F463151

General Info

Members Datasets Scaffolds Average Seq Length
555 266 555 206

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0048841|Ga0501031_0048841_771_1511
Length 246
Sequence MEQRIRFCTTPDGVRLAYATSGKGPPLVRASVARRHPAAKAVTFRAMKPAYHDGMRRLQDRFDSRALADXXXERLSRREFTAEDRAFIESRRLFFLASADAEGQPDCSYKGGDPGFVRVTAADELAFPSYDGNGMFRSLGNVLVNPAVALLFIDFEQPRRLRVNGRASIADDDPLLAAFTGAQVMVRVRAERIFPNCPRYIPRMSIAEVSQYVPRAGCTPPVPKWKTNEAFNEVLPRGDPAKTKKP

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 1.26
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10003987 3300005293 Bacteria 6653
2 Ga0065707_10102385 3300005295 Bacteria 2809
3 Ga0070658_10804171 3300005327 Bacteria 817
4 Ga0070690_100087630 3300005330 Bacteria 2045
5 Ga0070690_100130640 3300005330 Bacteria 1696
6 Ga0070670_100116738 3300005331 Bacteria 2301
7 Ga0070677_10353802 3300005333 Bacteria 762
8 Ga0068869_100005372 3300005334 Bacteria 8049
9 Ga0068869_100744620 3300005334 Bacteria 839
10 Ga0070666_10005295 3300005335 Bacteria 7904
11 Ga0070666_10265066 3300005335 Bacteria 1219
12 Ga0070680_100047216 3300005336 Bacteria 3505
13 Ga0070680_100156120 3300005336 Bacteria 1917
14 Ga0068868_100005931 3300005338 Bacteria 8619
15 Ga0068868_100027304 3300005338 Bacteria 4355
16 Ga0070689_100804621 3300005340 Bacteria 827
17 Ga0070689_101190369 3300005340 Bacteria 684
18 Ga0070687_100073931 3300005343 Bacteria 1839
19 Ga0070661_100052696 3300005344 Bacteria 2978
20 Ga0070692_10026184 3300005345 Bacteria 2880
21 Ga0070692_10046708 3300005345 Bacteria 2239
22 Ga0070668_100000332 3300005347 Bacteria 31100
23 Ga0070669_100000950 3300005353 Bacteria 21138
24 Ga0070669_100028821 3300005353 Bacteria 3999
25 Ga0070669_100476026 3300005353 Bacteria 1033
26 Ga0070675_100003748 3300005354 Bacteria 11546
27 Ga0070675_100021734 3300005354 Bacteria 5126
28 Ga0070671_100012508 3300005355 Bacteria 6835
29 Ga0070671_100015021 3300005355 Bacteria 6253
30 Ga0070671_100367410 3300005355 Unclassified 1229
31 Ga0070674_100002766 3300005356 Bacteria 9697
32 Ga0070674_100117056 3300005356 Unclassified 1967
33 Ga0070673_100006099 3300005364 Bacteria 7810
34 Ga0070673_100126353 3300005364 Bacteria 2140
35 Ga0070688_100147183 3300005365 Bacteria 1606
36 Ga0070659_100254311 3300005366 Bacteria 1456
37 Ga0070667_100004997 3300005367 Bacteria 11107
38 Ga0070667_100283900 3300005367 Unclassified 1487
39 Ga0070667_100845792 3300005367 Bacteria 851
40 Ga0070703_10002969 3300005406 Bacteria 4848
41 Ga0070709_10755978 3300005434 Bacteria 760
42 Ga0070714_100008968 3300005435 Bacteria 7831
43 Ga0070714_100561293 3300005435 Bacteria 1094
44 Ga0070701_10016655 3300005438 Bacteria 3422
45 Ga0070705_100056657 3300005440 Bacteria 2309
46 Ga0070705_100161743 3300005440 Bacteria 1497
47 Ga0070705_100254304 3300005440 Bacteria 1235
48 Ga0070705_100317857 3300005440 Bacteria 1123
49 Ga0070705_100509810 3300005440 Bacteria 915
50 Ga0070700_100004257 3300005441 Bacteria 7471
51 Ga0070700_100100323 3300005441 Bacteria 1906
52 Ga0070694_100038005 3300005444 Bacteria 3196
53 Ga0070694_100162342 3300005444 Bacteria 1640
54 Ga0070694_100516275 3300005444 Bacteria 953
55 Ga0070708_100046870 3300005445 Bacteria 3816
56 Ga0070708_100687731 3300005445 Bacteria 963
57 Ga0070663_100026998 3300005455 Bacteria 3894
58 Ga0070663_100217322 3300005455 Unclassified 1499
59 Ga0070678_100057728 3300005456 Bacteria 2845
60 Ga0070678_100102152 3300005456 Bacteria 2224
61 Ga0070678_100223481 3300005456 Bacteria 1566
62 Ga0070662_100001231 3300005457 Bacteria 15727
63 Ga0070662_100070608 3300005457 Bacteria 2573
64 Ga0070662_100563012 3300005457 Bacteria 956
65 Ga0070681_10025566 3300005458 Bacteria 5940
66 Ga0070681_10039177 3300005458 Bacteria 4751
67 Ga0070681_10098815 3300005458 Bacteria 2865
68 Ga0068867_100005647 3300005459 Bacteria 8867
69 Ga0068867_100094045 3300005459 Bacteria 2279
70 Ga0068867_100170513 3300005459 Bacteria 1723
71 Ga0068867_100434576 3300005459 Bacteria 1115
72 Ga0068867_100593770 3300005459 Bacteria 965
73 Ga0070685_10324796 3300005466 Bacteria 1044
74 Ga0070706_100543298 3300005467 Bacteria 1081
75 Ga0070707_100254889 3300005468 Bacteria 1707
76 Ga0070707_100453719 3300005468 Bacteria 1243
77 Ga0070698_100005029 3300005471 Bacteria 14484
78 Ga0070698_100365492 3300005471 Bacteria 1375
79 Ga0070698_100849800 3300005471 Bacteria 857
80 Ga0070699_100018485 3300005518 Bacteria 5986
81 Ga0070699_100558360 3300005518 Bacteria 1042
82 Ga0070679_100140166 3300005530 Bacteria 2398
83 Ga0070679_100175238 3300005530 Bacteria 2117
84 Ga0070679_100751922 3300005530 Bacteria 918
85 Ga0070697_100247936 3300005536 Bacteria 1522
86 Ga0068853_100038903 3300005539 Bacteria 4054
87 Ga0068853_100064855 3300005539 Bacteria 3168
88 Ga0068853_100409884 3300005539 Bacteria 1270
89 Ga0068853_100766476 3300005539 Bacteria 923
90 Ga0068853_100888899 3300005539 Unclassified 855
91 Ga0070672_100001876 3300005543 Bacteria 13148
92 Ga0070672_100014880 3300005543 Bacteria 5524
93 Ga0070672_100038870 3300005543 Bacteria 3640
94 Ga0070672_100051107 3300005543 Bacteria 3222
95 Ga0070672_100078033 3300005543 Bacteria 2649
96 Ga0070672_100078980 3300005543 Bacteria 2633
97 Ga0070672_100152168 3300005543 Bacteria 1914
98 Ga0070672_100205319 3300005543 Bacteria 1649
99 Ga0070672_100206118 3300005543 Bacteria 1645
100 Ga0070695_100002311 3300005545 Bacteria 10931
101 Ga0070695_100033929 3300005545 Bacteria 3195
102 Ga0070695_100164841 3300005545 Bacteria 1559
103 Ga0070695_101069200 3300005545 Bacteria 659
104 Ga0070696_100254971 3300005546 Bacteria 1328
105 Ga0070696_100406806 3300005546 Bacteria 1066
106 Ga0070693_100369884 3300005547 Bacteria 986
107 Ga0070693_100435490 3300005547 Bacteria 917
108 Ga0070665_100347379 3300005548 Bacteria 1488
109 Ga0070665_101325077 3300005548 Bacteria 730
110 Ga0070704_100000613 3300005549 Bacteria 17180
111 Ga0070704_100026341 3300005549 Bacteria 3840
112 Ga0070704_100167527 3300005549 Bacteria 1744
113 Ga0068855_100075269 3300005563 Bacteria 3921
114 Ga0068855_100104224 3300005563 Bacteria 3263
115 Ga0070664_100017520 3300005564 Bacteria 5885
116 Ga0070664_100340199 3300005564 Bacteria 1363
117 Ga0070664_100757459 3300005564 Bacteria 907
118 Ga0068857_100002520 3300005577 Bacteria 14995
119 Ga0068857_100045138 3300005577 Bacteria 3909
120 Ga0068857_100065261 3300005577 Bacteria 3236
121 Ga0068857_100088417 3300005577 Bacteria 2772
122 Ga0068857_100154375 3300005577 Bacteria 2081
123 Ga0068854_100314158 3300005578 Bacteria 1271
124 Ga0068856_100011081 3300005614 Bacteria 8756
125 Ga0068852_100031495 3300005616 Bacteria 4377
126 Ga0068852_100200383 3300005616 Bacteria 1889
127 Ga0068859_100026239 3300005617 Bacteria 5842
128 Ga0068859_100026644 3300005617 Bacteria 5797
129 Ga0068859_100033758 3300005617 Bacteria 5137
130 Ga0068859_100182735 3300005617 Bacteria 2180
131 Ga0068859_101337531 3300005617 Bacteria 790
132 Ga0068864_100001428 3300005618 Bacteria 19722
133 Ga0068864_100024342 3300005618 Bacteria 5093
134 Ga0068866_10001483 3300005718 Bacteria 9995
135 Ga0068861_100000426 3300005719 Bacteria 24509
136 Ga0068861_100317967 3300005719 Bacteria 1355
137 Ga0068851_10004147 3300005834 Bacteria 6523
138 Ga0068851_10063663 3300005834 Bacteria 1894
139 Ga0068851_10282498 3300005834 Bacteria 950
140 Ga0068870_10114659 3300005840 Bacteria 1544
141 Ga0068870_10173438 3300005840 Bacteria 1289
142 Ga0068863_100001953 3300005841 Bacteria 20472
143 Ga0068863_100162558 3300005841 Bacteria 2140
144 Ga0068863_100211152 3300005841 Bacteria 1869
145 Ga0068863_100359631 3300005841 Bacteria 1419
146 Ga0068863_100523878 3300005841 Bacteria 1169
147 Ga0068858_100001000 3300005842 Bacteria 29221
148 Ga0068858_100789672 3300005842 Unclassified 926
149 Ga0068860_100001048 3300005843 Bacteria 30480
150 Ga0068860_100062489 3300005843 Bacteria 3538
151 Ga0068860_100074490 3300005843 Bacteria 3228
152 Ga0068860_100153687 3300005843 Bacteria 2217
153 Ga0068860_100217624 3300005843 Bacteria 1854
154 Ga0068860_101716961 3300005843 Bacteria 650
155 Ga0068862_100005035 3300005844 Bacteria 11122
156 Ga0068862_100098828 3300005844 Bacteria 2550
157 Ga0068862_100105584 3300005844 Bacteria 2468
158 Ga0068862_100382222 3300005844 Bacteria 1313
159 Ga0068862_100482282 3300005844 Bacteria 1174
160 Ga0075432_10037521 3300006058 Bacteria 1687
161 Ga0075366_10027341 3300006195 Bacteria 3346
162 Ga0075366_10225245 3300006195 Bacteria 1142
163 Ga0097621_100026552 3300006237 Bacteria 4544
164 Ga0097621_100130435 3300006237 Bacteria 2139
165 Ga0068871_100352182 3300006358 Bacteria 1303
166 Ga0068871_100604616 3300006358 Bacteria 997
167 Ga0075428_100000828 3300006844 Bacteria 32366
168 Ga0075428_100018021 3300006844 Bacteria 7803
169 Ga0075428_100025930 3300006844 Bacteria 6491
170 Ga0075428_100034331 3300006844 Bacteria 5596
171 Ga0075430_100000127 3300006846 Bacteria 48027
172 Ga0075431_100006196 3300006847 Bacteria 11874
173 Ga0075431_100040114 3300006847 Bacteria 4824
174 Ga0075431_100047352 3300006847 Bacteria 4432
175 Ga0075431_100105217 3300006847 Bacteria 2912
176 Ga0075431_100240629 3300006847 Bacteria 1841
177 Ga0075433_10530058 3300006852 Bacteria 1036
178 Ga0075429_100000075 3300006880 Bacteria 49848
179 Ga0075429_100000762 3300006880 Bacteria 25370
180 Ga0075429_100019307 3300006880 Bacteria 5903
181 Ga0075429_100057422 3300006880 Bacteria 3389
182 Ga0068865_100002225 3300006881 Bacteria 11426
183 Ga0068865_100313460 3300006881 Bacteria 1259
184 Ga0097620_100026240 3300006931 Bacteria 5842
185 Ga0097620_100026645 3300006931 Bacteria 5797
186 Ga0097620_100033755 3300006931 Bacteria 5137
187 Ga0097620_100182723 3300006931 Bacteria 2180
188 Ga0097620_101337223 3300006931 Bacteria 790
189 Ga0099794_10002719 3300007265 Bacteria 6591
190 Ga0105240_10323099 3300009093 Bacteria 1758
191 Ga0105240_10590580 3300009093 Bacteria 1224
192 Ga0111539_10000275 3300009094 Bacteria 61397
193 Ga0111539_10066518 3300009094 Bacteria 4257
194 Ga0111539_10366001 3300009094 Bacteria 1678
195 Ga0111539_11030207 3300009094 Unclassified 957
196 Ga0114129_10002034 3300009147 Bacteria 27730
197 Ga0114129_10003702 3300009147 Bacteria 21531
198 Ga0114129_10020604 3300009147 Bacteria 9376
199 Ga0114129_10264738 3300009147 Bacteria 2302
200 Ga0114129_10795816 3300009147 Bacteria 1207
201 Ga0105243_10179075 3300009148 Bacteria 1842
202 Ga0105243_10218957 3300009148 Bacteria 1681
203 Ga0105243_10221556 3300009148 Bacteria 1673
204 Ga0105243_10606175 3300009148 Bacteria 1055
205 Ga0105241_10158053 3300009174 Bacteria 1861
206 Ga0105242_10063926 3300009176 Bacteria 3031
207 Ga0105242_11308421 3300009176 Bacteria 749
208 Ga0105237_10076521 3300009545 Bacteria 3337
209 Ga0105249_10006010 3300009553 Bacteria 10519
210 Ga0105249_10113090 3300009553 Bacteria 2568
211 Ga0105249_10126985 3300009553 Bacteria 2430
212 Ga0105249_10390457 3300009553 Bacteria 1420
213 Ga0105239_10054807 3300010375 Unclassified 4374
214 Ga0105239_10076828 3300010375 Bacteria 3673
215 Ga0105239_10417656 3300010375 Bacteria 1519
216 Ga0105246_10275379 3300011119 Bacteria 1347
217 Ga0157373_10156416 3300013100 Bacteria 1603
218 Ga0157369_10000125 3300013105 Bacteria 110481
219 Ga0157369_10035338 3300013105 Bacteria 5480
220 Ga0157374_10132805 3300013296 Bacteria 2410
221 Ga0157374_10167080 3300013296 Bacteria 2145
222 Ga0157378_10030746 3300013297 Bacteria 4741
223 Ga0157378_10231683 3300013297 Bacteria 1760
224 Ga0157378_11615747 3300013297 Unclassified 694
225 Ga0163162_10063807 3300013306 Bacteria 3728
226 Ga0163162_10105025 3300013306 Bacteria 2919
227 Ga0163162_10583511 3300013306 Bacteria 1245
228 Ga0163162_11196484 3300013306 Bacteria 862
229 Ga0157372_10249913 3300013307 Bacteria 2058
230 Ga0157375_10002055 3300013308 Bacteria 17375
231 Ga0157375_10002541 3300013308 Bacteria 15830
232 Ga0157375_10016354 3300013308 Bacteria 6660
233 Ga0157375_10048095 3300013308 Bacteria 4170
234 Ga0157375_10150354 3300013308 Bacteria 2463
235 Ga0157375_10169790 3300013308 Bacteria 2328
236 Ga0163163_10028522 3300014325 Bacteria 5361
237 Ga0157380_10001799 3300014326 Bacteria 14150
238 Ga0157380_10292158 3300014326 Bacteria 1497
239 Ga0157380_10324419 3300014326 Bacteria 1429
240 Ga0157377_10333822 3300014745 Bacteria 1012
241 Ga0157379_10003578 3300014968 Bacteria 13166
242 Ga0157379_10051980 3300014968 Bacteria 3658
243 Ga0157379_10101656 3300014968 Bacteria 2580
244 Ga0157379_10260300 3300014968 Bacteria 1576
245 Ga0157376_10011472 3300014969 Bacteria 6533
246 Ga0157376_10414817 3300014969 Bacteria 1305
247 Ga0163161_10020557 3300017792 Bacteria 4634
248 Ga0163161_10050183 3300017792 Bacteria 3019
249 Ga0207697_10032724 3300025315 Bacteria 2128
250 Ga0207656_10051403 3300025321 Bacteria 1782
251 Ga0207656_10157806 3300025321 Bacteria 1078
252 Ga0207653_10009738 3300025885 Bacteria 2995
253 Ga0207682_10030239 3300025893 Bacteria 2168
254 Ga0207682_10057582 3300025893 Bacteria 1621
255 Ga0207642_10001183 3300025899 Bacteria 8047
256 Ga0207642_10037267 3300025899 Bacteria 2094
257 Ga0207710_10035686 3300025900 Bacteria 2188
258 Ga0207680_10002952 3300025903 Bacteria 7976
259 Ga0207680_10097218 3300025903 Bacteria 1885
260 Ga0207645_10002094 3300025907 Bacteria 15962
261 Ga0207645_10074227 3300025907 Bacteria 2177
262 Ga0207705_10960190 3300025909 Bacteria 661
263 Ga0207684_10003422 3300025910 Bacteria 15497
264 Ga0207684_10292962 3300025910 Bacteria 1403
265 Ga0207684_11099752 3300025910 Bacteria 662
266 Ga0207654_10084565 3300025911 Bacteria 1918
267 Ga0207654_10112945 3300025911 Bacteria 1693
268 Ga0207707_10044769 3300025912 Bacteria 3857
269 Ga0207707_10058244 3300025912 Bacteria 3362
270 Ga0207707_10145849 3300025912 Bacteria 2069
271 Ga0207695_10071380 3300025913 Bacteria 3547
272 Ga0207695_10336237 3300025913 Bacteria 1398
273 Ga0207671_10002001 3300025914 Bacteria 22453
274 Ga0207660_10029109 3300025917 Bacteria 3785
275 Ga0207660_10148486 3300025917 Bacteria 1799
276 Ga0207662_10011160 3300025918 Bacteria 4974
277 Ga0207662_10132734 3300025918 Bacteria 1571
278 Ga0207657_10384418 3300025919 Bacteria 1105
279 Ga0207649_10084164 3300025920 Bacteria 2067
280 Ga0207652_10028509 3300025921 Bacteria 4659
281 Ga0207652_10300546 3300025921 Bacteria 1449
282 Ga0207646_10079823 3300025922 Bacteria 2925
283 Ga0207681_10000308 3300025923 Bacteria 35918
284 Ga0207681_10140066 3300025923 Bacteria 1800
285 Ga0207681_10147949 3300025923 Bacteria 1757
286 Ga0207681_10352707 3300025923 Bacteria 1178
287 Ga0207681_10508941 3300025923 Bacteria 987
288 Ga0207694_10039863 3300025924 Bacteria 3615
289 Ga0207694_10179720 3300025924 Bacteria 1715
290 Ga0207650_10001008 3300025925 Bacteria 21196
291 Ga0207650_10002178 3300025925 Bacteria 13682
292 Ga0207650_10101075 3300025925 Bacteria 2219
293 Ga0207659_10012776 3300025926 Bacteria 5360
294 Ga0207687_10255921 3300025927 Bacteria 1394
295 Ga0207664_10589841 3300025929 Bacteria 998
296 Ga0207644_10000233 3300025931 Bacteria 38178
297 Ga0207644_10025887 3300025931 Bacteria 4037
298 Ga0207644_10053943 3300025931 Bacteria 2894
299 Ga0207644_10173294 3300025931 Unclassified 1686
300 Ga0207644_10241897 3300025931 Bacteria 1437
301 Ga0207690_10351389 3300025932 Bacteria 1166
302 Ga0207706_10004526 3300025933 Bacteria 13057
303 Ga0207706_10008475 3300025933 Bacteria 9481
304 Ga0207706_10224056 3300025933 Bacteria 1646
305 Ga0207706_10279851 3300025933 Bacteria 1455
306 Ga0207686_10051722 3300025934 Bacteria 2560
307 Ga0207686_10111659 3300025934 Bacteria 1845
308 Ga0207709_10004196 3300025935 Bacteria 8361
309 Ga0207709_10010801 3300025935 Bacteria 5028
310 Ga0207709_10033078 3300025935 Bacteria 3033
311 Ga0207669_10000725 3300025937 Bacteria 14268
312 Ga0207669_10138163 3300025937 Unclassified 1687
313 Ga0207704_10001008 3300025938 Bacteria 12492
314 Ga0207704_10002634 3300025938 Bacteria 8100
315 Ga0207704_10148057 3300025938 Bacteria 1652
316 Ga0207704_10227583 3300025938 Bacteria 1384
317 Ga0207704_10860757 3300025938 Bacteria 760
318 Ga0207665_10017636 3300025939 Bacteria 4691
319 Ga0207691_10002582 3300025940 Bacteria 17694
320 Ga0207691_10009767 3300025940 Bacteria 9211
321 Ga0207691_10075309 3300025940 Bacteria 3043
322 Ga0207691_10085414 3300025940 Bacteria 2832
323 Ga0207691_10119482 3300025940 Bacteria 2337
324 Ga0207691_10211435 3300025940 Bacteria 1684
325 Ga0207691_10444763 3300025940 Unclassified 1103
326 Ga0207711_10024925 3300025941 Bacteria 5017
327 Ga0207711_10028704 3300025941 Bacteria 4685
328 Ga0207689_10002808 3300025942 Bacteria 16090
329 Ga0207689_10005397 3300025942 Bacteria 11441
330 Ga0207689_10135934 3300025942 Unclassified 2024
331 Ga0207689_10317192 3300025942 Bacteria 1293
332 Ga0207679_10110804 3300025945 Bacteria 2166
333 Ga0207679_10305939 3300025945 Bacteria 1372
334 Ga0207667_10073768 3300025949 Bacteria 3545
335 Ga0207667_10115988 3300025949 Bacteria 2760
336 Ga0207651_10074361 3300025960 Bacteria 2419
337 Ga0207651_10147543 3300025960 Bacteria 1826
338 Ga0207651_10291583 3300025960 Bacteria 1353
339 Ga0207651_10871938 3300025960 Bacteria 801
340 Ga0207712_10012095 3300025961 Bacteria 5511
341 Ga0207712_10052892 3300025961 Bacteria 2846
342 Ga0207712_10328831 3300025961 Bacteria 1264
343 Ga0207668_10071966 3300025972 Bacteria 2472
344 Ga0207668_10219076 3300025972 Unclassified 1527
345 Ga0207640_10060522 3300025981 Bacteria 2503
346 Ga0207640_10414024 3300025981 Bacteria 1101
347 Ga0207658_10001166 3300025986 Bacteria 20974
348 Ga0207658_10111477 3300025986 Bacteria 2164
349 Ga0207658_10186754 3300025986 Bacteria 1720
350 Ga0207658_10331692 3300025986 Unclassified 1320
351 Ga0207658_10364220 3300025986 Bacteria 1262
352 Ga0207677_11049029 3300026023 Bacteria 741
353 Ga0207703_10000414 3300026035 Bacteria 45564
354 Ga0207639_10178761 3300026041 Bacteria 1803
355 Ga0207639_10801093 3300026041 Unclassified 878
356 Ga0207678_10002005 3300026067 Bacteria 18533
357 Ga0207708_10019250 3300026075 Bacteria 5143
358 Ga0207702_10153301 3300026078 Bacteria 2098
359 Ga0207641_10000615 3300026088 Bacteria 38942
360 Ga0207641_10333183 3300026088 Bacteria 1442
361 Ga0207648_10001283 3300026089 Bacteria 28030
362 Ga0207648_10001858 3300026089 Bacteria 23063
363 Ga0207648_10048979 3300026089 Bacteria 3699
364 Ga0207648_10100968 3300026089 Bacteria 2528
365 Ga0207648_10241859 3300026089 Bacteria 1607
366 Ga0207648_10421466 3300026089 Bacteria 1212
367 Ga0207648_10780704 3300026089 Bacteria 888
368 Ga0207676_10016903 3300026095 Bacteria 5282
369 Ga0207676_10025075 3300026095 Unclassified 4422
370 Ga0207676_10028948 3300026095 Bacteria 4143
371 Ga0207676_10347071 3300026095 Bacteria 1371
372 Ga0207674_10005690 3300026116 Bacteria 14779
373 Ga0207674_10051704 3300026116 Bacteria 4193
374 Ga0207674_10182374 3300026116 Bacteria 2050
375 Ga0207674_10321593 3300026116 Bacteria 1496
376 Ga0207674_10719175 3300026116 Bacteria 964
377 Ga0207675_100002985 3300026118 Bacteria 16625
378 Ga0207675_100078237 3300026118 Bacteria 3099
379 Ga0207675_100138013 3300026118 Bacteria 2315
380 Ga0207683_10039813 3300026121 Bacteria 4100
381 Ga0207683_10066045 3300026121 Bacteria 3190
382 Ga0207683_10169405 3300026121 Bacteria 1977
383 Ga0207698_10004887 3300026142 Bacteria 8219
384 Ga0207698_10022022 3300026142 Bacteria 4420
385 Ga0207698_10080048 3300026142 Bacteria 2630
386 Ga0210000_1001718 3300027462 Bacteria 3094
387 Ga0209999_1000757 3300027543 Bacteria 5274
388 Ga0209588_1021796 3300027671 Bacteria 2014
389 Ga0207428_10004772 3300027907 Bacteria 12803
390 Ga0268265_10002595 3300028380 Bacteria 13467
391 Ga0268265_10026127 3300028380 Bacteria 4151
392 Ga0268265_10301381 3300028380 Bacteria 1443
393 Ga0268265_10519404 3300028380 Unclassified 1125
394 Ga0268265_10642572 3300028380 Bacteria 1019
395 Ga0268264_10000780 3300028381 Bacteria 35025
396 Ga0268264_10019710 3300028381 Bacteria 5510
397 Ga0268264_10062513 3300028381 Bacteria 3127
398 Ga0268264_10062845 3300028381 Bacteria 3119
399 Ga0268264_10102221 3300028381 Bacteria 2494
400 Ga0268264_10580374 3300028381 Bacteria 1103
401 Ga0307408_100040891 3300031548 Bacteria 3285
402 Ga0307405_10090200 3300031731 Bacteria 2027
403 Ga0307413_10182145 3300031824 Bacteria 1499
404 Ga0307410_10149993 3300031852 Bacteria 1735
405 Ga0307407_10093160 3300031903 Bacteria 1852
406 Ga0307412_10439178 3300031911 Bacteria 1072
407 Ga0307409_100103265 3300031995 Bacteria 2370
408 Ga0307416_100001193 3300032002 Bacteria 13976
409 Ga0307416_100171118 3300032002 Bacteria 2022
410 Ga0307416_100388789 3300032002 Bacteria 1428
411 Ga0307414_11028472 3300032004 Bacteria 759
412 Ga0307411_10011045 3300032005 Bacteria 4851
413 Ga0307415_100001120 3300032126 Bacteria 12518
414 Ga0373949_0044485 3300035090 Bacteria 1102
415 Ga0373941_0160003 3300035115 Bacteria 832
416 Ga0373946_0314183 3300035171 Bacteria 777
417 Ga0373955_0021268 3300035172 Bacteria 3273
418 Ga0373955_0127423 3300035172 Bacteria 1484
419 Ga0373942_0030852 3300035207 Bacteria 1414
420 Ga0373924_0024407 3300035410 Bacteria 2382
421 Ga0373931_0001530 3300035691 Bacteria 9968
422 Ga0373935_0150814 3300035692 Bacteria 1577
423 Ga0373927_0078297 3300035695 Bacteria 2141
424 Ga0373927_0095432 3300035695 Bacteria 1933
425 Ga0373947_0064888 3300035725 Bacteria 2227
426 Ga0373947_0083668 3300035725 Bacteria 1979
427 Ga0373937_0038192 3300036401 Bacteria 4376
428 Ga0373937_0097813 3300036401 Bacteria 2722
429 Ga0373937_0413168 3300036401 Bacteria 1280
430 Ga0373925_0000845 3300037068 Bacteria 28162
431 Ga0451853_1783048 3300041512 Bacteria 1956
432 Ga0439441_011407 3300042001 Bacteria 1507
433 Ga0439464_0184906 3300042439 Bacteria 661
434 Ga0451576_0258777 3300045051 Bacteria 1819
435 Ga0495603_0159038 3300046455 Bacteria 1311
436 Ga0495603_0166158 3300046455 Bacteria 1279
437 Ga0495629_0159074 3300046459 Bacteria 1569
438 Ga0495641_0126388 3300046461 Bacteria 1141
439 Ga0495651_0399200 3300046462 Bacteria 898
440 Ga0495580_0156721 3300046472 Bacteria 1577
441 Ga0495580_0315555 3300046472 Bacteria 1063
442 Ga0495585_0372991 3300046492 Bacteria 690
443 Ga0495620_0171489 3300046515 Bacteria 841
444 Ga0495628_0153973 3300046516 Bacteria 1750
445 Ga0495663_0063229 3300046525 Bacteria 1167
446 Ga0495586_0127151 3300046535 Bacteria 1426
447 Ga0495586_0130446 3300046535 Bacteria 1407
448 Ga0495621_0100855 3300046539 Bacteria 1098
449 Ga0495645_0032857 3300046543 Bacteria 3785
450 Ga0495656_0056435 3300046615 Bacteria 1697
451 Ga0495635_0057299 3300046663 Bacteria 2681
452 Ga0495657_0445751 3300046675 Bacteria 758
453 Ga0495599_0046159 3300046678 Bacteria 2732
454 Ga0495647_0064064 3300046681 Bacteria 1457
455 Ga0495658_0012026 3300046683 Bacteria 4371
456 Ga0495658_0017020 3300046683 Bacteria 3748
457 Ga0495669_0005865 3300046684 Bacteria 5120
458 Ga0495669_0353461 3300046684 Bacteria 710
459 Ga0495674_0134010 3300047319 Bacteria 2086
460 Ga0495680_0053172 3300047322 Bacteria 3154
461 Ga0495684_0026078 3300047471 Bacteria 4493
462 Ga0496102_0008252 3300048905 Bacteria 8920
463 Ga0496103_0092684 3300048906 Bacteria 1907
464 Ga0496106_0283417 3300048909 Bacteria 1327
465 Ga0496108_0123745 3300048911 Bacteria 2219
466 Ga0496109_0229061 3300048912 Bacteria 1748
467 Ga0496109_0233687 3300048912 Bacteria 1730
468 Ga0496110_0092527 3300048913 Bacteria 2706
469 Ga0501031_0048841 3300049568 Bacteria 2757
470 Ga0501032_0065492 3300049569 Bacteria 2430
471 Ga0501033_0004048 3300049570 Bacteria 11838
472 Ga0501034_0000406 3300049571 Bacteria 72755
473 Ga0501034_0002174 3300049571 Bacteria 24290
474 Ga0501036_0011077 3300049572 Bacteria 7457
475 Ga0501037_0023042 3300049573 Bacteria 4605
476 Ga0501038_0000668 3300049574 Bacteria 30539
477 Ga0501039_0007014 3300049575 Bacteria 8578
478 Ga0501040_0002705 3300049576 Bacteria 11427
479 Ga0501040_0037480 3300049576 Bacteria 3294
480 Ga0501040_0225807 3300049576 Bacteria 1333
481 Ga0501041_0000098 3300049577 Bacteria 35755
482 Ga0501041_0081699 3300049577 Bacteria 1990
483 Ga0501042_0000242 3300049578 Bacteria 26466
484 Ga0501042_0112725 3300049578 Bacteria 1958
485 Ga0501042_0178129 3300049578 Bacteria 1533
486 Ga0501043_0101839 3300049579 Bacteria 2257
487 Ga0501046_0000144 3300049580 Bacteria 74352
488 Ga0501047_0157730 3300049581 Bacteria 2142
489 Ga0501048_0008341 3300049582 Bacteria 7835
490 Ga0501067_0124185 3300049583 Bacteria 1437
491 Ga0501068_0005592 3300049584 Bacteria 6883
492 Ga0501068_0018055 3300049584 Bacteria 4085
493 Ga0501069_0186441 3300049585 Bacteria 1200
494 Ga0501069_0355022 3300049585 Bacteria 864
495 Ga0501070_0058828 3300049586 Bacteria 3186
496 Ga0501070_0074020 3300049586 Bacteria 2819
497 Ga0501071_0006755 3300049587 Bacteria 7470
498 Ga0501071_0112682 3300049587 Bacteria 2011
499 Ga0501072_0001347 3300049588 Bacteria 18406
500 Ga0501072_0001685 3300049588 Bacteria 16461
501 Ga0501072_0054971 3300049588 Bacteria 3138
502 Ga0501073_0032995 3300049589 Bacteria 3689
503 Ga0501074_0063744 3300049590 Bacteria 2654
504 Ga0501074_0433471 3300049590 Bacteria 932
505 Ga0501074_0512083 3300049590 Bacteria 850
506 Ga0501075_0000101 3300049591 Bacteria 39774
507 Ga0501075_0017493 3300049591 Bacteria 5180
508 Ga0501075_0018641 3300049591 Bacteria 5025
509 Ga0501076_0035324 3300049592 Bacteria 3911
510 Ga0501076_0160853 3300049592 Bacteria 1829
511 Ga0501076_0170270 3300049592 Bacteria 1775
512 Ga0501076_0174084 3300049592 Bacteria 1754
513 Ga0501077_0000994 3300049593 Bacteria 17080
514 Ga0501077_0020557 3300049593 Bacteria 4179
515 Ga0501077_0094343 3300049593 Bacteria 1897
516 Ga0501079_0000459 3300049741 Bacteria 26782
517 Ga0501079_0011265 3300049741 Bacteria 6822
518 Ga0501080_0042174 3300049742 Bacteria 4250
519 Ga0501080_0044844 3300049742 Bacteria 4115
520 Ga0501080_0086996 3300049742 Bacteria 2904
521 Ga0501080_0628343 3300049742 Bacteria 952
522 Ga0501081_0000680 3300049743 Bacteria 19572
523 Ga0501081_0002406 3300049743 Bacteria 11800
524 Ga0501083_0197124 3300049744 Bacteria 1314
525 Ga0501035_0080030 3300049822 Bacteria 2885
526 Ga0501035_0144481 3300049822 Bacteria 2067
527 Ga0501044_0071240 3300049823 Bacteria 3535
528 Ga0501045_0002526 3300049824 Bacteria 12452
529 Ga0501045_0092703 3300049824 Bacteria 2234
530 nmdc:mga05p37_29333_c1 3300050507 Bacteria 6714
531 nmdc:mga05p37_510_c1 3300050507 Bacteria 42907
532 nmdc:mga05p37_931_c1 3300050507 Bacteria 32975
533 nmdc:mga09592_1086_c1 3300050508 Bacteria 21589
534 nmdc:mga09592_49676_c1 3300050508 Bacteria 3537
535 nmdc:mga09592_75_c1 3300050508 Bacteria 56459
536 nmdc:mga0qj67_368_c1 3300050509 Bacteria 30906
537 nmdc:mga06r32_136009_c1 3300050510 Bacteria 2432
538 nmdc:mga06r32_148618_c1 3300050510 Bacteria 2321
539 nmdc:mga06r32_15504_c1 3300050510 Bacteria 6920
540 nmdc:mga06r32_1675_c1 3300050510 Bacteria 20002
541 nmdc:mga06r32_564910_c1 3300050510 Bacteria 1111
542 nmdc:mga08y16_124755_c1 3300050511 Bacteria 2679
543 nmdc:mga08y16_183697_c1 3300050511 Bacteria 2170
544 nmdc:mga08y16_56348_c1 3300050511 Bacteria 4108
545 nmdc:mga08x19_22243_c1 3300050514 Bacteria 3925
546 nmdc:mga0a205_538952_c1 3300050515 Bacteria 1023
547 Ga0495601_0042566 3300053077 Bacteria 2850
548 Ga0495601_0141193 3300053077 Bacteria 1571
549 Ga0495612_0027102 3300053078 Bacteria 2304
550 Ga0495595_0071075 3300053084 Bacteria 1645
551 Ga0495619_0075349 3300053085 Bacteria 2264
552 Ga0501084_0053651 3300054114 Bacteria 3372
553 Ga0501082_0024634 3300060353 Bacteria 5187
554 Ga0501082_0389290 3300060353 Bacteria 1216
555 Ga0530510_0000221 3300061734 Bacteria 35515

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10000233 Ga0207644_1000023314 189
2 3300025941 Ga0207711_10028704 Ga0207711_100287043 189
3 3300026095 Ga0207676_10347071 Ga0207676_103470712 189
4 3300031824 Ga0307413_10182145 Ga0307413_101821453 191
5 3300005338 Ga0068868_100027304 Ga0068868_1000273043 192
6 3300005355 Ga0070671_100012508 Ga0070671_1000125085 192
7 3300005355 Ga0070671_100015021 Ga0070671_1000150216 192
8 3300005455 Ga0070663_100026998 Ga0070663_1000269984 192
9 3300005456 Ga0070678_100102152 Ga0070678_1001021523 192
10 3300005539 Ga0068853_100064855 Ga0068853_1000648554 192
11 3300005543 Ga0070672_100078033 Ga0070672_1000780332 192
12 3300005543 Ga0070672_100152168 Ga0070672_1001521682 192
13 3300005834 Ga0068851_10004147 Ga0068851_100041477 192
14 3300005840 Ga0068870_10114659 Ga0068870_101146592 192
15 3300005841 Ga0068863_100211152 Ga0068863_1002111523 192
16 3300006237 Ga0097621_100130435 Ga0097621_1001304354 192
17 3300006358 Ga0068871_100352182 Ga0068871_1003521822 192
18 3300013296 Ga0157374_10167080 Ga0157374_101670803 192
19 3300013308 Ga0157375_10169790 Ga0157375_101697904 192
20 3300025321 Ga0207656_10051403 Ga0207656_100514032 192
21 3300025925 Ga0207650_10101075 Ga0207650_101010753 192
22 3300025931 Ga0207644_10025887 Ga0207644_100258875 192
23 3300025940 Ga0207691_10009767 Ga0207691_100097676 192
24 3300025960 Ga0207651_10074361 Ga0207651_100743612 192
25 3300025986 Ga0207658_10186754 Ga0207658_101867543 192
26 3300026067 Ga0207678_10002005 Ga0207678_1000200513 192
27 3300026095 Ga0207676_10028948 Ga0207676_100289485 192
28 3300026121 Ga0207683_10039813 Ga0207683_100398133 192
29 3300046515 Ga0495620_0171489 Ga0495620_0171489_139_765 192
30 3300046539 Ga0495621_0100855 Ga0495621_0100855_187_813 192
31 3300048911 Ga0496108_0123745 Ga0496108_0123745_400_1026 192
32 3300048912 Ga0496109_0229061 Ga0496109_0229061_623_1249 192
33 3300048912 Ga0496109_0233687 Ga0496109_0233687_580_1206 192
34 3300048913 Ga0496110_0092527 Ga0496110_0092527_647_1273 192
35 3300005548 Ga0070665_100347379 Ga0070665_1003473792 194
36 3300025942 Ga0207689_10317192 Ga0207689_103171922 194
37 3300025960 Ga0207651_10871938 Ga0207651_108719382 194
38 3300005336 Ga0070680_100156120 Ga0070680_1001561202 195
39 3300005353 Ga0070669_100028821 Ga0070669_1000288214 195
40 3300005356 Ga0070674_100117056 Ga0070674_1001170563 195
41 3300005365 Ga0070688_100147183 Ga0070688_1001471832 195
42 3300005367 Ga0070667_100283900 Ga0070667_1002839002 195
43 3300005440 Ga0070705_100317857 Ga0070705_1003178572 195
44 3300005455 Ga0070663_100217322 Ga0070663_1002173222 195
45 3300005456 Ga0070678_100057728 Ga0070678_1000577283 195
46 3300005456 Ga0070678_100223481 Ga0070678_1002234812 195
47 3300005458 Ga0070681_10039177 Ga0070681_100391773 195
48 3300005466 Ga0070685_10324796 Ga0070685_103247961 195
49 3300005468 Ga0070707_100453719 Ga0070707_1004537192 195
50 3300005471 Ga0070698_100365492 Ga0070698_1003654922 195
51 3300005530 Ga0070679_100140166 Ga0070679_1001401662 195
52 3300005539 Ga0068853_100038903 Ga0068853_1000389033 195
53 3300005545 Ga0070695_101069200 Ga0070695_1010692001 195
54 3300005547 Ga0070693_100435490 Ga0070693_1004354901 195
55 3300005577 Ga0068857_100088417 Ga0068857_1000884173 195
56 3300005617 Ga0068859_100026239 Ga0068859_1000262393 195
57 3300005843 Ga0068860_100062489 Ga0068860_1000624891 195
58 3300005844 Ga0068862_100098828 Ga0068862_1000988283 195
59 3300006195 Ga0075366_10027341 Ga0075366_100273413 195
60 3300006931 Ga0097620_100026240 Ga0097620_1000262406 195
61 3300009093 Ga0105240_10323099 Ga0105240_103230992 195
62 3300009094 Ga0111539_10066518 Ga0111539_100665185 195
63 3300009148 Ga0105243_10218957 Ga0105243_102189572 195
64 3300009148 Ga0105243_10221556 Ga0105243_102215562 195
65 3300009176 Ga0105242_11308421 Ga0105242_113084211 195
66 3300009553 Ga0105249_10006010 Ga0105249_100060103 195
67 3300009553 Ga0105249_10126985 Ga0105249_101269852 195
68 3300010375 Ga0105239_10417656 Ga0105239_104176561 195
69 3300011119 Ga0105246_10275379 Ga0105246_102753792 195
70 3300013105 Ga0157369_10000125 Ga0157369_1000012536 195
71 3300013297 Ga0157378_10030746 Ga0157378_100307462 195
72 3300013306 Ga0163162_10105025 Ga0163162_101050253 195
73 3300013308 Ga0157375_10048095 Ga0157375_100480952 195
74 3300014968 Ga0157379_10101656 Ga0157379_101016562 195
75 3300017792 Ga0163161_10050183 Ga0163161_100501833 195
76 3300025899 Ga0207642_10037267 Ga0207642_100372673 195
77 3300025911 Ga0207654_10084565 Ga0207654_100845652 195
78 3300025912 Ga0207707_10058244 Ga0207707_100582442 195
79 3300025913 Ga0207695_10071380 Ga0207695_100713805 195
80 3300025914 Ga0207671_10002001 Ga0207671_100020011 195
81 3300025917 Ga0207660_10148486 Ga0207660_101484862 195
82 3300025924 Ga0207694_10039863 Ga0207694_100398632 195
83 3300025935 Ga0207709_10033078 Ga0207709_100330782 195
84 3300025937 Ga0207669_10138163 Ga0207669_101381632 195
85 3300025938 Ga0207704_10002634 Ga0207704_100026343 195
86 3300025940 Ga0207691_10444763 Ga0207691_104447631 195
87 3300025942 Ga0207689_10135934 Ga0207689_101359341 195
88 3300025961 Ga0207712_10052892 Ga0207712_100528922 195
89 3300025972 Ga0207668_10219076 Ga0207668_102190762 195
90 3300025986 Ga0207658_10331692 Ga0207658_103316922 195
91 3300026041 Ga0207639_10178761 Ga0207639_101787613 195
92 3300026089 Ga0207648_10001858 Ga0207648_100018588 195
93 3300026116 Ga0207674_10051704 Ga0207674_100517043 195
94 3300026121 Ga0207683_10066045 Ga0207683_100660453 195
95 3300028380 Ga0268265_10519404 Ga0268265_105194042 195
96 3300028381 Ga0268264_10019710 Ga0268264_100197102 195
97 3300031852 Ga0307410_10149993 Ga0307410_101499931 195
98 3300032004 Ga0307414_11028472 Ga0307414_110284722 195
99 3300035171 Ga0373946_0314183 Ga0373946_0314183_157_759 195
100 3300035695 Ga0373927_0078297 Ga0373927_0078297_350_952 195
101 3300035725 Ga0373947_0083668 Ga0373947_0083668_473_1075 195
102 3300037068 Ga0373925_0000845 Ga0373925_0000845_22692_23294 195
103 3300046455 Ga0495603_0166158 Ga0495603_0166158_298_900 195
104 3300046681 Ga0495647_0064064 Ga0495647_0064064_681_1283 195
105 3300046684 Ga0495669_0005865 Ga0495669_0005865_3719_4327 195
106 3300050511 nmdc:mga08y16_56348_c1 nmdc:mga08y16_56348_c1_531_1124 195
107 3300014326 Ga0157380_10292158 Ga0157380_102921582 196
108 3300049742 Ga0501080_0628343 Ga0501080_0628343_248_850 196
109 3300005434 Ga0070709_10755978 Ga0070709_107559781 197
110 3300005435 Ga0070714_100008968 Ga0070714_1000089686 197
111 3300005444 Ga0070694_100516275 Ga0070694_1005162752 197
112 3300013297 Ga0157378_11615747 Ga0157378_116157471 197
113 3300026089 Ga0207648_10100968 Ga0207648_101009682 197
114 3300028380 Ga0268265_10026127 Ga0268265_100261272 197
115 3300046684 Ga0495669_0353461 Ga0495669_0353461_38_631 197
116 3300049585 Ga0501069_0186441 Ga0501069_0186441_424_1071 197
117 3300049585 Ga0501069_0355022 Ga0501069_0355022_126_728 197
118 3300049587 Ga0501071_0112682 Ga0501071_0112682_1089_1739 197
119 3300049588 Ga0501072_0001685 Ga0501072_0001685_1250_1852 197
120 3300049822 Ga0501035_0144481 Ga0501035_0144481_503_1153 197
121 3300049823 Ga0501044_0071240 Ga0501044_0071240_1047_1787 197
122 3300005336 Ga0070680_100047216 Ga0070680_1000472162 198
123 3300005345 Ga0070692_10026184 Ga0070692_100261843 198
124 3300005345 Ga0070692_10046708 Ga0070692_100467082 198
125 3300005353 Ga0070669_100476026 Ga0070669_1004760262 198
126 3300005406 Ga0070703_10002969 Ga0070703_100029693 198
127 3300005440 Ga0070705_100161743 Ga0070705_1001617432 198
128 3300005440 Ga0070705_100254304 Ga0070705_1002543042 198
129 3300005441 Ga0070700_100100323 Ga0070700_1001003233 198
130 3300005444 Ga0070694_100162342 Ga0070694_1001623421 198
131 3300005467 Ga0070706_100543298 Ga0070706_1005432982 198
132 3300005518 Ga0070699_100018485 Ga0070699_1000184857 198
133 3300005536 Ga0070697_100247936 Ga0070697_1002479362 198
134 3300005539 Ga0068853_100888899 Ga0068853_1008888992 198
135 3300005545 Ga0070695_100002311 Ga0070695_1000023116 198
136 3300005549 Ga0070704_100167527 Ga0070704_1001675272 198
137 3300005577 Ga0068857_100002520 Ga0068857_10000252012 198
138 3300005617 Ga0068859_100033758 Ga0068859_1000337582 198
139 3300005617 Ga0068859_100182735 Ga0068859_1001827352 198
140 3300005618 Ga0068864_100024342 Ga0068864_1000243423 198
141 3300005843 Ga0068860_100153687 Ga0068860_1001536873 198
142 3300005843 Ga0068860_101716961 Ga0068860_1017169611 198
143 3300005844 Ga0068862_100105584 Ga0068862_1001055843 198
144 3300005844 Ga0068862_100382222 Ga0068862_1003822222 198
145 3300006844 Ga0075428_100000828 Ga0075428_1000008282 198
146 3300006844 Ga0075428_100018021 Ga0075428_1000180218 198
147 3300006846 Ga0075430_100000127 Ga0075430_10000012722 198
148 3300006847 Ga0075431_100040114 Ga0075431_1000401144 198
149 3300006847 Ga0075431_100047352 Ga0075431_1000473523 198
150 3300006847 Ga0075431_100240629 Ga0075431_1002406292 198
151 3300006880 Ga0075429_100000075 Ga0075429_10000007518 198
152 3300006880 Ga0075429_100000762 Ga0075429_10000076216 198
153 3300006880 Ga0075429_100057422 Ga0075429_1000574222 198
154 3300006931 Ga0097620_100033755 Ga0097620_1000337552 198
155 3300006931 Ga0097620_100182723 Ga0097620_1001827232 198
156 3300009093 Ga0105240_10590580 Ga0105240_105905802 198
157 3300009147 Ga0114129_10002034 Ga0114129_1000203423 198
158 3300009147 Ga0114129_10020604 Ga0114129_100206046 198
159 3300009174 Ga0105241_10158053 Ga0105241_101580533 198
160 3300009176 Ga0105242_10063926 Ga0105242_100639263 198
161 3300009553 Ga0105249_10113090 Ga0105249_101130902 198
162 3300009553 Ga0105249_10390457 Ga0105249_103904572 198
163 3300010375 Ga0105239_10054807 Ga0105239_100548075 198
164 3300025885 Ga0207653_10009738 Ga0207653_100097382 198
165 3300025910 Ga0207684_10003422 Ga0207684_1000342214 198
166 3300025910 Ga0207684_10292962 Ga0207684_102929621 198
167 3300025911 Ga0207654_10112945 Ga0207654_101129452 198
168 3300025913 Ga0207695_10336237 Ga0207695_103362372 198
169 3300025917 Ga0207660_10029109 Ga0207660_100291093 198
170 3300025923 Ga0207681_10508941 Ga0207681_105089412 198
171 3300025934 Ga0207686_10051722 Ga0207686_100517223 198
172 3300025935 Ga0207709_10010801 Ga0207709_100108013 198
173 3300025942 Ga0207689_10005397 Ga0207689_100053977 198
174 3300025961 Ga0207712_10328831 Ga0207712_103288312 198
175 3300025981 Ga0207640_10414024 Ga0207640_104140243 198
176 3300026041 Ga0207639_10801093 Ga0207639_108010931 198
177 3300026075 Ga0207708_10019250 Ga0207708_100192504 198
178 3300026116 Ga0207674_10005690 Ga0207674_100056902 198
179 3300028380 Ga0268265_10642572 Ga0268265_106425722 198
180 3300028381 Ga0268264_10062513 Ga0268264_100625133 198
181 3300028381 Ga0268264_10580374 Ga0268264_105803741 198
182 3300032002 Ga0307416_100388789 Ga0307416_1003887893 198
183 3300042001 Ga0439441_011407 Ga0439441_011407_472_1068 198
184 3300042439 Ga0439464_0184906 Ga0439464_0184906_13_609 198
185 3300046678 Ga0495599_0046159 Ga0495599_0046159_887_1495 198
186 3300050507 nmdc:mga05p37_510_c1 nmdc:mga05p37_510_c1_17455_18051 198
187 3300050507 nmdc:mga05p37_931_c1 nmdc:mga05p37_931_c1_10562_11161 198
188 3300050508 nmdc:mga09592_49676_c1 nmdc:mga09592_49676_c1_813_1409 198
189 3300050508 nmdc:mga09592_75_c1 nmdc:mga09592_75_c1_40610_41209 198
190 3300050509 nmdc:mga0qj67_368_c1 nmdc:mga0qj67_368_c1_6797_7393 198
191 3300050510 nmdc:mga06r32_15504_c1 nmdc:mga06r32_15504_c1_3698_4297 198
192 3300050510 nmdc:mga06r32_1675_c1 nmdc:mga06r32_1675_c1_17604_18200 198
193 3300050510 nmdc:mga06r32_564910_c1 nmdc:mga06r32_564910_c1_99_701 198
194 3300005327 Ga0070658_10804171 Ga0070658_108041712 199
195 3300005340 Ga0070689_101190369 Ga0070689_1011903691 199
196 3300005344 Ga0070661_100052696 Ga0070661_1000526964 199
197 3300005435 Ga0070714_100561293 Ga0070714_1005612931 199
198 3300005440 Ga0070705_100056657 Ga0070705_1000566572 199
199 3300005445 Ga0070708_100046870 Ga0070708_1000468702 199
200 3300005445 Ga0070708_100687731 Ga0070708_1006877312 199
201 3300005457 Ga0070662_100563012 Ga0070662_1005630121 199
202 3300005458 Ga0070681_10025566 Ga0070681_100255664 199
203 3300005468 Ga0070707_100254889 Ga0070707_1002548892 199
204 3300005518 Ga0070699_100558360 Ga0070699_1005583602 199
205 3300005530 Ga0070679_100175238 Ga0070679_1001752382 199
206 3300005549 Ga0070704_100026341 Ga0070704_1000263415 199
207 3300005563 Ga0068855_100075269 Ga0068855_1000752694 199
208 3300005564 Ga0070664_100017520 Ga0070664_1000175206 199
209 3300005577 Ga0068857_100154375 Ga0068857_1001543753 199
210 3300005614 Ga0068856_100011081 Ga0068856_1000110813 199
211 3300005841 Ga0068863_100523878 Ga0068863_1005238782 199
212 3300006844 Ga0075428_100034331 Ga0075428_1000343314 199
213 3300006847 Ga0075431_100006196 Ga0075431_1000061965 199
214 3300006847 Ga0075431_100105217 Ga0075431_1001052172 199
215 3300006880 Ga0075429_100019307 Ga0075429_1000193075 199
216 3300009094 Ga0111539_11030207 Ga0111539_110302071 199
217 3300009147 Ga0114129_10003702 Ga0114129_100037025 199
218 3300013100 Ga0157373_10156416 Ga0157373_101564161 199
219 3300013105 Ga0157369_10035338 Ga0157369_100353388 199
220 3300013307 Ga0157372_10249913 Ga0157372_102499133 199
221 3300014968 Ga0157379_10260300 Ga0157379_102603002 199
222 3300025900 Ga0207710_10035686 Ga0207710_100356862 199
223 3300025909 Ga0207705_10960190 Ga0207705_109601901 199
224 3300025910 Ga0207684_11099752 Ga0207684_110997521 199
225 3300025912 Ga0207707_10145849 Ga0207707_101458493 199
226 3300025920 Ga0207649_10084164 Ga0207649_100841643 199
227 3300025921 Ga0207652_10028509 Ga0207652_100285097 199
228 3300025922 Ga0207646_10079823 Ga0207646_100798232 199
229 3300025929 Ga0207664_10589841 Ga0207664_105898412 199
230 3300025941 Ga0207711_10024925 Ga0207711_100249252 199
231 3300025945 Ga0207679_10110804 Ga0207679_101108042 199
232 3300025949 Ga0207667_10073768 Ga0207667_100737684 199
233 3300026078 Ga0207702_10153301 Ga0207702_101533012 199
234 3300026116 Ga0207674_10321593 Ga0207674_103215931 199
235 3300046455 Ga0495603_0159038 Ga0495603_0159038_633_1247 199
236 3300046535 Ga0495586_0130446 Ga0495586_0130446_656_1270 199
237 3300046683 Ga0495658_0012026 Ga0495658_0012026_2791_3405 199
238 3300049593 Ga0501077_0094343 Ga0501077_0094343_870_1469 199
239 3300050507 nmdc:mga05p37_29333_c1 nmdc:mga05p37_29333_c1_917_1522 199
240 3300050508 nmdc:mga09592_1086_c1 nmdc:mga09592_1086_c1_5087_5692 199
241 3300050510 nmdc:mga06r32_136009_c1 nmdc:mga06r32_136009_c1_1060_1659 199
242 3300050510 nmdc:mga06r32_148618_c1 nmdc:mga06r32_148618_c1_986_1591 199
243 3300005293 Ga0065715_10003987 Ga0065715_100039876 200
244 3300005295 Ga0065707_10102385 Ga0065707_101023851 200
245 3300005330 Ga0070690_100087630 Ga0070690_1000876302 200
246 3300005330 Ga0070690_100130640 Ga0070690_1001306403 200
247 3300005331 Ga0070670_100116738 Ga0070670_1001167382 200
248 3300005333 Ga0070677_10353802 Ga0070677_103538021 200
249 3300005334 Ga0068869_100005372 Ga0068869_1000053725 200
250 3300005334 Ga0068869_100744620 Ga0068869_1007446201 200
251 3300005335 Ga0070666_10005295 Ga0070666_100052953 200
252 3300005335 Ga0070666_10265066 Ga0070666_102650661 200
253 3300005338 Ga0068868_100005931 Ga0068868_1000059315 200
254 3300005340 Ga0070689_100804621 Ga0070689_1008046211 200
255 3300005343 Ga0070687_100073931 Ga0070687_1000739312 200
256 3300005347 Ga0070668_100000332 Ga0070668_10000033219 200
257 3300005353 Ga0070669_100000950 Ga0070669_10000095016 200
258 3300005354 Ga0070675_100003748 Ga0070675_1000037482 200
259 3300005354 Ga0070675_100021734 Ga0070675_1000217344 200
260 3300005355 Ga0070671_100367410 Ga0070671_1003674101 200
261 3300005356 Ga0070674_100002766 Ga0070674_1000027665 200
262 3300005364 Ga0070673_100006099 Ga0070673_1000060997 200
263 3300005364 Ga0070673_100126353 Ga0070673_1001263532 200
264 3300005366 Ga0070659_100254311 Ga0070659_1002543113 200
265 3300005367 Ga0070667_100004997 Ga0070667_10000499711 200
266 3300005367 Ga0070667_100845792 Ga0070667_1008457921 200
267 3300005438 Ga0070701_10016655 Ga0070701_100166553 200
268 3300005440 Ga0070705_100509810 Ga0070705_1005098102 200
269 3300005441 Ga0070700_100004257 Ga0070700_1000042575 200
270 3300005444 Ga0070694_100038005 Ga0070694_1000380056 200
271 3300005457 Ga0070662_100001231 Ga0070662_1000012317 200
272 3300005457 Ga0070662_100070608 Ga0070662_1000706083 200
273 3300005458 Ga0070681_10098815 Ga0070681_100988152 200
274 3300005459 Ga0068867_100005647 Ga0068867_1000056475 200
275 3300005459 Ga0068867_100094045 Ga0068867_1000940451 200
276 3300005459 Ga0068867_100170513 Ga0068867_1001705132 200
277 3300005459 Ga0068867_100434576 Ga0068867_1004345762 200
278 3300005459 Ga0068867_100593770 Ga0068867_1005937702 200
279 3300005471 Ga0070698_100005029 Ga0070698_10000502917 200
280 3300005471 Ga0070698_100849800 Ga0070698_1008498002 200
281 3300005530 Ga0070679_100751922 Ga0070679_1007519221 200
282 3300005539 Ga0068853_100409884 Ga0068853_1004098842 200
283 3300005539 Ga0068853_100766476 Ga0068853_1007664762 200
284 3300005543 Ga0070672_100001876 Ga0070672_10000187613 200
285 3300005543 Ga0070672_100014880 Ga0070672_1000148805 200
286 3300005543 Ga0070672_100038870 Ga0070672_1000388704 200
287 3300005543 Ga0070672_100051107 Ga0070672_1000511072 200
288 3300005543 Ga0070672_100078980 Ga0070672_1000789803 200
289 3300005543 Ga0070672_100205319 Ga0070672_1002053192 200
290 3300005543 Ga0070672_100206118 Ga0070672_1002061182 200
291 3300005545 Ga0070695_100033929 Ga0070695_1000339294 200
292 3300005545 Ga0070695_100164841 Ga0070695_1001648414 200
293 3300005546 Ga0070696_100254971 Ga0070696_1002549712 200
294 3300005546 Ga0070696_100406806 Ga0070696_1004068062 200
295 3300005547 Ga0070693_100369884 Ga0070693_1003698842 200
296 3300005548 Ga0070665_101325077 Ga0070665_1013250771 200
297 3300005549 Ga0070704_100000613 Ga0070704_10000061310 200
298 3300005563 Ga0068855_100104224 Ga0068855_1001042243 200
299 3300005564 Ga0070664_100340199 Ga0070664_1003401991 200
300 3300005564 Ga0070664_100757459 Ga0070664_1007574592 200
301 3300005577 Ga0068857_100045138 Ga0068857_1000451386 200
302 3300005577 Ga0068857_100065261 Ga0068857_1000652613 200
303 3300005578 Ga0068854_100314158 Ga0068854_1003141581 200
304 3300005616 Ga0068852_100031495 Ga0068852_1000314953 200
305 3300005616 Ga0068852_100200383 Ga0068852_1002003832 200
306 3300005617 Ga0068859_100026644 Ga0068859_1000266442 200
307 3300005617 Ga0068859_101337531 Ga0068859_1013375311 200
308 3300005618 Ga0068864_100001428 Ga0068864_1000014282 200
309 3300005718 Ga0068866_10001483 Ga0068866_1000148312 200
310 3300005719 Ga0068861_100000426 Ga0068861_10000042610 200
311 3300005719 Ga0068861_100317967 Ga0068861_1003179672 200
312 3300005834 Ga0068851_10063663 Ga0068851_100636632 200
313 3300005834 Ga0068851_10282498 Ga0068851_102824982 200
314 3300005840 Ga0068870_10173438 Ga0068870_101734382 200
315 3300005841 Ga0068863_100001953 Ga0068863_1000019537 200
316 3300005841 Ga0068863_100162558 Ga0068863_1001625583 200
317 3300005841 Ga0068863_100359631 Ga0068863_1003596311 200
318 3300005842 Ga0068858_100001000 Ga0068858_10000100013 200
319 3300005842 Ga0068858_100789672 Ga0068858_1007896722 200
320 3300005843 Ga0068860_100001048 Ga0068860_10000104825 200
321 3300005843 Ga0068860_100074490 Ga0068860_1000744903 200
322 3300005843 Ga0068860_100217624 Ga0068860_1002176242 200
323 3300005844 Ga0068862_100005035 Ga0068862_1000050356 200
324 3300005844 Ga0068862_100482282 Ga0068862_1004822822 200
325 3300006058 Ga0075432_10037521 Ga0075432_100375211 200
326 3300006195 Ga0075366_10225245 Ga0075366_102252452 200
327 3300006237 Ga0097621_100026552 Ga0097621_1000265522 200
328 3300006358 Ga0068871_100604616 Ga0068871_1006046162 200
329 3300006844 Ga0075428_100025930 Ga0075428_1000259303 200
330 3300006852 Ga0075433_10530058 Ga0075433_105300582 200
331 3300006881 Ga0068865_100002225 Ga0068865_10000222512 200
332 3300006881 Ga0068865_100313460 Ga0068865_1003134602 200
333 3300006931 Ga0097620_100026645 Ga0097620_1000266456 200
334 3300006931 Ga0097620_101337223 Ga0097620_1013372231 200
335 3300007265 Ga0099794_10002719 Ga0099794_100027192 200
336 3300009094 Ga0111539_10000275 Ga0111539_1000027520 200
337 3300009094 Ga0111539_10366001 Ga0111539_103660012 200
338 3300009147 Ga0114129_10264738 Ga0114129_102647381 200
339 3300009147 Ga0114129_10795816 Ga0114129_107958162 200
340 3300009148 Ga0105243_10179075 Ga0105243_101790752 200
341 3300009148 Ga0105243_10606175 Ga0105243_106061752 200
342 3300009545 Ga0105237_10076521 Ga0105237_100765212 200
343 3300010375 Ga0105239_10076828 Ga0105239_100768283 200
344 3300013296 Ga0157374_10132805 Ga0157374_101328052 200
345 3300013297 Ga0157378_10231683 Ga0157378_102316832 200
346 3300013306 Ga0163162_10063807 Ga0163162_100638072 200
347 3300013306 Ga0163162_10583511 Ga0163162_105835112 200
348 3300013306 Ga0163162_11196484 Ga0163162_111964842 200
349 3300013308 Ga0157375_10002055 Ga0157375_1000205510 200
350 3300013308 Ga0157375_10002541 Ga0157375_1000254110 200
351 3300013308 Ga0157375_10016354 Ga0157375_100163545 200
352 3300013308 Ga0157375_10150354 Ga0157375_101503542 200
353 3300014325 Ga0163163_10028522 Ga0163163_100285223 200
354 3300014326 Ga0157380_10001799 Ga0157380_1000179911 200
355 3300014326 Ga0157380_10324419 Ga0157380_103244192 200
356 3300014745 Ga0157377_10333822 Ga0157377_103338222 200
357 3300014968 Ga0157379_10003578 Ga0157379_1000357812 200
358 3300014968 Ga0157379_10051980 Ga0157379_100519801 200
359 3300014969 Ga0157376_10011472 Ga0157376_100114722 200
360 3300014969 Ga0157376_10414817 Ga0157376_104148172 200
361 3300017792 Ga0163161_10020557 Ga0163161_100205575 200
362 3300025315 Ga0207697_10032724 Ga0207697_100327243 200
363 3300025321 Ga0207656_10157806 Ga0207656_101578062 200
364 3300025893 Ga0207682_10030239 Ga0207682_100302393 200
365 3300025893 Ga0207682_10057582 Ga0207682_100575822 200
366 3300025899 Ga0207642_10001183 Ga0207642_100011839 200
367 3300025903 Ga0207680_10002952 Ga0207680_100029523 200
368 3300025903 Ga0207680_10097218 Ga0207680_100972182 200
369 3300025907 Ga0207645_10002094 Ga0207645_100020949 200
370 3300025907 Ga0207645_10074227 Ga0207645_100742273 200
371 3300025912 Ga0207707_10044769 Ga0207707_100447692 200
372 3300025918 Ga0207662_10011160 Ga0207662_100111602 200
373 3300025918 Ga0207662_10132734 Ga0207662_101327342 200
374 3300025919 Ga0207657_10384418 Ga0207657_103844182 200
375 3300025921 Ga0207652_10300546 Ga0207652_103005462 200
376 3300025923 Ga0207681_10000308 Ga0207681_1000030814 200
377 3300025923 Ga0207681_10140066 Ga0207681_101400662 200
378 3300025923 Ga0207681_10147949 Ga0207681_101479493 200
379 3300025923 Ga0207681_10352707 Ga0207681_103527072 200
380 3300025924 Ga0207694_10179720 Ga0207694_101797202 200
381 3300025925 Ga0207650_10001008 Ga0207650_1000100812 200
382 3300025925 Ga0207650_10002178 Ga0207650_100021782 200
383 3300025926 Ga0207659_10012776 Ga0207659_100127762 200
384 3300025927 Ga0207687_10255921 Ga0207687_102559212 200
385 3300025931 Ga0207644_10053943 Ga0207644_100539433 200
386 3300025931 Ga0207644_10173294 Ga0207644_101732942 200
387 3300025931 Ga0207644_10241897 Ga0207644_102418972 200
388 3300025932 Ga0207690_10351389 Ga0207690_103513892 200
389 3300025933 Ga0207706_10004526 Ga0207706_1000452612 200
390 3300025933 Ga0207706_10008475 Ga0207706_100084755 200
391 3300025933 Ga0207706_10224056 Ga0207706_102240562 200
392 3300025933 Ga0207706_10279851 Ga0207706_102798512 200
393 3300025934 Ga0207686_10111659 Ga0207686_101116592 200
394 3300025935 Ga0207709_10004196 Ga0207709_100041967 200
395 3300025937 Ga0207669_10000725 Ga0207669_100007259 200
396 3300025938 Ga0207704_10001008 Ga0207704_100010087 200
397 3300025938 Ga0207704_10148057 Ga0207704_101480572 200
398 3300025938 Ga0207704_10227583 Ga0207704_102275832 200
399 3300025938 Ga0207704_10860757 Ga0207704_108607572 200
400 3300025939 Ga0207665_10017636 Ga0207665_100176366 200
401 3300025940 Ga0207691_10002582 Ga0207691_1000258210 200
402 3300025940 Ga0207691_10075309 Ga0207691_100753093 200
403 3300025940 Ga0207691_10085414 Ga0207691_100854142 200
404 3300025940 Ga0207691_10119482 Ga0207691_101194822 200
405 3300025940 Ga0207691_10211435 Ga0207691_102114352 200
406 3300025942 Ga0207689_10002808 Ga0207689_1000280814 200
407 3300025945 Ga0207679_10305939 Ga0207679_103059391 200
408 3300025949 Ga0207667_10115988 Ga0207667_101159883 200
409 3300025960 Ga0207651_10147543 Ga0207651_101475432 200
410 3300025960 Ga0207651_10291583 Ga0207651_102915832 200
411 3300025961 Ga0207712_10012095 Ga0207712_100120955 200
412 3300025972 Ga0207668_10071966 Ga0207668_100719662 200
413 3300025981 Ga0207640_10060522 Ga0207640_100605222 200
414 3300025986 Ga0207658_10001166 Ga0207658_1000116611 200
415 3300025986 Ga0207658_10111477 Ga0207658_101114772 200
416 3300025986 Ga0207658_10364220 Ga0207658_103642202 200
417 3300026023 Ga0207677_11049029 Ga0207677_110490291 200
418 3300026035 Ga0207703_10000414 Ga0207703_1000041423 200
419 3300026088 Ga0207641_10000615 Ga0207641_1000061535 200
420 3300026088 Ga0207641_10333183 Ga0207641_103331832 200
421 3300026089 Ga0207648_10001283 Ga0207648_1000128322 200
422 3300026089 Ga0207648_10048979 Ga0207648_100489793 200
423 3300026089 Ga0207648_10241859 Ga0207648_102418592 200
424 3300026089 Ga0207648_10421466 Ga0207648_104214662 200
425 3300026089 Ga0207648_10780704 Ga0207648_107807041 200
426 3300026095 Ga0207676_10016903 Ga0207676_100169035 200
427 3300026095 Ga0207676_10025075 Ga0207676_100250751 200
428 3300026116 Ga0207674_10182374 Ga0207674_101823741 200
429 3300026116 Ga0207674_10719175 Ga0207674_107191751 200
430 3300026118 Ga0207675_100002985 Ga0207675_10000298511 200
431 3300026118 Ga0207675_100078237 Ga0207675_1000782373 200
432 3300026118 Ga0207675_100138013 Ga0207675_1001380132 200
433 3300026121 Ga0207683_10169405 Ga0207683_101694051 200
434 3300026142 Ga0207698_10004887 Ga0207698_100048878 200
435 3300026142 Ga0207698_10022022 Ga0207698_100220224 200
436 3300026142 Ga0207698_10080048 Ga0207698_100800482 200
437 3300027462 Ga0210000_1001718 Ga0210000_10017182 200
438 3300027543 Ga0209999_1000757 Ga0209999_10007575 200
439 3300027671 Ga0209588_1021796 Ga0209588_10217962 200
440 3300027907 Ga0207428_10004772 Ga0207428_100047727 200
441 3300028380 Ga0268265_10002595 Ga0268265_100025956 200
442 3300028380 Ga0268265_10301381 Ga0268265_103013811 200
443 3300028381 Ga0268264_10000780 Ga0268264_1000078016 200
444 3300028381 Ga0268264_10062845 Ga0268264_100628454 200
445 3300028381 Ga0268264_10102221 Ga0268264_101022213 200
446 3300031548 Ga0307408_100040891 Ga0307408_1000408913 200
447 3300031731 Ga0307405_10090200 Ga0307405_100902001 200
448 3300031903 Ga0307407_10093160 Ga0307407_100931602 200
449 3300031911 Ga0307412_10439178 Ga0307412_104391782 200
450 3300031995 Ga0307409_100103265 Ga0307409_1001032651 200
451 3300032002 Ga0307416_100001193 Ga0307416_10000119311 200
452 3300032002 Ga0307416_100171118 Ga0307416_1001711183 200
453 3300032005 Ga0307411_10011045 Ga0307411_100110453 200
454 3300032126 Ga0307415_100001120 Ga0307415_1000011204 200
455 3300035090 Ga0373949_0044485 Ga0373949_0044485_82_684 200
456 3300035115 Ga0373941_0160003 Ga0373941_0160003_193_798 200
457 3300035172 Ga0373955_0021268 Ga0373955_0021268_1696_2331 200
458 3300035172 Ga0373955_0127423 Ga0373955_0127423_275_961 200
459 3300035207 Ga0373942_0030852 Ga0373942_0030852_469_1071 200
460 3300035410 Ga0373924_0024407 Ga0373924_0024407_60_746 200
461 3300035691 Ga0373931_0001530 Ga0373931_0001530_8946_9548 200
462 3300035692 Ga0373935_0150814 Ga0373935_0150814_453_1139 200
463 3300035695 Ga0373927_0095432 Ga0373927_0095432_916_1602 200
464 3300035725 Ga0373947_0064888 Ga0373947_0064888_1108_1743 200
465 3300036401 Ga0373937_0038192 Ga0373937_0038192_3246_3881 200
466 3300036401 Ga0373937_0097813 Ga0373937_0097813_1483_2169 200
467 3300036401 Ga0373937_0413168 Ga0373937_0413168_21_650 200
468 3300041512 Ga0451853_1783048 Ga0451853_1783048_1210_1845 200
469 3300045051 Ga0451576_0258777 Ga0451576_0258777_645_1250 200
470 3300046459 Ga0495629_0159074 Ga0495629_0159074_324_959 200
471 3300046461 Ga0495641_0126388 Ga0495641_0126388_281_916 200
472 3300046462 Ga0495651_0399200 Ga0495651_0399200_201_836 200
473 3300046472 Ga0495580_0156721 Ga0495580_0156721_926_1561 200
474 3300046472 Ga0495580_0315555 Ga0495580_0315555_284_889 200
475 3300046492 Ga0495585_0372991 Ga0495585_0372991_35_637 200
476 3300046516 Ga0495628_0153973 Ga0495628_0153973_202_888 200
477 3300046525 Ga0495663_0063229 Ga0495663_0063229_462_1064 200
478 3300046535 Ga0495586_0127151 Ga0495586_0127151_70_756 200
479 3300046543 Ga0495645_0032857 Ga0495645_0032857_34_669 200
480 3300046615 Ga0495656_0056435 Ga0495656_0056435_761_1363 200
481 3300046663 Ga0495635_0057299 Ga0495635_0057299_183_818 200
482 3300046675 Ga0495657_0445751 Ga0495657_0445751_64_699 200
483 3300046683 Ga0495658_0017020 Ga0495658_0017020_1347_2033 200
484 3300047319 Ga0495674_0134010 Ga0495674_0134010_391_1026 200
485 3300047322 Ga0495680_0053172 Ga0495680_0053172_2157_2792 200
486 3300047471 Ga0495684_0026078 Ga0495684_0026078_3578_4264 200
487 3300048905 Ga0496102_0008252 Ga0496102_0008252_3712_4314 200
488 3300048906 Ga0496103_0092684 Ga0496103_0092684_376_978 200
489 3300048909 Ga0496106_0283417 Ga0496106_0283417_211_813 200
490 3300049568 Ga0501031_0048841 Ga0501031_0048841_771_1511 200
491 3300049569 Ga0501032_0065492 Ga0501032_0065492_206_946 200
492 3300049570 Ga0501033_0004048 Ga0501033_0004048_10734_11474 200
493 3300049571 Ga0501034_0000406 Ga0501034_0000406_1014_1619 200
494 3300049571 Ga0501034_0002174 Ga0501034_0002174_11957_12562 200
495 3300049572 Ga0501036_0011077 Ga0501036_0011077_5358_6098 200
496 3300049573 Ga0501037_0023042 Ga0501037_0023042_1152_1892 200
497 3300049574 Ga0501038_0000668 Ga0501038_0000668_6191_6931 200
498 3300049575 Ga0501039_0007014 Ga0501039_0007014_4087_4827 200
499 3300049576 Ga0501040_0002705 Ga0501040_0002705_9481_10221 200
500 3300049576 Ga0501040_0037480 Ga0501040_0037480_1184_1786 200
501 3300049576 Ga0501040_0225807 Ga0501040_0225807_218_841 200
502 3300049577 Ga0501041_0000098 Ga0501041_0000098_32626_33366 200
503 3300049577 Ga0501041_0081699 Ga0501041_0081699_716_1318 200
504 3300049578 Ga0501042_0000242 Ga0501042_0000242_18434_19174 200
505 3300049578 Ga0501042_0112725 Ga0501042_0112725_99_701 200
506 3300049578 Ga0501042_0178129 Ga0501042_0178129_349_954 200
507 3300049579 Ga0501043_0101839 Ga0501043_0101839_1247_1987 200
508 3300049580 Ga0501046_0000144 Ga0501046_0000144_52193_52933 200
509 3300049581 Ga0501047_0157730 Ga0501047_0157730_1020_1760 200
510 3300049582 Ga0501048_0008341 Ga0501048_0008341_6944_7684 200
511 3300049583 Ga0501067_0124185 Ga0501067_0124185_751_1362 200
512 3300049584 Ga0501068_0005592 Ga0501068_0005592_2825_3436 200
513 3300049584 Ga0501068_0018055 Ga0501068_0018055_1124_1864 200
514 3300049586 Ga0501070_0058828 Ga0501070_0058828_1562_2173 200
515 3300049586 Ga0501070_0074020 Ga0501070_0074020_734_1474 200
516 3300049587 Ga0501071_0006755 Ga0501071_0006755_2968_3708 200
517 3300049588 Ga0501072_0001347 Ga0501072_0001347_7502_8107 200
518 3300049588 Ga0501072_0054971 Ga0501072_0054971_352_957 200
519 3300049589 Ga0501073_0032995 Ga0501073_0032995_2404_3015 200
520 3300049590 Ga0501074_0063744 Ga0501074_0063744_1124_1864 200
521 3300049590 Ga0501074_0433471 Ga0501074_0433471_63_674 200
522 3300049590 Ga0501074_0512083 Ga0501074_0512083_216_827 200
523 3300049591 Ga0501075_0000101 Ga0501075_0000101_2189_2929 200
524 3300049591 Ga0501075_0017493 Ga0501075_0017493_2367_2969 200
525 3300049591 Ga0501075_0018641 Ga0501075_0018641_1120_1725 200
526 3300049592 Ga0501076_0035324 Ga0501076_0035324_1593_2333 200
527 3300049592 Ga0501076_0160853 Ga0501076_0160853_537_1139 200
528 3300049592 Ga0501076_0170270 Ga0501076_0170270_198_803 200
529 3300049592 Ga0501076_0174084 Ga0501076_0174084_562_1167 200
530 3300049593 Ga0501077_0000994 Ga0501077_0000994_658_1398 200
531 3300049593 Ga0501077_0020557 Ga0501077_0020557_441_1043 200
532 3300049741 Ga0501079_0000459 Ga0501079_0000459_466_1206 200
533 3300049741 Ga0501079_0011265 Ga0501079_0011265_4209_4811 200
534 3300049742 Ga0501080_0042174 Ga0501080_0042174_3465_4076 200
535 3300049742 Ga0501080_0044844 Ga0501080_0044844_2703_3443 200
536 3300049742 Ga0501080_0086996 Ga0501080_0086996_2019_2621 200
537 3300049743 Ga0501081_0000680 Ga0501081_0000680_4967_5707 200
538 3300049743 Ga0501081_0002406 Ga0501081_0002406_3925_4527 200
539 3300049744 Ga0501083_0197124 Ga0501083_0197124_621_1226 200
540 3300049822 Ga0501035_0080030 Ga0501035_0080030_1690_2430 200
541 3300049824 Ga0501045_0002526 Ga0501045_0002526_10767_11507 200
542 3300049824 Ga0501045_0092703 Ga0501045_0092703_317_922 200
543 3300050511 nmdc:mga08y16_124755_c1 nmdc:mga08y16_124755_c1_1765_2367 200
544 3300050511 nmdc:mga08y16_183697_c1 nmdc:mga08y16_183697_c1_743_1381 200
545 3300050514 nmdc:mga08x19_22243_c1 nmdc:mga08x19_22243_c1_979_1626 200
546 3300050515 nmdc:mga0a205_538952_c1 nmdc:mga0a205_538952_c1_246_851 200
547 3300053077 Ga0495601_0042566 Ga0495601_0042566_1511_2197 200
548 3300053077 Ga0495601_0141193 Ga0495601_0141193_406_1041 200
549 3300053078 Ga0495612_0027102 Ga0495612_0027102_393_1079 200
550 3300053084 Ga0495595_0071075 Ga0495595_0071075_22_657 200
551 3300053085 Ga0495619_0075349 Ga0495619_0075349_1480_2166 200
552 3300054114 Ga0501084_0053651 Ga0501084_0053651_593_1333 200
553 3300060353 Ga0501082_0024634 Ga0501082_0024634_620_1360 200
554 3300060353 Ga0501082_0389290 Ga0501082_0389290_544_1146 200
555 3300061734 Ga0530510_0000221 Ga0530510_0000221_18704_19444 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

80

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eg5-assembly1.cif.gz_B fmn-bound form of yvic from lactococcus lactis subsp. lactis il1403 0.8295 37 152
1flm-assembly1.cif.gz_B dimer of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8191 49 152
3amf-assembly1.cif.gz_B e13r mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8183 36 152
3awh-assembly1.cif.gz_B e13k mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8176 36 152
2e83-assembly1.cif.gz_B t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f) 0.8163 36 152
ID Description Score Start End Superfamily
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8143 42 152 2.30.110.10
af_Q57730_15_149_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7928 36 150 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7826 36 152 2.30.110.10
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.779 33 149 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7657 36 152 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3N5H7Z0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9815 3 199
AF-A0A433B166-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.981 7 192
AF-A0A538DHM8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.977 6 196
AF-A0A7W1DYC8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9769 6 196
AF-A0A536U4P0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9764 4 199

Feature Viewer

pLDDT pTM Quality
91.34 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map