | Ga0114129_10003702 | 3300009147 | Bacteria | 21531 |
| 198 | Ga0114129_10020604 | 3300009147 | Bacteria | 9376 |
| 199 | Ga0114129_10264738 | 3300009147 | Bacteria | 2302 |
| 200 | Ga0114129_10795816 | 3300009147 | Bacteria | 1207 |
| 201 | Ga0105243_10179075 | 3300009148 | Bacteria | 1842 |
| 202 | Ga0105243_10218957 | 3300009148 | Bacteria | 1681 |
| 203 | Ga0105243_10221556 | 3300009148 | Bacteria | 1673 |
| 204 | Ga0105243_10606175 | 3300009148 | Bacteria | 1055 |
| 205 | Ga0105241_10158053 | 3300009174 | Bacteria | 1861 |
| 206 | Ga0105242_10063926 | 3300009176 | Bacteria | 3031 |
| 207 | Ga0105242_11308421 | 3300009176 | Bacteria | 749 |
| 208 | Ga0105237_10076521 | 3300009545 | Bacteria | 3337 |
| 209 | Ga0105249_10006010 | 3300009553 | Bacteria | 10519 |
| 210 | Ga0105249_10113090 | 3300009553 | Bacteria | 2568 |
| 211 | Ga0105249_10126985 | 3300009553 | Bacteria | 2430 |
| 212 | Ga0105249_10390457 | 3300009553 | Bacteria | 1420 |
| 213 | Ga0105239_10054807 | 3300010375 | Unclassified | 4374 |
| 214 | Ga0105239_10076828 | 3300010375 | Bacteria | 3673 |
| 215 | Ga0105239_10417656 | 3300010375 | Bacteria | 1519 |
| 216 | Ga0105246_10275379 | 3300011119 | Bacteria | 1347 |
| 217 | Ga0157373_10156416 | 3300013100 | Bacteria | 1603 |
| 218 | Ga0157369_10000125 | 3300013105 | Bacteria | 110481 |
| 219 | Ga0157369_10035338 | 3300013105 | Bacteria | 5480 |
| 220 | Ga0157374_10132805 | 3300013296 | Bacteria | 2410 |
| 221 | Ga0157374_10167080 | 3300013296 | Bacteria | 2145 |
| 222 | Ga0157378_10030746 | 3300013297 | Bacteria | 4741 |
| 223 | Ga0157378_10231683 | 3300013297 | Bacteria | 1760 |
| 224 | Ga0157378_11615747 | 3300013297 | Unclassified | 694 |
| 225 | Ga0163162_10063807 | 3300013306 | Bacteria | 3728 |
| 226 | Ga0163162_10105025 | 3300013306 | Bacteria | 2919 |
| 227 | Ga0163162_10583511 | 3300013306 | Bacteria | 1245 |
| 228 | Ga0163162_11196484 | 3300013306 | Bacteria | 862 |
| 229 | Ga0157372_10249913 | 3300013307 | Bacteria | 2058 |
| 230 | Ga0157375_10002055 | 3300013308 | Bacteria | 17375 |
| 231 | Ga0157375_10002541 | 3300013308 | Bacteria | 15830 |
| 232 | Ga0157375_10016354 | 3300013308 | Bacteria | 6660 |
| 233 | Ga0157375_10048095 | 3300013308 | Bacteria | 4170 |
| 234 | Ga0157375_10150354 | 3300013308 | Bacteria | 2463 |
| 235 | Ga0157375_10169790 | 3300013308 | Bacteria | 2328 |
| 236 | Ga0163163_10028522 | 3300014325 | Bacteria | 5361 |
| 237 | Ga0157380_10001799 | 3300014326 | Bacteria | 14150 |
| 238 | Ga0157380_10292158 | 3300014326 | Bacteria | 1497 |
| 239 | Ga0157380_10324419 | 3300014326 | Bacteria | 1429 |
| 240 | Ga0157377_10333822 | 3300014745 | Bacteria | 1012 |
| 241 | Ga0157379_10003578 | 3300014968 | Bacteria | 13166 |
| 242 | Ga0157379_10051980 | 3300014968 | Bacteria | 3658 |
| 243 | Ga0157379_10101656 | 3300014968 | Bacteria | 2580 |
| 244 | Ga0157379_10260300 | 3300014968 | Bacteria | 1576 |
| 245 | Ga0157376_10011472 | 3300014969 | Bacteria | 6533 |
| 246 | Ga0157376_10414817 | 3300014969 | Bacteria | 1305 |
| 247 | Ga0163161_10020557 | 3300017792 | Bacteria | 4634 |
| 248 | Ga0163161_10050183 | 3300017792 | Bacteria | 3019 |
| 249 | Ga0207697_10032724 | 3300025315 | Bacteria | 2128 |
| 250 | Ga0207656_10051403 | 3300025321 | Bacteria | 1782 |
| 251 | Ga0207656_10157806 | 3300025321 | Bacteria | 1078 |
| 252 | Ga0207653_10009738 | 3300025885 | Bacteria | 2995 |
| 253 | Ga0207682_10030239 | 3300025893 | Bacteria | 2168 |
| 254 | Ga0207682_10057582 | 3300025893 | Bacteria | 1621 |
| 255 | Ga0207642_10001183 | 3300025899 | Bacteria | 8047 |
| 256 | Ga0207642_10037267 | 3300025899 | Bacteria | 2094 |
| 257 | Ga0207710_10035686 | 3300025900 | Bacteria | 2188 |
| 258 | Ga0207680_10002952 | 3300025903 | Bacteria | 7976 |
| 259 | Ga0207680_10097218 | 3300025903 | Bacteria | 1885 |
| 260 | Ga0207645_10002094 | 3300025907 | Bacteria | 15962 |
| 261 | Ga0207645_10074227 | 3300025907 | Bacteria | 2177 |
| 262 | Ga0207705_10960190 | 3300025909 | Bacteria | 661 |
| 263 | Ga0207684_10003422 | 3300025910 | Bacteria | 15497 |
| 264 | Ga0207684_10292962 | 3300025910 | Bacteria | 1403 |
| 265 | Ga0207684_11099752 | 3300025910 | Bacteria | 662 |
| 266 | Ga0207654_10084565 | 3300025911 | Bacteria | 1918 |
| 267 | Ga0207654_10112945 | 3300025911 | Bacteria | 1693 |
| 268 | Ga0207707_10044769 | 3300025912 | Bacteria | 3857 |
| 269 | Ga0207707_10058244 | 3300025912 | Bacteria | 3362 |
| 270 | Ga0207707_10145849 | 3300025912 | Bacteria | 2069 |
| 271 | Ga0207695_10071380 | 3300025913 | Bacteria | 3547 |
| 272 | Ga0207695_10336237 | 3300025913 | Bacteria | 1398 |
| 273 | Ga0207671_10002001 | 3300025914 | Bacteria | 22453 |
| 274 | Ga0207660_10029109 | 3300025917 | Bacteria | 3785 |
| 275 | Ga0207660_10148486 | 3300025917 | Bacteria | 1799 |
| 276 | Ga0207662_10011160 | 3300025918 | Bacteria | 4974 |
| 277 | Ga0207662_10132734 | 3300025918 | Bacteria | 1571 |
| 278 | Ga0207657_10384418 | 3300025919 | Bacteria | 1105 |
| 279 | Ga0207649_10084164 | 3300025920 | Bacteria | 2067 |
| 280 | Ga0207652_10028509 | 3300025921 | Bacteria | 4659 |
| 281 | Ga0207652_10300546 | 3300025921 | Bacteria | 1449 |
| 282 | Ga0207646_10079823 | 3300025922 | Bacteria | 2925 |
| 283 | Ga0207681_10000308 | 3300025923 | Bacteria | 35918 |
| 284 | Ga0207681_10140066 | 3300025923 | Bacteria | 1800 |
| 285 | Ga0207681_10147949 | 3300025923 | Bacteria | 1757 |
| 286 | Ga0207681_10352707 | 3300025923 | Bacteria | 1178 |
| 287 | Ga0207681_10508941 | 3300025923 | Bacteria | 987 |
| 288 | Ga0207694_10039863 | 3300025924 | Bacteria | 3615 |
| 289 | Ga0207694_10179720 | 3300025924 | Bacteria | 1715 |
| 290 | Ga0207650_10001008 | 3300025925 | Bacteria | 21196 |
| 291 | Ga0207650_10002178 | 3300025925 | Bacteria | 13682 |
| 292 | Ga0207650_10101075 | 3300025925 | Bacteria | 2219 |
| 293 | Ga0207659_10012776 | 3300025926 | Bacteria | 5360 |
| 294 | Ga0207687_10255921 | 3300025927 | Bacteria | 1394 |
| 295 | Ga0207664_10589841 | 3300025929 | Bacteria | 998 |
| 296 | Ga0207644_10000233 | 3300025931 | Bacteria | 38178 |
| 297 | Ga0207644_10025887 | 3300025931 | Bacteria | 4037 |
| 298 | Ga0207644_10053943 | 3300025931 | Bacteria | 2894 |
| 299 | Ga0207644_10173294 | 3300025931 | Unclassified | 1686 |
| 300 | Ga0207644_10241897 | 3300025931 | Bacteria | 1437 |
| 301 | Ga0207690_10351389 | 3300025932 | Bacteria | 1166 |
| 302 | Ga0207706_10004526 | 3300025933 | Bacteria | 13057 |
| 303 | Ga0207706_10008475 | 3300025933 | Bacteria | 9481 |
| 304 | Ga0207706_10224056 | 3300025933 | Bacteria | 1646 |
| 305 | Ga0207706_10279851 | 3300025933 | Bacteria | 1455 |
| 306 | Ga0207686_10051722 | 3300025934 | Bacteria | 2560 |
| 307 | Ga0207686_10111659 | 3300025934 | Bacteria | 1845 |
| 308 | Ga0207709_10004196 | 3300025935 | Bacteria | 8361 |
| 309 | Ga0207709_10010801 | 3300025935 | Bacteria | 5028 |
| 310 | Ga0207709_10033078 | 3300025935 | Bacteria | 3033 |
| 311 | Ga0207669_10000725 | 3300025937 | Bacteria | 14268 |
| 312 | Ga0207669_10138163 | 3300025937 | Unclassified | 1687 |
| 313 | Ga0207704_10001008 | 3300025938 | Bacteria | 12492 |
| 314 | Ga0207704_10002634 | 3300025938 | Bacteria | 8100 |
| 315 | Ga0207704_10148057 | 3300025938 | Bacteria | 1652 |
| 316 | Ga0207704_10227583 | 3300025938 | Bacteria | 1384 |
| 317 | Ga0207704_10860757 | 3300025938 | Bacteria | 760 |
| 318 | Ga0207665_10017636 | 3300025939 | Bacteria | 4691 |
| 319 | Ga0207691_10002582 | 3300025940 | Bacteria | 17694 |
| 320 | Ga0207691_10009767 | 3300025940 | Bacteria | 9211 |
| 321 | Ga0207691_10075309 | 3300025940 | Bacteria | 3043 |
| 322 | Ga0207691_10085414 | 3300025940 | Bacteria | 2832 |
| 323 | Ga0207691_10119482 | 3300025940 | Bacteria | 2337 |
| 324 | Ga0207691_10211435 | 3300025940 | Bacteria | 1684 |
| 325 | Ga0207691_10444763 | 3300025940 | Unclassified | 1103 |
| 326 | Ga0207711_10024925 | 3300025941 | Bacteria | 5017 |
| 327 | Ga0207711_10028704 | 3300025941 | Bacteria | 4685 |
| 328 | Ga0207689_10002808 | 3300025942 | Bacteria | 16090 |
| 329 | Ga0207689_10005397 | 3300025942 | Bacteria | 11441 |
| 330 | Ga0207689_10135934 | 3300025942 | Unclassified | 2024 |
| 331 | Ga0207689_10317192 | 3300025942 | Bacteria | 1293 |
| 332 | Ga0207679_10110804 | 3300025945 | Bacteria | 2166 |
| 333 | Ga0207679_10305939 | 3300025945 | Bacteria | 1372 |
| 334 | Ga0207667_10073768 | 3300025949 | Bacteria | 3545 |
| 335 | Ga0207667_10115988 | 3300025949 | Bacteria | 2760 |
| 336 | Ga0207651_10074361 | 3300025960 | Bacteria | 2419 |
| 337 | Ga0207651_10147543 | 3300025960 | Bacteria | 1826 |
| 338 | Ga0207651_10291583 | 3300025960 | Bacteria | 1353 |
| 339 | Ga0207651_10871938 | 3300025960 | Bacteria | 801 |
| 340 | Ga0207712_10012095 | 3300025961 | Bacteria | 5511 |
| 341 | Ga0207712_10052892 | 3300025961 | Bacteria | 2846 |
| 342 | Ga0207712_10328831 | 3300025961 | Bacteria | 1264 |
| 343 | Ga0207668_10071966 | 3300025972 | Bacteria | 2472 |
| 344 | Ga0207668_10219076 | 3300025972 | Unclassified | 1527 |
| 345 | Ga0207640_10060522 | 3300025981 | Bacteria | 2503 |
| 346 | Ga0207640_10414024 | 3300025981 | Bacteria | 1101 |
| 347 | Ga0207658_10001166 | 3300025986 | Bacteria | 20974 |
| 348 | Ga0207658_10111477 | 3300025986 | Bacteria | 2164 |
| 349 | Ga0207658_10186754 | 3300025986 | Bacteria | 1720 |
| 350 | Ga0207658_10331692 | 3300025986 | Unclassified | 1320 |
| 351 | Ga0207658_10364220 | 3300025986 | Bacteria | 1262 |
| 352 | Ga0207677_11049029 | 3300026023 | Bacteria | 741 |
| 353 | Ga0207703_10000414 | 3300026035 | Bacteria | 45564 |
| 354 | Ga0207639_10178761 | 3300026041 | Bacteria | 1803 |
| 355 | Ga0207639_10801093 | 3300026041 | Unclassified | 878 |
| 356 | Ga0207678_10002005 | 3300026067 | Bacteria | 18533 |
| 357 | Ga0207708_10019250 | 3300026075 | Bacteria | 5143 |
| 358 | Ga0207702_10153301 | 3300026078 | Bacteria | 2098 |
| 359 | Ga0207641_10000615 | 3300026088 | Bacteria | 38942 |
| 360 | Ga0207641_10333183 | 3300026088 | Bacteria | 1442 |
| 361 | Ga0207648_10001283 | 3300026089 | Bacteria | 28030 |
| 362 | Ga0207648_10001858 | 3300026089 | Bacteria | 23063 |
| 363 | Ga0207648_10048979 | 3300026089 | Bacteria | 3699 |
| 364 | Ga0207648_10100968 | 3300026089 | Bacteria | 2528 |
| 365 | Ga0207648_10241859 | 3300026089 | Bacteria | 1607 |
| 366 | Ga0207648_10421466 | 3300026089 | Bacteria | 1212 |
| 367 | Ga0207648_10780704 | 3300026089 | Bacteria | 888 |
| 368 | Ga0207676_10016903 | 3300026095 | Bacteria | 5282 |
| 369 | Ga0207676_10025075 | 3300026095 | Unclassified | 4422 |
| 370 | Ga0207676_10028948 | 3300026095 | Bacteria | 4143 |
| 371 | Ga0207676_10347071 | 3300026095 | Bacteria | 1371 |
| 372 | Ga0207674_10005690 | 3300026116 | Bacteria | 14779 |
| 373 | Ga0207674_10051704 | 3300026116 | Bacteria | 4193 |
| 374 | Ga0207674_10182374 | 3300026116 | Bacteria | 2050 |
| 375 | Ga0207674_10321593 | 3300026116 | Bacteria | 1496 |
| 376 | Ga0207674_10719175 | 3300026116 | Bacteria | 964 |
| 377 | Ga0207675_100002985 | 3300026118 | Bacteria | 16625 |
| 378 | Ga0207675_100078237 | 3300026118 | Bacteria | 3099 |
| 379 | Ga0207675_100138013 | 3300026118 | Bacteria | 2315 |
| 380 | Ga0207683_10039813 | 3300026121 | Bacteria | 4100 |
| 381 | Ga0207683_10066045 | 3300026121 | Bacteria | 3190 |
| 382 | Ga0207683_10169405 | 3300026121 | Bacteria | 1977 |
| 383 | Ga0207698_10004887 | 3300026142 | Bacteria | 8219 |
| 384 | Ga0207698_10022022 | 3300026142 | Bacteria | 4420 |
| 385 | Ga0207698_10080048 | 3300026142 | Bacteria | 2630 |
| 386 | Ga0210000_1001718 | 3300027462 | Bacteria | 3094 |
| 387 | Ga0209999_1000757 | 3300027543 | Bacteria | 5274 |
| 388 | Ga0209588_1021796 | 3300027671 | Bacteria | 2014 |
| 389 | Ga0207428_10004772 | 3300027907 | Bacteria | 12803 |
| 390 | Ga0268265_10002595 | 3300028380 | Bacteria | 13467 |
| 391 | Ga0268265_10026127 | 3300028380 | Bacteria | 4151 |
| 392 | Ga0268265_10301381 | 3300028380 | Bacteria | 1443 |
| 393 | Ga0268265_10519404 | 3300028380 | Unclassified | 1125 |
| 394 | Ga0268265_10642572 | 3300028380 | Bacteria | 1019 |
| 395 | Ga0268264_10000780 | 3300028381 | Bacteria | 35025 |
| 396 | Ga0268264_10019710 | 3300028381 | Bacteria | 5510 |
| 397 | Ga0268264_10062513 | 3300028381 | Bacteria | 3127 |
| 398 | Ga0268264_10062845 | 3300028381 | Bacteria | 3119 |
| 399 | Ga0268264_10102221 | 3300028381 | Bacteria | 2494 |
| 400 | Ga0268264_10580374 | 3300028381 | Bacteria | 1103 |
| 401 | Ga0307408_100040891 | 3300031548 | Bacteria | 3285 |
| 402 | Ga0307405_10090200 | 3300031731 | Bacteria | 2027 |
| 403 | Ga0307413_10182145 | 3300031824 | Bacteria | 1499 |
| 404 | Ga0307410_10149993 | 3300031852 | Bacteria | 1735 |
| 405 | Ga0307407_10093160 | 3300031903 | Bacteria | 1852 |
| 406 | Ga0307412_10439178 | 3300031911 | Bacteria | 1072 |
| 407 | Ga0307409_100103265 | 3300031995 | Bacteria | 2370 |
| 408 | Ga0307416_100001193 | 3300032002 | Bacteria | 13976 |
| 409 | Ga0307416_100171118 | 3300032002 | Bacteria | 2022 |
| 410 | Ga0307416_100388789 | 3300032002 | Bacteria | 1428 |
| 411 | Ga0307414_11028472 | 3300032004 | Bacteria | 759 |
| 412 | Ga0307411_10011045 | 3300032005 | Bacteria | 4851 |
| 413 | Ga0307415_100001120 | 3300032126 | Bacteria | 12518 |
| 414 | Ga0373949_0044485 | 3300035090 | Bacteria | 1102 |
| 415 | Ga0373941_0160003 | 3300035115 | Bacteria | 832 |
| 416 | Ga0373946_0314183 | 3300035171 | Bacteria | 777 |
| 417 | Ga0373955_0021268 | 3300035172 | Bacteria | 3273 |
| 418 | Ga0373955_0127423 | 3300035172 | Bacteria | 1484 |
| 419 | Ga0373942_0030852 | 3300035207 | Bacteria | 1414 |
| 420 | Ga0373924_0024407 | 3300035410 | Bacteria | 2382 |
| 421 | Ga0373931_0001530 | 3300035691 | Bacteria | 9968 |
| 422 | Ga0373935_0150814 | 3300035692 | Bacteria | 1577 |
| 423 | Ga0373927_0078297 | 3300035695 | Bacteria | 2141 |
| 424 | Ga0373927_0095432 | 3300035695 | Bacteria | 1933 |
| 425 | Ga0373947_0064888 | 3300035725 | Bacteria | 2227 |
| 426 | Ga0373947_0083668 | 3300035725 | Bacteria | 1979 |
| 427 | Ga0373937_0038192 | 3300036401 | Bacteria | 4376 |
| 428 | Ga0373937_0097813 | 3300036401 | Bacteria | 2722 |
| 429 | Ga0373937_0413168 | 3300036401 | Bacteria | 1280 |
| 430 | Ga0373925_0000845 | 3300037068 | Bacteria | 28162 |
| 431 | Ga0451853_1783048 | 3300041512 | Bacteria | 1956 |
| 432 | Ga0439441_011407 | 3300042001 | Bacteria | 1507 |
| 433 | Ga0439464_0184906 | 3300042439 | Bacteria | 661 |
| 434 | Ga0451576_0258777 | 3300045051 | Bacteria | 1819 |
| 435 | Ga0495603_0159038 | 3300046455 | Bacteria | 1311 |
| 436 | Ga0495603_0166158 | 3300046455 | Bacteria | 1279 |
| 437 | Ga0495629_0159074 | 3300046459 | Bacteria | 1569 |
| 438 | Ga0495641_0126388 | 3300046461 | Bacteria | 1141 |
| 439 | Ga0495651_0399200 | 3300046462 | Bacteria | 898 |
| 440 | Ga0495580_0156721 | 3300046472 | Bacteria | 1577 |
| 441 | Ga0495580_0315555 | 3300046472 | Bacteria | 1063 |
| 442 | Ga0495585_0372991 | 3300046492 | Bacteria | 690 |
| 443 | Ga0495620_0171489 | 3300046515 | Bacteria | 841 |
| 444 | Ga0495628_0153973 | 3300046516 | Bacteria | 1750 |
| 445 | Ga0495663_0063229 | 3300046525 | Bacteria | 1167 |
| 446 | Ga0495586_0127151 | 3300046535 | Bacteria | 1426 |
| 447 | Ga0495586_0130446 | 3300046535 | Bacteria | 1407 |
| 448 | Ga0495621_0100855 | 3300046539 | Bacteria | 1098 |
| 449 | Ga0495645_0032857 | 3300046543 | Bacteria | 3785 |
| 450 | Ga0495656_0056435 | 3300046615 | Bacteria | 1697 |
| 451 | Ga0495635_0057299 | 3300046663 | Bacteria | 2681 |
| 452 | Ga0495657_0445751 | 3300046675 | Bacteria | 758 |
| 453 | Ga0495599_0046159 | 3300046678 | Bacteria | 2732 |
| 454 | Ga0495647_0064064 | 3300046681 | Bacteria | 1457 |
| 455 | Ga0495658_0012026 | 3300046683 | Bacteria | 4371 |
| 456 | Ga0495658_0017020 | 3300046683 | Bacteria | 3748 |
| 457 | Ga0495669_0005865 | 3300046684 | Bacteria | 5120 |
| 458 | Ga0495669_0353461 | 3300046684 | Bacteria | 710 |
| 459 | Ga0495674_0134010 | 3300047319 | Bacteria | 2086 |
| 460 | Ga0495680_0053172 | 3300047322 | Bacteria | 3154 |
| 461 | Ga0495684_0026078 | 3300047471 | Bacteria | 4493 |
| 462 | Ga0496102_0008252 | 3300048905 | Bacteria | 8920 |
| 463 | Ga0496103_0092684 | 3300048906 | Bacteria | 1907 |
| 464 | Ga0496106_0283417 | 3300048909 | Bacteria | 1327 |
| 465 | Ga0496108_0123745 | 3300048911 | Bacteria | 2219 |
| 466 | Ga0496109_0229061 | 3300048912 | Bacteria | 1748 |
| 467 | Ga0496109_0233687 | 3300048912 | Bacteria | 1730 |
| 468 | Ga0496110_0092527 | 3300048913 | Bacteria | 2706 |
| 469 | Ga0501031_0048841 | 3300049568 | Bacteria | 2757 |
| 470 | Ga0501032_0065492 | 3300049569 | Bacteria | 2430 |
| 471 | Ga0501033_0004048 | 3300049570 | Bacteria | 11838 |
| 472 | Ga0501034_0000406 | 3300049571 | Bacteria | 72755 |
| 473 | Ga0501034_0002174 | 3300049571 | Bacteria | 24290 |
| 474 | Ga0501036_0011077 | 3300049572 | Bacteria | 7457 |
| 475 | Ga0501037_0023042 | 3300049573 | Bacteria | 4605 |
| 476 | Ga0501038_0000668 | 3300049574 | Bacteria | 30539 |
| 477 | Ga0501039_0007014 | 3300049575 | Bacteria | 8578 |
| 478 | Ga0501040_0002705 | 3300049576 | Bacteria | 11427 |
| 479 | Ga0501040_0037480 | 3300049576 | Bacteria | 3294 |
| 480 | Ga0501040_0225807 | 3300049576 | Bacteria | 1333 |
| 481 | Ga0501041_0000098 | 3300049577 | Bacteria | 35755 |
| 482 | Ga0501041_0081699 | 3300049577 | Bacteria | 1990 |
| 483 | Ga0501042_0000242 | 3300049578 | Bacteria | 26466 |
| 484 | Ga0501042_0112725 | 3300049578 | Bacteria | 1958 |
| 485 | Ga0501042_0178129 | 3300049578 | Bacteria | 1533 |
| 486 | Ga0501043_0101839 | 3300049579 | Bacteria | 2257 |
| 487 | Ga0501046_0000144 | 3300049580 | Bacteria | 74352 |
| 488 | Ga0501047_0157730 | 3300049581 | Bacteria | 2142 |
| 489 | Ga0501048_0008341 | 3300049582 | Bacteria | 7835 |
| 490 | Ga0501067_0124185 | 3300049583 | Bacteria | 1437 |
| 491 | Ga0501068_0005592 | 3300049584 | Bacteria | 6883 |
| 492 | Ga0501068_0018055 | 3300049584 | Bacteria | 4085 |
| 493 | Ga0501069_0186441 | 3300049585 | Bacteria | 1200 |
| 494 | Ga0501069_0355022 | 3300049585 | Bacteria | 864 |
| 495 | Ga0501070_0058828 | 3300049586 | Bacteria | 3186 |
| 496 | Ga0501070_0074020 | 3300049586 | Bacteria | 2819 |
| 497 | Ga0501071_0006755 | 3300049587 | Bacteria | 7470 |
| 498 | Ga0501071_0112682 | 3300049587 | Bacteria | 2011 |
| 499 | Ga0501072_0001347 | 3300049588 | Bacteria | 18406 |
| 500 | Ga0501072_0001685 | 3300049588 | Bacteria | 16461 |
| 501 | Ga0501072_0054971 | 3300049588 | Bacteria | 3138 |
| 502 | Ga0501073_0032995 | 3300049589 | Bacteria | 3689 |
| 503 | Ga0501074_0063744 | 3300049590 | Bacteria | 2654 |
| 504 | Ga0501074_0433471 | 3300049590 | Bacteria | 932 |
| 505 | Ga0501074_0512083 | 3300049590 | Bacteria | 850 |
| 506 | Ga0501075_0000101 | 3300049591 | Bacteria | 39774 |
| 507 | Ga0501075_0017493 | 3300049591 | Bacteria | 5180 |
| 508 | Ga0501075_0018641 | 3300049591 | Bacteria | 5025 |
| 509 | Ga0501076_0035324 | 3300049592 | Bacteria | 3911 |
| 510 | Ga0501076_0160853 | 3300049592 | Bacteria | 1829 |
| 511 | Ga0501076_0170270 | 3300049592 | Bacteria | 1775 |
| 512 | Ga0501076_0174084 | 3300049592 | Bacteria | 1754 |
| 513 | Ga0501077_0000994 | 3300049593 | Bacteria | 17080 |
| 514 | Ga0501077_0020557 | 3300049593 | Bacteria | 4179 |
| 515 | Ga0501077_0094343 | 3300049593 | Bacteria | 1897 |
| 516 | Ga0501079_0000459 | 3300049741 | Bacteria | 26782 |
| 517 | Ga0501079_0011265 | 3300049741 | Bacteria | 6822 |
| 518 | Ga0501080_0042174 | 3300049742 | Bacteria | 4250 |
| 519 | Ga0501080_0044844 | 3300049742 | Bacteria | 4115 |
| 520 | Ga0501080_0086996 | 3300049742 | Bacteria | 2904 |
| 521 | Ga0501080_0628343 | 3300049742 | Bacteria | 952 |
| 522 | Ga0501081_0000680 | 3300049743 | Bacteria | 19572 |
| 523 | Ga0501081_0002406 | 3300049743 | Bacteria | 11800 |
| 524 | Ga0501083_0197124 | 3300049744 | Bacteria | 1314 |
| 525 | Ga0501035_0080030 | 3300049822 | Bacteria | 2885 |
| 526 | Ga0501035_0144481 | 3300049822 | Bacteria | 2067 |
| 527 | Ga0501044_0071240 | 3300049823 | Bacteria | 3535 |
| 528 | Ga0501045_0002526 | 3300049824 | Bacteria | 12452 |
| 529 | Ga0501045_0092703 | 3300049824 | Bacteria | 2234 |
| 530 | nmdc:mga05p37_29333_c1 | 3300050507 | Bacteria | 6714 |
| 531 | nmdc:mga05p37_510_c1 | 3300050507 | Bacteria | 42907 |
| 532 | nmdc:mga05p37_931_c1 | 3300050507 | Bacteria | 32975 |
| 533 | nmdc:mga09592_1086_c1 | 3300050508 | Bacteria | 21589 |
| 534 | nmdc:mga09592_49676_c1 | 3300050508 | Bacteria | 3537 |
| 535 | nmdc:mga09592_75_c1 | 3300050508 | Bacteria | 56459 |
| 536 | nmdc:mga0qj67_368_c1 | 3300050509 | Bacteria | 30906 |
| 537 | nmdc:mga06r32_136009_c1 | 3300050510 | Bacteria | 2432 |
| 538 | nmdc:mga06r32_148618_c1 | 3300050510 | Bacteria | 2321 |
| 539 | nmdc:mga06r32_15504_c1 | 3300050510 | Bacteria | 6920 |
| 540 | nmdc:mga06r32_1675_c1 | 3300050510 | Bacteria | 20002 |
| 541 | nmdc:mga06r32_564910_c1 | 3300050510 | Bacteria | 1111 |
| 542 | nmdc:mga08y16_124755_c1 | 3300050511 | Bacteria | 2679 |
| 543 | nmdc:mga08y16_183697_c1 | 3300050511 | Bacteria | 2170 |
| 544 | nmdc:mga08y16_56348_c1 | 3300050511 | Bacteria | 4108 |
| 545 | nmdc:mga08x19_22243_c1 | 3300050514 | Bacteria | 3925 |
| 546 | nmdc:mga0a205_538952_c1 | 3300050515 | Bacteria | 1023 |
| 547 | Ga0495601_0042566 | 3300053077 | Bacteria | 2850 |
| 548 | Ga0495601_0141193 | 3300053077 | Bacteria | 1571 |
| 549 | Ga0495612_0027102 | 3300053078 | Bacteria | 2304 |
| 550 | Ga0495595_0071075 | 3300053084 | Bacteria | 1645 |
| 551 | Ga0495619_0075349 | 3300053085 | Bacteria | 2264 |
| 552 | Ga0501084_0053651 | 3300054114 | Bacteria | 3372 |
| 553 | Ga0501082_0024634 | 3300060353 | Bacteria | 5187 |
| 554 | Ga0501082_0389290 | 3300060353 | Bacteria | 1216 |
| 555 | Ga0530510_0000221 | 3300061734 | Bacteria | 35515 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025931 | Ga0207644_10000233 | Ga0207644_1000023314 | 189 |
| 2 | 3300025941 | Ga0207711_10028704 | Ga0207711_100287043 | 189 |
| 3 | 3300026095 | Ga0207676_10347071 | Ga0207676_103470712 | 189 |
| 4 | 3300031824 | Ga0307413_10182145 | Ga0307413_101821453 | 191 |
| 5 | 3300005338 | Ga0068868_100027304 | Ga0068868_1000273043 | 192 |
| 6 | 3300005355 | Ga0070671_100012508 | Ga0070671_1000125085 | 192 |
| 7 | 3300005355 | Ga0070671_100015021 | Ga0070671_1000150216 | 192 |
| 8 | 3300005455 | Ga0070663_100026998 | Ga0070663_1000269984 | 192 |
| 9 | 3300005456 | Ga0070678_100102152 | Ga0070678_1001021523 | 192 |
| 10 | 3300005539 | Ga0068853_100064855 | Ga0068853_1000648554 | 192 |
| 11 | 3300005543 | Ga0070672_100078033 | Ga0070672_1000780332 | 192 |
| 12 | 3300005543 | Ga0070672_100152168 | Ga0070672_1001521682 | 192 |
| 13 | 3300005834 | Ga0068851_10004147 | Ga0068851_100041477 | 192 |
| 14 | 3300005840 | Ga0068870_10114659 | Ga0068870_101146592 | 192 |
| 15 | 3300005841 | Ga0068863_100211152 | Ga0068863_1002111523 | 192 |
| 16 | 3300006237 | Ga0097621_100130435 | Ga0097621_1001304354 | 192 |
| 17 | 3300006358 | Ga0068871_100352182 | Ga0068871_1003521822 | 192 |
| 18 | 3300013296 | Ga0157374_10167080 | Ga0157374_101670803 | 192 |
| 19 | 3300013308 | Ga0157375_10169790 | Ga0157375_101697904 | 192 |
| 20 | 3300025321 | Ga0207656_10051403 | Ga0207656_100514032 | 192 |
| 21 | 3300025925 | Ga0207650_10101075 | Ga0207650_101010753 | 192 |
| 22 | 3300025931 | Ga0207644_10025887 | Ga0207644_100258875 | 192 |
| 23 | 3300025940 | Ga0207691_10009767 | Ga0207691_100097676 | 192 |
| 24 | 3300025960 | Ga0207651_10074361 | Ga0207651_100743612 | 192 |
| 25 | 3300025986 | Ga0207658_10186754 | Ga0207658_101867543 | 192 |
| 26 | 3300026067 | Ga0207678_10002005 | Ga0207678_1000200513 | 192 |
| 27 | 3300026095 | Ga0207676_10028948 | Ga0207676_100289485 | 192 |
| 28 | 3300026121 | Ga0207683_10039813 | Ga0207683_100398133 | 192 |
| 29 | 3300046515 | Ga0495620_0171489 | Ga0495620_0171489_139_765 | 192 |
| 30 | 3300046539 | Ga0495621_0100855 | Ga0495621_0100855_187_813 | 192 |
| 31 | 3300048911 | Ga0496108_0123745 | Ga0496108_0123745_400_1026 | 192 |
| 32 | 3300048912 | Ga0496109_0229061 | Ga0496109_0229061_623_1249 | 192 |
| 33 | 3300048912 | Ga0496109_0233687 | Ga0496109_0233687_580_1206 | 192 |
| 34 | 3300048913 | Ga0496110_0092527 | Ga0496110_0092527_647_1273 | 192 |
| 35 | 3300005548 | Ga0070665_100347379 | Ga0070665_1003473792 | 194 |
| 36 | 3300025942 | Ga0207689_10317192 | Ga0207689_103171922 | 194 |
| 37 | 3300025960 | Ga0207651_10871938 | Ga0207651_108719382 | 194 |
| 38 | 3300005336 | Ga0070680_100156120 | Ga0070680_1001561202 | 195 |
| 39 | 3300005353 | Ga0070669_100028821 | Ga0070669_1000288214 | 195 |
| 40 | 3300005356 | Ga0070674_100117056 | Ga0070674_1001170563 | 195 |
| 41 | 3300005365 | Ga0070688_100147183 | Ga0070688_1001471832 | 195 |
| 42 | 3300005367 | Ga0070667_100283900 | Ga0070667_1002839002 | 195 |
| 43 | 3300005440 | Ga0070705_100317857 | Ga0070705_1003178572 | 195 |
| 44 | 3300005455 | Ga0070663_100217322 | Ga0070663_1002173222 | 195 |
| 45 | 3300005456 | Ga0070678_100057728 | Ga0070678_1000577283 | 195 |
| 46 | 3300005456 | Ga0070678_100223481 | Ga0070678_1002234812 | 195 |
| 47 | 3300005458 | Ga0070681_10039177 | Ga0070681_100391773 | 195 |
| 48 | 3300005466 | Ga0070685_10324796 | Ga0070685_103247961 | 195 |
| 49 | 3300005468 | Ga0070707_100453719 | Ga0070707_1004537192 | 195 |
| 50 | 3300005471 | Ga0070698_100365492 | Ga0070698_1003654922 | 195 |
| 51 | 3300005530 | Ga0070679_100140166 | Ga0070679_1001401662 | 195 |
| 52 | 3300005539 | Ga0068853_100038903 | Ga0068853_1000389033 | 195 |
| 53 | 3300005545 | Ga0070695_101069200 | Ga0070695_1010692001 | 195 |
| 54 | 3300005547 | Ga0070693_100435490 | Ga0070693_1004354901 | 195 |
| 55 | 3300005577 | Ga0068857_100088417 | Ga0068857_1000884173 | 195 |
| 56 | 3300005617 | Ga0068859_100026239 | Ga0068859_1000262393 | 195 |
| 57 | 3300005843 | Ga0068860_100062489 | Ga0068860_1000624891 | 195 |
| 58 | 3300005844 | Ga0068862_100098828 | Ga0068862_1000988283 | 195 |
| 59 | 3300006195 | Ga0075366_10027341 | Ga0075366_100273413 | 195 |
| 60 | 3300006931 | Ga0097620_100026240 | Ga0097620_1000262406 | 195 |
| 61 | 3300009093 | Ga0105240_10323099 | Ga0105240_103230992 | 195 |
| 62 | 3300009094 | Ga0111539_10066518 | Ga0111539_100665185 | 195 |
| 63 | 3300009148 | Ga0105243_10218957 | Ga0105243_102189572 | 195 |
| 64 | 3300009148 | Ga0105243_10221556 | Ga0105243_102215562 | 195 |
| 65 | 3300009176 | Ga0105242_11308421 | Ga0105242_113084211 | 195 |
| 66 | 3300009553 | Ga0105249_10006010 | Ga0105249_100060103 | 195 |
| 67 | 3300009553 | Ga0105249_10126985 | Ga0105249_101269852 | 195 |
| 68 | 3300010375 | Ga0105239_10417656 | Ga0105239_104176561 | 195 |
| 69 | 3300011119 | Ga0105246_10275379 | Ga0105246_102753792 | 195 |
| 70 | 3300013105 | Ga0157369_10000125 | Ga0157369_1000012536 | 195 |
| 71 | 3300013297 | Ga0157378_10030746 | Ga0157378_100307462 | 195 |
| 72 | 3300013306 | Ga0163162_10105025 | Ga0163162_101050253 | 195 |
| 73 | 3300013308 | Ga0157375_10048095 | Ga0157375_100480952 | 195 |
| 74 | 3300014968 | Ga0157379_10101656 | Ga0157379_101016562 | 195 |
| 75 | 3300017792 | Ga0163161_10050183 | Ga0163161_100501833 | 195 |
| 76 | 3300025899 | Ga0207642_10037267 | Ga0207642_100372673 | 195 |
| 77 | 3300025911 | Ga0207654_10084565 | Ga0207654_100845652 | 195 |
| 78 | 3300025912 | Ga0207707_10058244 | Ga0207707_100582442 | 195 |
| 79 | 3300025913 | Ga0207695_10071380 | Ga0207695_100713805 | 195 |
| 80 | 3300025914 | Ga0207671_10002001 | Ga0207671_100020011 | 195 |
| 81 | 3300025917 | Ga0207660_10148486 | Ga0207660_101484862 | 195 |
| 82 | 3300025924 | Ga0207694_10039863 | Ga0207694_100398632 | 195 |
| 83 | 3300025935 | Ga0207709_10033078 | Ga0207709_100330782 | 195 |
| 84 | 3300025937 | Ga0207669_10138163 | Ga0207669_101381632 | 195 |
| 85 | 3300025938 | Ga0207704_10002634 | Ga0207704_100026343 | 195 |
| 86 | 3300025940 | Ga0207691_10444763 | Ga0207691_104447631 | 195 |
| 87 | 3300025942 | Ga0207689_10135934 | Ga0207689_101359341 | 195 |
| 88 | 3300025961 | Ga0207712_10052892 | Ga0207712_100528922 | 195 |
| 89 | 3300025972 | Ga0207668_10219076 | Ga0207668_102190762 | 195 |
| 90 | 3300025986 | Ga0207658_10331692 | Ga0207658_103316922 | 195 |
| 91 | 3300026041 | Ga0207639_10178761 | Ga0207639_101787613 | 195 |
| 92 | 3300026089 | Ga0207648_10001858 | Ga0207648_100018588 | 195 |
| 93 | 3300026116 | Ga0207674_10051704 | Ga0207674_100517043 | 195 |
| 94 | 3300026121 | Ga0207683_10066045 | Ga0207683_100660453 | 195 |
| 95 | 3300028380 | Ga0268265_10519404 | Ga0268265_105194042 | 195 |
| 96 | 3300028381 | Ga0268264_10019710 | Ga0268264_100197102 | 195 |
| 97 | 3300031852 | Ga0307410_10149993 | Ga0307410_101499931 | 195 |
| 98 | 3300032004 | Ga0307414_11028472 | Ga0307414_110284722 | 195 |
| 99 | 3300035171 | Ga0373946_0314183 | Ga0373946_0314183_157_759 | 195 |
| 100 | 3300035695 | Ga0373927_0078297 | Ga0373927_0078297_350_952 | 195 |
| 101 | 3300035725 | Ga0373947_0083668 | Ga0373947_0083668_473_1075 | 195 |
| 102 | 3300037068 | Ga0373925_0000845 | Ga0373925_0000845_22692_23294 | 195 |
| 103 | 3300046455 | Ga0495603_0166158 | Ga0495603_0166158_298_900 | 195 |
| 104 | 3300046681 | Ga0495647_0064064 | Ga0495647_0064064_681_1283 | 195 |
| 105 | 3300046684 | Ga0495669_0005865 | Ga0495669_0005865_3719_4327 | 195 |
| 106 | 3300050511 | nmdc:mga08y16_56348_c1 | nmdc:mga08y16_56348_c1_531_1124 | 195 |
| 107 | 3300014326 | Ga0157380_10292158 | Ga0157380_102921582 | 196 |
| 108 | 3300049742 | Ga0501080_0628343 | Ga0501080_0628343_248_850 | 196 |
| 109 | 3300005434 | Ga0070709_10755978 | Ga0070709_107559781 | 197 |
| 110 | 3300005435 | Ga0070714_100008968 | Ga0070714_1000089686 | 197 |
| 111 | 3300005444 | Ga0070694_100516275 | Ga0070694_1005162752 | 197 |
| 112 | 3300013297 | Ga0157378_11615747 | Ga0157378_116157471 | 197 |
| 113 | 3300026089 | Ga0207648_10100968 | Ga0207648_101009682 | 197 |
| 114 | 3300028380 | Ga0268265_10026127 | Ga0268265_100261272 | 197 |
| 115 | 3300046684 | Ga0495669_0353461 | Ga0495669_0353461_38_631 | 197 |
| 116 | 3300049585 | Ga0501069_0186441 | Ga0501069_0186441_424_1071 | 197 |
| 117 | 3300049585 | Ga0501069_0355022 | Ga0501069_0355022_126_728 | 197 |
| 118 | 3300049587 | Ga0501071_0112682 | Ga0501071_0112682_1089_1739 | 197 |
| 119 | 3300049588 | Ga0501072_0001685 | Ga0501072_0001685_1250_1852 | 197 |
| 120 | 3300049822 | Ga0501035_0144481 | Ga0501035_0144481_503_1153 | 197 |
| 121 | 3300049823 | Ga0501044_0071240 | Ga0501044_0071240_1047_1787 | 197 |
| 122 | 3300005336 | Ga0070680_100047216 | Ga0070680_1000472162 | 198 |
| 123 | 3300005345 | Ga0070692_10026184 | Ga0070692_100261843 | 198 |
| 124 | 3300005345 | Ga0070692_10046708 | Ga0070692_100467082 | 198 |
| 125 | 3300005353 | Ga0070669_100476026 | Ga0070669_1004760262 | 198 |
| 126 | 3300005406 | Ga0070703_10002969 | Ga0070703_100029693 | 198 |
| 127 | 3300005440 | Ga0070705_100161743 | Ga0070705_1001617432 | 198 |
| 128 | 3300005440 | Ga0070705_100254304 | Ga0070705_1002543042 | 198 |
| 129 | 3300005441 | Ga0070700_100100323 | Ga0070700_1001003233 | 198 |
| 130 | 3300005444 | Ga0070694_100162342 | Ga0070694_1001623421 | 198 |
| 131 | 3300005467 | Ga0070706_100543298 | Ga0070706_1005432982 | 198 |
| 132 | 3300005518 | Ga0070699_100018485 | Ga0070699_1000184857 | 198 |
| 133 | 3300005536 | Ga0070697_100247936 | Ga0070697_1002479362 | 198 |
| 134 | 3300005539 | Ga0068853_100888899 | Ga0068853_1008888992 | 198 |
| 135 | 3300005545 | Ga0070695_100002311 | Ga0070695_1000023116 | 198 |
| 136 | 3300005549 | Ga0070704_100167527 | Ga0070704_1001675272 | 198 |
| 137 | 3300005577 | Ga0068857_100002520 | Ga0068857_10000252012 | 198 |
| 138 | 3300005617 | Ga0068859_100033758 | Ga0068859_1000337582 | 198 |
| 139 | 3300005617 | Ga0068859_100182735 | Ga0068859_1001827352 | 198 |
| 140 | 3300005618 | Ga0068864_100024342 | Ga0068864_1000243423 | 198 |
| 141 | 3300005843 | Ga0068860_100153687 | Ga0068860_1001536873 | 198 |
| 142 | 3300005843 | Ga0068860_101716961 | Ga0068860_1017169611 | 198 |
| 143 | 3300005844 | Ga0068862_100105584 | Ga0068862_1001055843 | 198 |
| 144 | 3300005844 | Ga0068862_100382222 | Ga0068862_1003822222 | 198 |
| 145 | 3300006844 | Ga0075428_100000828 | Ga0075428_1000008282 | 198 |
| 146 | 3300006844 | Ga0075428_100018021 | Ga0075428_1000180218 | 198 |
| 147 | 3300006846 | Ga0075430_100000127 | Ga0075430_10000012722 | 198 |
| 148 | 3300006847 | Ga0075431_100040114 | Ga0075431_1000401144 | 198 |
| 149 | 3300006847 | Ga0075431_100047352 | Ga0075431_1000473523 | 198 |
| 150 | 3300006847 | Ga0075431_100240629 | Ga0075431_1002406292 | 198 |
| 151 | 3300006880 | Ga0075429_100000075 | Ga0075429_10000007518 | 198 |
| 152 | 3300006880 | Ga0075429_100000762 | Ga0075429_10000076216 | 198 |
| 153 | 3300006880 | Ga0075429_100057422 | Ga0075429_1000574222 | 198 |
| 154 | 3300006931 | Ga0097620_100033755 | Ga0097620_1000337552 | 198 |
| 155 | 3300006931 | Ga0097620_100182723 | Ga0097620_1001827232 | 198 |
| 156 | 3300009093 | Ga0105240_10590580 | Ga0105240_105905802 | 198 |
| 157 | 3300009147 | Ga0114129_10002034 | Ga0114129_1000203423 | 198 |
| 158 | 3300009147 | Ga0114129_10020604 | Ga0114129_100206046 | 198 |
| 159 | 3300009174 | Ga0105241_10158053 | Ga0105241_101580533 | 198 |
| 160 | 3300009176 | Ga0105242_10063926 | Ga0105242_100639263 | 198 |
| 161 | 3300009553 | Ga0105249_10113090 | Ga0105249_101130902 | 198 |
| 162 | 3300009553 | Ga0105249_10390457 | Ga0105249_103904572 | 198 |
| 163 | 3300010375 | Ga0105239_10054807 | Ga0105239_100548075 | 198 |
| 164 | 3300025885 | Ga0207653_10009738 | Ga0207653_100097382 | 198 |
| 165 | 3300025910 | Ga0207684_10003422 | Ga0207684_1000342214 | 198 |
| 166 | 3300025910 | Ga0207684_10292962 | Ga0207684_102929621 | 198 |
| 167 | 3300025911 | Ga0207654_10112945 | Ga0207654_101129452 | 198 |
| 168 | 3300025913 | Ga0207695_10336237 | Ga0207695_103362372 | 198 |
| 169 | 3300025917 | Ga0207660_10029109 | Ga0207660_100291093 | 198 |
| 170 | 3300025923 | Ga0207681_10508941 | Ga0207681_105089412 | 198 |
| 171 | 3300025934 | Ga0207686_10051722 | Ga0207686_100517223 | 198 |
| 172 | 3300025935 | Ga0207709_10010801 | Ga0207709_100108013 | 198 |
| 173 | 3300025942 | Ga0207689_10005397 | Ga0207689_100053977 | 198 |
| 174 | 3300025961 | Ga0207712_10328831 | Ga0207712_103288312 | 198 |
| 175 | 3300025981 | Ga0207640_10414024 | Ga0207640_104140243 | 198 |
| 176 | 3300026041 | Ga0207639_10801093 | Ga0207639_108010931 | 198 |
| 177 | 3300026075 | Ga0207708_10019250 | Ga0207708_100192504 | 198 |
| 178 | 3300026116 | Ga0207674_10005690 | Ga0207674_100056902 | 198 |
| 179 | 3300028380 | Ga0268265_10642572 | Ga0268265_106425722 | 198 |
| 180 | 3300028381 | Ga0268264_10062513 | Ga0268264_100625133 | 198 |
| 181 | 3300028381 | Ga0268264_10580374 | Ga0268264_105803741 | 198 |
| 182 | 3300032002 | Ga0307416_100388789 | Ga0307416_1003887893 | 198 |
| 183 | 3300042001 | Ga0439441_011407 | Ga0439441_011407_472_1068 | 198 |
| 184 | 3300042439 | Ga0439464_0184906 | Ga0439464_0184906_13_609 | 198 |
| 185 | 3300046678 | Ga0495599_0046159 | Ga0495599_0046159_887_1495 | 198 |
| 186 | 3300050507 | nmdc:mga05p37_510_c1 | nmdc:mga05p37_510_c1_17455_18051 | 198 |
| 187 | 3300050507 | nmdc:mga05p37_931_c1 | nmdc:mga05p37_931_c1_10562_11161 | 198 |
| 188 | 3300050508 | nmdc:mga09592_49676_c1 | nmdc:mga09592_49676_c1_813_1409 | 198 |
| 189 | 3300050508 | nmdc:mga09592_75_c1 | nmdc:mga09592_75_c1_40610_41209 | 198 |
| 190 | 3300050509 | nmdc:mga0qj67_368_c1 | nmdc:mga0qj67_368_c1_6797_7393 | 198 |
| 191 | 3300050510 | nmdc:mga06r32_15504_c1 | nmdc:mga06r32_15504_c1_3698_4297 | 198 |
| 192 | 3300050510 | nmdc:mga06r32_1675_c1 | nmdc:mga06r32_1675_c1_17604_18200 | 198 |
| 193 | 3300050510 | nmdc:mga06r32_564910_c1 | nmdc:mga06r32_564910_c1_99_701 | 198 |
| 194 | 3300005327 | Ga0070658_10804171 | Ga0070658_108041712 | 199 |
| 195 | 3300005340 | Ga0070689_101190369 | Ga0070689_1011903691 | 199 |
| 196 | 3300005344 | Ga0070661_100052696 | Ga0070661_1000526964 | 199 |
| 197 | 3300005435 | Ga0070714_100561293 | Ga0070714_1005612931 | 199 |
| 198 | 3300005440 | Ga0070705_100056657 | Ga0070705_1000566572 | 199 |
| 199 | 3300005445 | Ga0070708_100046870 | Ga0070708_1000468702 | 199 |
| 200 | 3300005445 | Ga0070708_100687731 | Ga0070708_1006877312 | 199 |
| 201 | 3300005457 | Ga0070662_100563012 | Ga0070662_1005630121 | 199 |
| 202 | 3300005458 | Ga0070681_10025566 | Ga0070681_100255664 | 199 |
| 203 | 3300005468 | Ga0070707_100254889 | Ga0070707_1002548892 | 199 |
| 204 | 3300005518 | Ga0070699_100558360 | Ga0070699_1005583602 | 199 |
| 205 | 3300005530 | Ga0070679_100175238 | Ga0070679_1001752382 | 199 |
| 206 | 3300005549 | Ga0070704_100026341 | Ga0070704_1000263415 | 199 |
| 207 | 3300005563 | Ga0068855_100075269 | Ga0068855_1000752694 | 199 |
| 208 | 3300005564 | Ga0070664_100017520 | Ga0070664_1000175206 | 199 |
| 209 | 3300005577 | Ga0068857_100154375 | Ga0068857_1001543753 | 199 |
| 210 | 3300005614 | Ga0068856_100011081 | Ga0068856_1000110813 | 199 |
| 211 | 3300005841 | Ga0068863_100523878 | Ga0068863_1005238782 | 199 |
| 212 | 3300006844 | Ga0075428_100034331 | Ga0075428_1000343314 | 199 |
| 213 | 3300006847 | Ga0075431_100006196 | Ga0075431_1000061965 | 199 |
| 214 | 3300006847 | Ga0075431_100105217 | Ga0075431_1001052172 | 199 |
| 215 | 3300006880 | Ga0075429_100019307 | Ga0075429_1000193075 | 199 |
| 216 | 3300009094 | Ga0111539_11030207 | Ga0111539_110302071 | 199 |
| 217 | 3300009147 | Ga0114129_10003702 | Ga0114129_100037025 | 199 |
| 218 | 3300013100 | Ga0157373_10156416 | Ga0157373_101564161 | 199 |
| 219 | 3300013105 | Ga0157369_10035338 | Ga0157369_100353388 | 199 |
| 220 | 3300013307 | Ga0157372_10249913 | Ga0157372_102499133 | 199 |
| 221 | 3300014968 | Ga0157379_10260300 | Ga0157379_102603002 | 199 |
| 222 | 3300025900 | Ga0207710_10035686 | Ga0207710_100356862 | 199 |
| 223 | 3300025909 | Ga0207705_10960190 | Ga0207705_109601901 | 199 |
| 224 | 3300025910 | Ga0207684_11099752 | Ga0207684_110997521 | 199 |
| 225 | 3300025912 | Ga0207707_10145849 | Ga0207707_101458493 | 199 |
| 226 | 3300025920 | Ga0207649_10084164 | Ga0207649_100841643 | 199 |
| 227 | 3300025921 | Ga0207652_10028509 | Ga0207652_100285097 | 199 |
| 228 | 3300025922 | Ga0207646_10079823 | Ga0207646_100798232 | 199 |
| 229 | 3300025929 | Ga0207664_10589841 | Ga0207664_105898412 | 199 |
| 230 | 3300025941 | Ga0207711_10024925 | Ga0207711_100249252 | 199 |
| 231 | 3300025945 | Ga0207679_10110804 | Ga0207679_101108042 | 199 |
| 232 | 3300025949 | Ga0207667_10073768 | Ga0207667_100737684 | 199 |
| 233 | 3300026078 | Ga0207702_10153301 | Ga0207702_101533012 | 199 |
| 234 | 3300026116 | Ga0207674_10321593 | Ga0207674_103215931 | 199 |
| 235 | 3300046455 | Ga0495603_0159038 | Ga0495603_0159038_633_1247 | 199 |
| 236 | 3300046535 | Ga0495586_0130446 | Ga0495586_0130446_656_1270 | 199 |
| 237 | 3300046683 | Ga0495658_0012026 | Ga0495658_0012026_2791_3405 | 199 |
| 238 | 3300049593 | Ga0501077_0094343 | Ga0501077_0094343_870_1469 | 199 |
| 239 | 3300050507 | nmdc:mga05p37_29333_c1 | nmdc:mga05p37_29333_c1_917_1522 | 199 |
| 240 | 3300050508 | nmdc:mga09592_1086_c1 | nmdc:mga09592_1086_c1_5087_5692 | 199 |
| 241 | 3300050510 | nmdc:mga06r32_136009_c1 | nmdc:mga06r32_136009_c1_1060_1659 | 199 |
| 242 | 3300050510 | nmdc:mga06r32_148618_c1 | nmdc:mga06r32_148618_c1_986_1591 | 199 |
| 243 | 3300005293 | Ga0065715_10003987 | Ga0065715_100039876 | 200 |
| 244 | 3300005295 | Ga0065707_10102385 | Ga0065707_101023851 | 200 |
| 245 | 3300005330 | Ga0070690_100087630 | Ga0070690_1000876302 | 200 |
| 246 | 3300005330 | Ga0070690_100130640 | Ga0070690_1001306403 | 200 |
| 247 | 3300005331 | Ga0070670_100116738 | Ga0070670_1001167382 | 200 |
| 248 | 3300005333 | Ga0070677_10353802 | Ga0070677_103538021 | 200 |
| 249 | 3300005334 | Ga0068869_100005372 | Ga0068869_1000053725 | 200 |
| 250 | 3300005334 | Ga0068869_100744620 | Ga0068869_1007446201 | 200 |
| 251 | 3300005335 | Ga0070666_10005295 | Ga0070666_100052953 | 200 |
| 252 | 3300005335 | Ga0070666_10265066 | Ga0070666_102650661 | 200 |
| 253 | 3300005338 | Ga0068868_100005931 | Ga0068868_1000059315 | 200 |
| 254 | 3300005340 | Ga0070689_100804621 | Ga0070689_1008046211 | 200 |
| 255 | 3300005343 | Ga0070687_100073931 | Ga0070687_1000739312 | 200 |
| 256 | 3300005347 | Ga0070668_100000332 | Ga0070668_10000033219 | 200 |
| 257 | 3300005353 | Ga0070669_100000950 | Ga0070669_10000095016 | 200 |
| 258 | 3300005354 | Ga0070675_100003748 | Ga0070675_1000037482 | 200 |
| 259 | 3300005354 | Ga0070675_100021734 | Ga0070675_1000217344 | 200 |
| 260 | 3300005355 | Ga0070671_100367410 | Ga0070671_1003674101 | 200 |
| 261 | 3300005356 | Ga0070674_100002766 | Ga0070674_1000027665 | 200 |
| 262 | 3300005364 | Ga0070673_100006099 | Ga0070673_1000060997 | 200 |
| 263 | 3300005364 | Ga0070673_100126353 | Ga0070673_1001263532 | 200 |
| 264 | 3300005366 | Ga0070659_100254311 | Ga0070659_1002543113 | 200 |
| 265 | 3300005367 | Ga0070667_100004997 | Ga0070667_10000499711 | 200 |
| 266 | 3300005367 | Ga0070667_100845792 | Ga0070667_1008457921 | 200 |
| 267 | 3300005438 | Ga0070701_10016655 | Ga0070701_100166553 | 200 |
| 268 | 3300005440 | Ga0070705_100509810 | Ga0070705_1005098102 | 200 |
| 269 | 3300005441 | Ga0070700_100004257 | Ga0070700_1000042575 | 200 |
| 270 | 3300005444 | Ga0070694_100038005 | Ga0070694_1000380056 | 200 |
| 271 | 3300005457 | Ga0070662_100001231 | Ga0070662_1000012317 | 200 |
| 272 | 3300005457 | Ga0070662_100070608 | Ga0070662_1000706083 | 200 |
| 273 | 3300005458 | Ga0070681_10098815 | Ga0070681_100988152 | 200 |
| 274 | 3300005459 | Ga0068867_100005647 | Ga0068867_1000056475 | 200 |
| 275 | 3300005459 | Ga0068867_100094045 | Ga0068867_1000940451 | 200 |
| 276 | 3300005459 | Ga0068867_100170513 | Ga0068867_1001705132 | 200 |
| 277 | 3300005459 | Ga0068867_100434576 | Ga0068867_1004345762 | 200 |
| 278 | 3300005459 | Ga0068867_100593770 | Ga0068867_1005937702 | 200 |
| 279 | 3300005471 | Ga0070698_100005029 | Ga0070698_10000502917 | 200 |
| 280 | 3300005471 | Ga0070698_100849800 | Ga0070698_1008498002 | 200 |
| 281 | 3300005530 | Ga0070679_100751922 | Ga0070679_1007519221 | 200 |
| 282 | 3300005539 | Ga0068853_100409884 | Ga0068853_1004098842 | 200 |
| 283 | 3300005539 | Ga0068853_100766476 | Ga0068853_1007664762 | 200 |
| 284 | 3300005543 | Ga0070672_100001876 | Ga0070672_10000187613 | 200 |
| 285 | 3300005543 | Ga0070672_100014880 | Ga0070672_1000148805 | 200 |
| 286 | 3300005543 | Ga0070672_100038870 | Ga0070672_1000388704 | 200 |
| 287 | 3300005543 | Ga0070672_100051107 | Ga0070672_1000511072 | 200 |
| 288 | 3300005543 | Ga0070672_100078980 | Ga0070672_1000789803 | 200 |
| 289 | 3300005543 | Ga0070672_100205319 | Ga0070672_1002053192 | 200 |
| 290 | 3300005543 | Ga0070672_100206118 | Ga0070672_1002061182 | 200 |
| 291 | 3300005545 | Ga0070695_100033929 | Ga0070695_1000339294 | 200 |
| 292 | 3300005545 | Ga0070695_100164841 | Ga0070695_1001648414 | 200 |
| 293 | 3300005546 | Ga0070696_100254971 | Ga0070696_1002549712 | 200 |
| 294 | 3300005546 | Ga0070696_100406806 | Ga0070696_1004068062 | 200 |
| 295 | 3300005547 | Ga0070693_100369884 | Ga0070693_1003698842 | 200 |
| 296 | 3300005548 | Ga0070665_101325077 | Ga0070665_1013250771 | 200 |
| 297 | 3300005549 | Ga0070704_100000613 | Ga0070704_10000061310 | 200 |
| 298 | 3300005563 | Ga0068855_100104224 | Ga0068855_1001042243 | 200 |
| 299 | 3300005564 | Ga0070664_100340199 | Ga0070664_1003401991 | 200 |
| 300 | 3300005564 | Ga0070664_100757459 | Ga0070664_1007574592 | 200 |
| 301 | 3300005577 | Ga0068857_100045138 | Ga0068857_1000451386 | 200 |
| 302 | 3300005577 | Ga0068857_100065261 | Ga0068857_1000652613 | 200 |
| 303 | 3300005578 | Ga0068854_100314158 | Ga0068854_1003141581 | 200 |
| 304 | 3300005616 | Ga0068852_100031495 | Ga0068852_1000314953 | 200 |
| 305 | 3300005616 | Ga0068852_100200383 | Ga0068852_1002003832 | 200 |
| 306 | 3300005617 | Ga0068859_100026644 | Ga0068859_1000266442 | 200 |
| 307 | 3300005617 | Ga0068859_101337531 | Ga0068859_1013375311 | 200 |
| 308 | 3300005618 | Ga0068864_100001428 | Ga0068864_1000014282 | 200 |
| 309 | 3300005718 | Ga0068866_10001483 | Ga0068866_1000148312 | 200 |
| 310 | 3300005719 | Ga0068861_100000426 | Ga0068861_10000042610 | 200 |
| 311 | 3300005719 | Ga0068861_100317967 | Ga0068861_1003179672 | 200 |
| 312 | 3300005834 | Ga0068851_10063663 | Ga0068851_100636632 | 200 |
| 313 | 3300005834 | Ga0068851_10282498 | Ga0068851_102824982 | 200 |
| 314 | 3300005840 | Ga0068870_10173438 | Ga0068870_101734382 | 200 |
| 315 | 3300005841 | Ga0068863_100001953 | Ga0068863_1000019537 | 200 |
| 316 | 3300005841 | Ga0068863_100162558 | Ga0068863_1001625583 | 200 |
| 317 | 3300005841 | Ga0068863_100359631 | Ga0068863_1003596311 | 200 |
| 318 | 3300005842 | Ga0068858_100001000 | Ga0068858_10000100013 | 200 |
| 319 | 3300005842 | Ga0068858_100789672 | Ga0068858_1007896722 | 200 |
| 320 | 3300005843 | Ga0068860_100001048 | Ga0068860_10000104825 | 200 |
| 321 | 3300005843 | Ga0068860_100074490 | Ga0068860_1000744903 | 200 |
| 322 | 3300005843 | Ga0068860_100217624 | Ga0068860_1002176242 | 200 |
| 323 | 3300005844 | Ga0068862_100005035 | Ga0068862_1000050356 | 200 |
| 324 | 3300005844 | Ga0068862_100482282 | Ga0068862_1004822822 | 200 |
| 325 | 3300006058 | Ga0075432_10037521 | Ga0075432_100375211 | 200 |
| 326 | 3300006195 | Ga0075366_10225245 | Ga0075366_102252452 | 200 |
| 327 | 3300006237 | Ga0097621_100026552 | Ga0097621_1000265522 | 200 |
| 328 | 3300006358 | Ga0068871_100604616 | Ga0068871_1006046162 | 200 |
| 329 | 3300006844 | Ga0075428_100025930 | Ga0075428_1000259303 | 200 |
| 330 | 3300006852 | Ga0075433_10530058 | Ga0075433_105300582 | 200 |
| 331 | 3300006881 | Ga0068865_100002225 | Ga0068865_10000222512 | 200 |
| 332 | 3300006881 | Ga0068865_100313460 | Ga0068865_1003134602 | 200 |
| 333 | 3300006931 | Ga0097620_100026645 | Ga0097620_1000266456 | 200 |
| 334 | 3300006931 | Ga0097620_101337223 | Ga0097620_1013372231 | 200 |
| 335 | 3300007265 | Ga0099794_10002719 | Ga0099794_100027192 | 200 |
| 336 | 3300009094 | Ga0111539_10000275 | Ga0111539_1000027520 | 200 |
| 337 | 3300009094 | Ga0111539_10366001 | Ga0111539_103660012 | 200 |
| 338 | 3300009147 | Ga0114129_10264738 | Ga0114129_102647381 | 200 |
| 339 | 3300009147 | Ga0114129_10795816 | Ga0114129_107958162 | 200 |
| 340 | 3300009148 | Ga0105243_10179075 | Ga0105243_101790752 | 200 |
| 341 | 3300009148 | Ga0105243_10606175 | Ga0105243_106061752 | 200 |
| 342 | 3300009545 | Ga0105237_10076521 | Ga0105237_100765212 | 200 |
| 343 | 3300010375 | Ga0105239_10076828 | Ga0105239_100768283 | 200 |
| 344 | 3300013296 | Ga0157374_10132805 | Ga0157374_101328052 | 200 |
| 345 | 3300013297 | Ga0157378_10231683 | Ga0157378_102316832 | 200 |
| 346 | 3300013306 | Ga0163162_10063807 | Ga0163162_100638072 | 200 |
| 347 | 3300013306 | Ga0163162_10583511 | Ga0163162_105835112 | 200 |
| 348 | 3300013306 | Ga0163162_11196484 | Ga0163162_111964842 | 200 |
| 349 | 3300013308 | Ga0157375_10002055 | Ga0157375_1000205510 | 200 |
| 350 | 3300013308 | Ga0157375_10002541 | Ga0157375_1000254110 | 200 |
| 351 | 3300013308 | Ga0157375_10016354 | Ga0157375_100163545 | 200 |
| 352 | 3300013308 | Ga0157375_10150354 | Ga0157375_101503542 | 200 |
| 353 | 3300014325 | Ga0163163_10028522 | Ga0163163_100285223 | 200 |
| 354 | 3300014326 | Ga0157380_10001799 | Ga0157380_1000179911 | 200 |
| 355 | 3300014326 | Ga0157380_10324419 | Ga0157380_103244192 | 200 |
| 356 | 3300014745 | Ga0157377_10333822 | Ga0157377_103338222 | 200 |
| 357 | 3300014968 | Ga0157379_10003578 | Ga0157379_1000357812 | 200 |
| 358 | 3300014968 | Ga0157379_10051980 | Ga0157379_100519801 | 200 |
| 359 | 3300014969 | Ga0157376_10011472 | Ga0157376_100114722 | 200 |
| 360 | 3300014969 | Ga0157376_10414817 | Ga0157376_104148172 | 200 |
| 361 | 3300017792 | Ga0163161_10020557 | Ga0163161_100205575 | 200 |
| 362 | 3300025315 | Ga0207697_10032724 | Ga0207697_100327243 | 200 |
| 363 | 3300025321 | Ga0207656_10157806 | Ga0207656_101578062 | 200 |
| 364 | 3300025893 | Ga0207682_10030239 | Ga0207682_100302393 | 200 |
| 365 | 3300025893 | Ga0207682_10057582 | Ga0207682_100575822 | 200 |
| 366 | 3300025899 | Ga0207642_10001183 | Ga0207642_100011839 | 200 |
| 367 | 3300025903 | Ga0207680_10002952 | Ga0207680_100029523 | 200 |
| 368 | 3300025903 | Ga0207680_10097218 | Ga0207680_100972182 | 200 |
| 369 | 3300025907 | Ga0207645_10002094 | Ga0207645_100020949 | 200 |
| 370 | 3300025907 | Ga0207645_10074227 | Ga0207645_100742273 | 200 |
| 371 | 3300025912 | Ga0207707_10044769 | Ga0207707_100447692 | 200 |
| 372 | 3300025918 | Ga0207662_10011160 | Ga0207662_100111602 | 200 |
| 373 | 3300025918 | Ga0207662_10132734 | Ga0207662_101327342 | 200 |
| 374 | 3300025919 | Ga0207657_10384418 | Ga0207657_103844182 | 200 |
| 375 | 3300025921 | Ga0207652_10300546 | Ga0207652_103005462 | 200 |
| 376 | 3300025923 | Ga0207681_10000308 | Ga0207681_1000030814 | 200 |
| 377 | 3300025923 | Ga0207681_10140066 | Ga0207681_101400662 | 200 |
| 378 | 3300025923 | Ga0207681_10147949 | Ga0207681_101479493 | 200 |
| 379 | 3300025923 | Ga0207681_10352707 | Ga0207681_103527072 | 200 |
| 380 | 3300025924 | Ga0207694_10179720 | Ga0207694_101797202 | 200 |
| 381 | 3300025925 | Ga0207650_10001008 | Ga0207650_1000100812 | 200 |
| 382 | 3300025925 | Ga0207650_10002178 | Ga0207650_100021782 | 200 |
| 383 | 3300025926 | Ga0207659_10012776 | Ga0207659_100127762 | 200 |
| 384 | 3300025927 | Ga0207687_10255921 | Ga0207687_102559212 | 200 |
| 385 | 3300025931 | Ga0207644_10053943 | Ga0207644_100539433 | 200 |
| 386 | 3300025931 | Ga0207644_10173294 | Ga0207644_101732942 | 200 |
| 387 | 3300025931 | Ga0207644_10241897 | Ga0207644_102418972 | 200 |
| 388 | 3300025932 | Ga0207690_10351389 | Ga0207690_103513892 | 200 |
| 389 | 3300025933 | Ga0207706_10004526 | Ga0207706_1000452612 | 200 |
| 390 | 3300025933 | Ga0207706_10008475 | Ga0207706_100084755 | 200 |
| 391 | 3300025933 | Ga0207706_10224056 | Ga0207706_102240562 | 200 |
| 392 | 3300025933 | Ga0207706_10279851 | Ga0207706_102798512 | 200 |
| 393 | 3300025934 | Ga0207686_10111659 | Ga0207686_101116592 | 200 |
| 394 | 3300025935 | Ga0207709_10004196 | Ga0207709_100041967 | 200 |
| 395 | 3300025937 | Ga0207669_10000725 | Ga0207669_100007259 | 200 |
| 396 | 3300025938 | Ga0207704_10001008 | Ga0207704_100010087 | 200 |
| 397 | 3300025938 | Ga0207704_10148057 | Ga0207704_101480572 | 200 |
| 398 | 3300025938 | Ga0207704_10227583 | Ga0207704_102275832 | 200 |
| 399 | 3300025938 | Ga0207704_10860757 | Ga0207704_108607572 | 200 |
| 400 | 3300025939 | Ga0207665_10017636 | Ga0207665_100176366 | 200 |
| 401 | 3300025940 | Ga0207691_10002582 | Ga0207691_1000258210 | 200 |
| 402 | 3300025940 | Ga0207691_10075309 | Ga0207691_100753093 | 200 |
| 403 | 3300025940 | Ga0207691_10085414 | Ga0207691_100854142 | 200 |
| 404 | 3300025940 | Ga0207691_10119482 | Ga0207691_101194822 | 200 |
| 405 | 3300025940 | Ga0207691_10211435 | Ga0207691_102114352 | 200 |
| 406 | 3300025942 | Ga0207689_10002808 | Ga0207689_1000280814 | 200 |
| 407 | 3300025945 | Ga0207679_10305939 | Ga0207679_103059391 | 200 |
| 408 | 3300025949 | Ga0207667_10115988 | Ga0207667_101159883 | 200 |
| 409 | 3300025960 | Ga0207651_10147543 | Ga0207651_101475432 | 200 |
| 410 | 3300025960 | Ga0207651_10291583 | Ga0207651_102915832 | 200 |
| 411 | 3300025961 | Ga0207712_10012095 | Ga0207712_100120955 | 200 |
| 412 | 3300025972 | Ga0207668_10071966 | Ga0207668_100719662 | 200 |
| 413 | 3300025981 | Ga0207640_10060522 | Ga0207640_100605222 | 200 |
| 414 | 3300025986 | Ga0207658_10001166 | Ga0207658_1000116611 | 200 |
| 415 | 3300025986 | Ga0207658_10111477 | Ga0207658_101114772 | 200 |
| 416 | 3300025986 | Ga0207658_10364220 | Ga0207658_103642202 | 200 |
| 417 | 3300026023 | Ga0207677_11049029 | Ga0207677_110490291 | 200 |
| 418 | 3300026035 | Ga0207703_10000414 | Ga0207703_1000041423 | 200 |
| 419 | 3300026088 | Ga0207641_10000615 | Ga0207641_1000061535 | 200 |
| 420 | 3300026088 | Ga0207641_10333183 | Ga0207641_103331832 | 200 |
| 421 | 3300026089 | Ga0207648_10001283 | Ga0207648_1000128322 | 200 |
| 422 | 3300026089 | Ga0207648_10048979 | Ga0207648_100489793 | 200 |
| 423 | 3300026089 | Ga0207648_10241859 | Ga0207648_102418592 | 200 |
| 424 | 3300026089 | Ga0207648_10421466 | Ga0207648_104214662 | 200 |
| 425 | 3300026089 | Ga0207648_10780704 | Ga0207648_107807041 | 200 |
| 426 | 3300026095 | Ga0207676_10016903 | Ga0207676_100169035 | 200 |
| 427 | 3300026095 | Ga0207676_10025075 | Ga0207676_100250751 | 200 |
| 428 | 3300026116 | Ga0207674_10182374 | Ga0207674_101823741 | 200 |
| 429 | 3300026116 | Ga0207674_10719175 | Ga0207674_107191751 | 200 |
| 430 | 3300026118 | Ga0207675_100002985 | Ga0207675_10000298511 | 200 |
| 431 | 3300026118 | Ga0207675_100078237 | Ga0207675_1000782373 | 200 |
| 432 | 3300026118 | Ga0207675_100138013 | Ga0207675_1001380132 | 200 |
| 433 | 3300026121 | Ga0207683_10169405 | Ga0207683_101694051 | 200 |
| 434 | 3300026142 | Ga0207698_10004887 | Ga0207698_100048878 | 200 |
| 435 | 3300026142 | Ga0207698_10022022 | Ga0207698_100220224 | 200 |
| 436 | 3300026142 | Ga0207698_10080048 | Ga0207698_100800482 | 200 |
| 437 | 3300027462 | Ga0210000_1001718 | Ga0210000_10017182 | 200 |
| 438 | 3300027543 | Ga0209999_1000757 | Ga0209999_10007575 | 200 |
| 439 | 3300027671 | Ga0209588_1021796 | Ga0209588_10217962 | 200 |
| 440 | 3300027907 | Ga0207428_10004772 | Ga0207428_100047727 | 200 |
| 441 | 3300028380 | Ga0268265_10002595 | Ga0268265_100025956 | 200 |
| 442 | 3300028380 | Ga0268265_10301381 | Ga0268265_103013811 | 200 |
| 443 | 3300028381 | Ga0268264_10000780 | Ga0268264_1000078016 | 200 |
| 444 | 3300028381 | Ga0268264_10062845 | Ga0268264_100628454 | 200 |
| 445 | 3300028381 | Ga0268264_10102221 | Ga0268264_101022213 | 200 |
| 446 | 3300031548 | Ga0307408_100040891 | Ga0307408_1000408913 | 200 |
| 447 | 3300031731 | Ga0307405_10090200 | Ga0307405_100902001 | 200 |
| 448 | 3300031903 | Ga0307407_10093160 | Ga0307407_100931602 | 200 |
| 449 | 3300031911 | Ga0307412_10439178 | Ga0307412_104391782 | 200 |
| 450 | 3300031995 | Ga0307409_100103265 | Ga0307409_1001032651 | 200 |
| 451 | 3300032002 | Ga0307416_100001193 | Ga0307416_10000119311 | 200 |
| 452 | 3300032002 | Ga0307416_100171118 | Ga0307416_1001711183 | 200 |
| 453 | 3300032005 | Ga0307411_10011045 | Ga0307411_100110453 | 200 |
| 454 | 3300032126 | Ga0307415_100001120 | Ga0307415_1000011204 | 200 |
| 455 | 3300035090 | Ga0373949_0044485 | Ga0373949_0044485_82_684 | 200 |
| 456 | 3300035115 | Ga0373941_0160003 | Ga0373941_0160003_193_798 | 200 |
| 457 | 3300035172 | Ga0373955_0021268 | Ga0373955_0021268_1696_2331 | 200 |
| 458 | 3300035172 | Ga0373955_0127423 | Ga0373955_0127423_275_961 | 200 |
| 459 | 3300035207 | Ga0373942_0030852 | Ga0373942_0030852_469_1071 | 200 |
| 460 | 3300035410 | Ga0373924_0024407 | Ga0373924_0024407_60_746 | 200 |
| 461 | 3300035691 | Ga0373931_0001530 | Ga0373931_0001530_8946_9548 | 200 |
| 462 | 3300035692 | Ga0373935_0150814 | Ga0373935_0150814_453_1139 | 200 |
| 463 | 3300035695 | Ga0373927_0095432 | Ga0373927_0095432_916_1602 | 200 |
| 464 | 3300035725 | Ga0373947_0064888 | Ga0373947_0064888_1108_1743 | 200 |
| 465 | 3300036401 | Ga0373937_0038192 | Ga0373937_0038192_3246_3881 | 200 |
| 466 | 3300036401 | Ga0373937_0097813 | Ga0373937_0097813_1483_2169 | 200 |
| 467 | 3300036401 | Ga0373937_0413168 | Ga0373937_0413168_21_650 | 200 |
| 468 | 3300041512 | Ga0451853_1783048 | Ga0451853_1783048_1210_1845 | 200 |
| 469 | 3300045051 | Ga0451576_0258777 | Ga0451576_0258777_645_1250 | 200 |
| 470 | 3300046459 | Ga0495629_0159074 | Ga0495629_0159074_324_959 | 200 |
| 471 | 3300046461 | Ga0495641_0126388 | Ga0495641_0126388_281_916 | 200 |
| 472 | 3300046462 | Ga0495651_0399200 | Ga0495651_0399200_201_836 | 200 |
| 473 | 3300046472 | Ga0495580_0156721 | Ga0495580_0156721_926_1561 | 200 |
| 474 | 3300046472 | Ga0495580_0315555 | Ga0495580_0315555_284_889 | 200 |
| 475 | 3300046492 | Ga0495585_0372991 | Ga0495585_0372991_35_637 | 200 |
| 476 | 3300046516 | Ga0495628_0153973 | Ga0495628_0153973_202_888 | 200 |
| 477 | 3300046525 | Ga0495663_0063229 | Ga0495663_0063229_462_1064 | 200 |
| 478 | 3300046535 | Ga0495586_0127151 | Ga0495586_0127151_70_756 | 200 |
| 479 | 3300046543 | Ga0495645_0032857 | Ga0495645_0032857_34_669 | 200 |
| 480 | 3300046615 | Ga0495656_0056435 | Ga0495656_0056435_761_1363 | 200 |
| 481 | 3300046663 | Ga0495635_0057299 | Ga0495635_0057299_183_818 | 200 |
| 482 | 3300046675 | Ga0495657_0445751 | Ga0495657_0445751_64_699 | 200 |
| 483 | 3300046683 | Ga0495658_0017020 | Ga0495658_0017020_1347_2033 | 200 |
| 484 | 3300047319 | Ga0495674_0134010 | Ga0495674_0134010_391_1026 | 200 |
| 485 | 3300047322 | Ga0495680_0053172 | Ga0495680_0053172_2157_2792 | 200 |
| 486 | 3300047471 | Ga0495684_0026078 | Ga0495684_0026078_3578_4264 | 200 |
| 487 | 3300048905 | Ga0496102_0008252 | Ga0496102_0008252_3712_4314 | 200 |
| 488 | 3300048906 | Ga0496103_0092684 | Ga0496103_0092684_376_978 | 200 |
| 489 | 3300048909 | Ga0496106_0283417 | Ga0496106_0283417_211_813 | 200 |
| 490 | 3300049568 | Ga0501031_0048841 | Ga0501031_0048841_771_1511 | 200 |
| 491 | 3300049569 | Ga0501032_0065492 | Ga0501032_0065492_206_946 | 200 |
| 492 | 3300049570 | Ga0501033_0004048 | Ga0501033_0004048_10734_11474 | 200 |
| 493 | 3300049571 | Ga0501034_0000406 | Ga0501034_0000406_1014_1619 | 200 |
| 494 | 3300049571 | Ga0501034_0002174 | Ga0501034_0002174_11957_12562 | 200 |
| 495 | 3300049572 | Ga0501036_0011077 | Ga0501036_0011077_5358_6098 | 200 |
| 496 | 3300049573 | Ga0501037_0023042 | Ga0501037_0023042_1152_1892 | 200 |
| 497 | 3300049574 | Ga0501038_0000668 | Ga0501038_0000668_6191_6931 | 200 |
| 498 | 3300049575 | Ga0501039_0007014 | Ga0501039_0007014_4087_4827 | 200 |
| 499 | 3300049576 | Ga0501040_0002705 | Ga0501040_0002705_9481_10221 | 200 |
| 500 | 3300049576 | Ga0501040_0037480 | Ga0501040_0037480_1184_1786 | 200 |
| 501 | 3300049576 | Ga0501040_0225807 | Ga0501040_0225807_218_841 | 200 |
| 502 | 3300049577 | Ga0501041_0000098 | Ga0501041_0000098_32626_33366 | 200 |
| 503 | 3300049577 | Ga0501041_0081699 | Ga0501041_0081699_716_1318 | 200 |
| 504 | 3300049578 | Ga0501042_0000242 | Ga0501042_0000242_18434_19174 | 200 |
| 505 | 3300049578 | Ga0501042_0112725 | Ga0501042_0112725_99_701 | 200 |
| 506 | 3300049578 | Ga0501042_0178129 | Ga0501042_0178129_349_954 | 200 |
| 507 | 3300049579 | Ga0501043_0101839 | Ga0501043_0101839_1247_1987 | 200 |
| 508 | 3300049580 | Ga0501046_0000144 | Ga0501046_0000144_52193_52933 | 200 |
| 509 | 3300049581 | Ga0501047_0157730 | Ga0501047_0157730_1020_1760 | 200 |
| 510 | 3300049582 | Ga0501048_0008341 | Ga0501048_0008341_6944_7684 | 200 |
| 511 | 3300049583 | Ga0501067_0124185 | Ga0501067_0124185_751_1362 | 200 |
| 512 | 3300049584 | Ga0501068_0005592 | Ga0501068_0005592_2825_3436 | 200 |
| 513 | 3300049584 | Ga0501068_0018055 | Ga0501068_0018055_1124_1864 | 200 |
| 514 | 3300049586 | Ga0501070_0058828 | Ga0501070_0058828_1562_2173 | 200 |
| 515 | 3300049586 | Ga0501070_0074020 | Ga0501070_0074020_734_1474 | 200 |
| 516 | 3300049587 | Ga0501071_0006755 | Ga0501071_0006755_2968_3708 | 200 |
| 517 | 3300049588 | Ga0501072_0001347 | Ga0501072_0001347_7502_8107 | 200 |
| 518 | 3300049588 | Ga0501072_0054971 | Ga0501072_0054971_352_957 | 200 |
| 519 | 3300049589 | Ga0501073_0032995 | Ga0501073_0032995_2404_3015 | 200 |
| 520 | 3300049590 | Ga0501074_0063744 | Ga0501074_0063744_1124_1864 | 200 |
| 521 | 3300049590 | Ga0501074_0433471 | Ga0501074_0433471_63_674 | 200 |
| 522 | 3300049590 | Ga0501074_0512083 | Ga0501074_0512083_216_827 | 200 |
| 523 | 3300049591 | Ga0501075_0000101 | Ga0501075_0000101_2189_2929 | 200 |
| 524 | 3300049591 | Ga0501075_0017493 | Ga0501075_0017493_2367_2969 | 200 |
| 525 | 3300049591 | Ga0501075_0018641 | Ga0501075_0018641_1120_1725 | 200 |
| 526 | 3300049592 | Ga0501076_0035324 | Ga0501076_0035324_1593_2333 | 200 |
| 527 | 3300049592 | Ga0501076_0160853 | Ga0501076_0160853_537_1139 | 200 |
| 528 | 3300049592 | Ga0501076_0170270 | Ga0501076_0170270_198_803 | 200 |
| 529 | 3300049592 | Ga0501076_0174084 | Ga0501076_0174084_562_1167 | 200 |
| 530 | 3300049593 | Ga0501077_0000994 | Ga0501077_0000994_658_1398 | 200 |
| 531 | 3300049593 | Ga0501077_0020557 | Ga0501077_0020557_441_1043 | 200 |
| 532 | 3300049741 | Ga0501079_0000459 | Ga0501079_0000459_466_1206 | 200 |
| 533 | 3300049741 | Ga0501079_0011265 | Ga0501079_0011265_4209_4811 | 200 |
| 534 | 3300049742 | Ga0501080_0042174 | Ga0501080_0042174_3465_4076 | 200 |
| 535 | 3300049742 | Ga0501080_0044844 | Ga0501080_0044844_2703_3443 | 200 |
| 536 | 3300049742 | Ga0501080_0086996 | Ga0501080_0086996_2019_2621 | 200 |
| 537 | 3300049743 | Ga0501081_0000680 | Ga0501081_0000680_4967_5707 | 200 |
| 538 | 3300049743 | Ga0501081_0002406 | Ga0501081_0002406_3925_4527 | 200 |
| 539 | 3300049744 | Ga0501083_0197124 | Ga0501083_0197124_621_1226 | 200 |
| 540 | 3300049822 | Ga0501035_0080030 | Ga0501035_0080030_1690_2430 | 200 |
| 541 | 3300049824 | Ga0501045_0002526 | Ga0501045_0002526_10767_11507 | 200 |
| 542 | 3300049824 | Ga0501045_0092703 | Ga0501045_0092703_317_922 | 200 |
| 543 | 3300050511 | nmdc:mga08y16_124755_c1 | nmdc:mga08y16_124755_c1_1765_2367 | 200 |
| 544 | 3300050511 | nmdc:mga08y16_183697_c1 | nmdc:mga08y16_183697_c1_743_1381 | 200 |
| 545 | 3300050514 | nmdc:mga08x19_22243_c1 | nmdc:mga08x19_22243_c1_979_1626 | 200 |
| 546 | 3300050515 | nmdc:mga0a205_538952_c1 | nmdc:mga0a205_538952_c1_246_851 | 200 |
| 547 | 3300053077 | Ga0495601_0042566 | Ga0495601_0042566_1511_2197 | 200 |
| 548 | 3300053077 | Ga0495601_0141193 | Ga0495601_0141193_406_1041 | 200 |
| 549 | 3300053078 | Ga0495612_0027102 | Ga0495612_0027102_393_1079 | 200 |
| 550 | 3300053084 | Ga0495595_0071075 | Ga0495595_0071075_22_657 | 200 |
| 551 | 3300053085 | Ga0495619_0075349 | Ga0495619_0075349_1480_2166 | 200 |
| 552 | 3300054114 | Ga0501084_0053651 | Ga0501084_0053651_593_1333 | 200 |
| 553 | 3300060353 | Ga0501082_0024634 | Ga0501082_0024634_620_1360 | 200 |
| 554 | 3300060353 | Ga0501082_0389290 | Ga0501082_0389290_544_1146 | 200 |
| 555 | 3300061734 | Ga0530510_0000221 | Ga0530510_0000221_18704_19444 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7eg5-assembly1.cif.gz_B | fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 | 0.8295 | 37 | 152 |
| 1flm-assembly1.cif.gz_B | dimer of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8191 | 49 | 152 |
| 3amf-assembly1.cif.gz_B | e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8183 | 36 | 152 |
| 3awh-assembly1.cif.gz_B | e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8176 | 36 | 152 |
| 2e83-assembly1.cif.gz_B | t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) | 0.8163 | 36 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wliA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8143 | 42 | 152 | 2.30.110.10 |
| af_Q57730_15_149_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7928 | 36 | 150 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7826 | 36 | 152 | 2.30.110.10 |
| 2htdA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.779 | 33 | 149 | 2.30.110.10 |
| 5escD00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7657 | 36 | 152 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5H7Z0-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9815 | 3 | 199 |
|
| AF-A0A433B166-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.981 | 7 | 192 |
|
| AF-A0A538DHM8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.977 | 6 | 196 |
|
| AF-A0A7W1DYC8-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9769 | 6 | 196 |
|
| AF-A0A536U4P0-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9764 | 4 | 199 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar