F463147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 270 | 548 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300047319|Ga0495674_0224639|Ga0495674_0224639_612_1307 |
| Length | 231 |
| Sequence | MSPADRPFCGIRTVLLWLKVHMPLHESTEQVPAQVDFWFDPICPWAWITSRWILEVQKVRPVNITWHVMSLSVLNEDKDDLPEQYRELLQTGWGPVRVLIAAEQAHGPEVLGPLYTALGTRFHHEKAPRDRETIEAALAEAGLPAHLADAMDSTDYDAALRASHTEGIERVGYDVGTPVITVNGLSVFGPVVSPIPRGEAAARLWDGVLLIAGTEGFFELKRSRTRDPIFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 3 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 4 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 5 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 6 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 99 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 269 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 270 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.22 |
| Metatranscriptomes | 2.52 |
| Isolates | 1.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 2.88 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10026532 | 3300003373 | Bacteria | 1503 |
| 2 | Ga0070658_10001528 | 3300005327 | Bacteria | 19605 |
| 3 | Ga0070683_100167911 | 3300005329 | Bacteria | 2082 |
| 4 | Ga0070683_100295778 | 3300005329 | Bacteria | 1540 |
| 5 | Ga0068869_100531595 | 3300005334 | Bacteria | 985 |
| 6 | Ga0070666_10052573 | 3300005335 | Bacteria | 2745 |
| 7 | Ga0070680_100001058 | 3300005336 | Bacteria | 19716 |
| 8 | Ga0070680_100289755 | 3300005336 | Bacteria | 1387 |
| 9 | Ga0070660_100080911 | 3300005339 | Bacteria | 2550 |
| 10 | Ga0070689_100230671 | 3300005340 | Bacteria | 1522 |
| 11 | Ga0070661_100071147 | 3300005344 | Bacteria | 2559 |
| 12 | Ga0070668_100020039 | 3300005347 | Bacteria | 5043 |
| 13 | Ga0070675_100351684 | 3300005354 | Bacteria | 1307 |
| 14 | Ga0070671_100136093 | 3300005355 | Bacteria | 2071 |
| 15 | Ga0070674_100691619 | 3300005356 | Bacteria | 871 |
| 16 | Ga0070673_100009103 | 3300005364 | Bacteria | 6648 |
| 17 | Ga0070659_100050830 | 3300005366 | Bacteria | 3258 |
| 18 | Ga0070659_100909453 | 3300005366 | Bacteria | 769 |
| 19 | Ga0070667_100035056 | 3300005367 | Bacteria | 4202 |
| 20 | Ga0070709_10026042 | 3300005434 | Bacteria | 3461 |
| 21 | Ga0070709_10086653 | 3300005434 | Bacteria | 2056 |
| 22 | Ga0070709_10323509 | 3300005434 | Bacteria | 1132 |
| 23 | Ga0070714_100000680 | 3300005435 | Bacteria | 23985 |
| 24 | Ga0070714_100026874 | 3300005435 | Bacteria | 4760 |
| 25 | Ga0070714_100032593 | 3300005435 | Bacteria | 4351 |
| 26 | Ga0070714_100036291 | 3300005435 | Bacteria | 4133 |
| 27 | Ga0070714_100081330 | 3300005435 | Bacteria | 2820 |
| 28 | Ga0070714_100114789 | 3300005435 | Bacteria | 2389 |
| 29 | Ga0070714_100139918 | 3300005435 | Bacteria | 2171 |
| 30 | Ga0070714_100251036 | 3300005435 | Bacteria | 1636 |
| 31 | Ga0070714_100372699 | 3300005435 | Bacteria | 1344 |
| 32 | Ga0070714_100482789 | 3300005435 | Bacteria | 1180 |
| 33 | Ga0070713_100653507 | 3300005436 | Bacteria | 1001 |
| 34 | Ga0070713_100819485 | 3300005436 | Bacteria | 893 |
| 35 | Ga0070710_10012246 | 3300005437 | Bacteria | 4254 |
| 36 | Ga0070710_10062119 | 3300005437 | Bacteria | 2129 |
| 37 | Ga0070710_10066666 | 3300005437 | Bacteria | 2064 |
| 38 | Ga0070710_10288758 | 3300005437 | Bacteria | 1067 |
| 39 | Ga0070710_10363940 | 3300005437 | Bacteria | 960 |
| 40 | Ga0070710_10490162 | 3300005437 | Bacteria | 840 |
| 41 | Ga0070701_10079588 | 3300005438 | Bacteria | 1771 |
| 42 | Ga0070711_100039417 | 3300005439 | Bacteria | 3182 |
| 43 | Ga0070711_100051486 | 3300005439 | Bacteria | 2828 |
| 44 | Ga0070711_100446953 | 3300005439 | Bacteria | 1057 |
| 45 | Ga0070711_100448734 | 3300005439 | Bacteria | 1055 |
| 46 | Ga0070700_100461514 | 3300005441 | Bacteria | 969 |
| 47 | Ga0070708_100059206 | 3300005445 | Bacteria | 3414 |
| 48 | Ga0070708_100100957 | 3300005445 | Bacteria | 2641 |
| 49 | Ga0070708_100623903 | 3300005445 | Bacteria | 1016 |
| 50 | Ga0070681_10006754 | 3300005458 | Bacteria | 11166 |
| 51 | Ga0070681_10393932 | 3300005458 | Bacteria | 1296 |
| 52 | Ga0070706_100003775 | 3300005467 | Bacteria | 14784 |
| 53 | Ga0070706_100006621 | 3300005467 | Bacteria | 10928 |
| 54 | Ga0070706_100008872 | 3300005467 | Bacteria | 9365 |
| 55 | Ga0070706_100013498 | 3300005467 | Bacteria | 7556 |
| 56 | Ga0070706_100017317 | 3300005467 | Bacteria | 6650 |
| 57 | Ga0070706_100051472 | 3300005467 | Bacteria | 3801 |
| 58 | Ga0070706_100054929 | 3300005467 | Bacteria | 3676 |
| 59 | Ga0070706_100073303 | 3300005467 | Bacteria | 3169 |
| 60 | Ga0070706_100127734 | 3300005467 | Bacteria | 2371 |
| 61 | Ga0070706_100253261 | 3300005467 | Bacteria | 1644 |
| 62 | Ga0070707_100000099 | 3300005468 | Bacteria | 78915 |
| 63 | Ga0070707_100059424 | 3300005468 | Bacteria | 3668 |
| 64 | Ga0070707_100070467 | 3300005468 | Bacteria | 3367 |
| 65 | Ga0070707_100114435 | 3300005468 | Bacteria | 2617 |
| 66 | Ga0070707_100245641 | 3300005468 | Bacteria | 1742 |
| 67 | Ga0070707_100302217 | 3300005468 | Bacteria | 1555 |
| 68 | Ga0070698_100000057 | 3300005471 | Bacteria | 79148 |
| 69 | Ga0070698_100001403 | 3300005471 | Bacteria | 26681 |
| 70 | Ga0070698_100003947 | 3300005471 | Bacteria | 16312 |
| 71 | Ga0070698_100016931 | 3300005471 | Bacteria | 7685 |
| 72 | Ga0070698_100028229 | 3300005471 | Bacteria | 5830 |
| 73 | Ga0070698_100051939 | 3300005471 | Bacteria | 4173 |
| 74 | Ga0070698_100060560 | 3300005471 | Bacteria | 3821 |
| 75 | Ga0070698_100303289 | 3300005471 | Bacteria | 1528 |
| 76 | Ga0070698_100401080 | 3300005471 | Bacteria | 1305 |
| 77 | Ga0070699_100015608 | 3300005518 | Bacteria | 6524 |
| 78 | Ga0070699_100051463 | 3300005518 | Bacteria | 3565 |
| 79 | Ga0070699_100093494 | 3300005518 | Bacteria | 2631 |
| 80 | Ga0070699_100402984 | 3300005518 | Bacteria | 1237 |
| 81 | Ga0070679_100005432 | 3300005530 | Bacteria | 11812 |
| 82 | Ga0070679_100024438 | 3300005530 | Bacteria | 5920 |
| 83 | Ga0070679_100240106 | 3300005530 | Bacteria | 1769 |
| 84 | Ga0070679_100273502 | 3300005530 | Bacteria | 1643 |
| 85 | Ga0070684_100127264 | 3300005535 | Bacteria | 2295 |
| 86 | Ga0070684_100148588 | 3300005535 | Bacteria | 2122 |
| 87 | Ga0070684_100222133 | 3300005535 | Bacteria | 1723 |
| 88 | Ga0070684_100345606 | 3300005535 | Bacteria | 1368 |
| 89 | Ga0070697_100175535 | 3300005536 | Bacteria | 1815 |
| 90 | Ga0070697_100507800 | 3300005536 | Bacteria | 1055 |
| 91 | Ga0070697_100709780 | 3300005536 | Bacteria | 887 |
| 92 | Ga0068853_100366198 | 3300005539 | Bacteria | 1344 |
| 93 | Ga0070686_100056200 | 3300005544 | Bacteria | 2523 |
| 94 | Ga0070695_100360551 | 3300005545 | Bacteria | 1091 |
| 95 | Ga0070696_100055182 | 3300005546 | Bacteria | 2770 |
| 96 | Ga0070693_100009277 | 3300005547 | Bacteria | 4888 |
| 97 | Ga0070665_100238015 | 3300005548 | Bacteria | 1821 |
| 98 | Ga0068855_100009145 | 3300005563 | Bacteria | 11966 |
| 99 | Ga0068855_100494964 | 3300005563 | Bacteria | 1329 |
| 100 | Ga0068855_100793321 | 3300005563 | Bacteria | 1007 |
| 101 | Ga0070664_100304669 | 3300005564 | Bacteria | 1440 |
| 102 | Ga0070664_100608682 | 3300005564 | Bacteria | 1013 |
| 103 | Ga0068857_100142186 | 3300005577 | Bacteria | 2169 |
| 104 | Ga0068857_100176265 | 3300005577 | Bacteria | 1945 |
| 105 | Ga0068857_100518665 | 3300005577 | Bacteria | 1120 |
| 106 | Ga0068857_101045423 | 3300005577 | Bacteria | 787 |
| 107 | Ga0068854_100026554 | 3300005578 | Bacteria | 3981 |
| 108 | Ga0068856_100048503 | 3300005614 | Bacteria | 4186 |
| 109 | Ga0068856_100461196 | 3300005614 | Bacteria | 1291 |
| 110 | Ga0068856_100531143 | 3300005614 | Bacteria | 1197 |
| 111 | Ga0068856_100756805 | 3300005614 | Bacteria | 991 |
| 112 | Ga0070702_100025172 | 3300005615 | Bacteria | 3185 |
| 113 | Ga0068852_100461552 | 3300005616 | Bacteria | 1259 |
| 114 | Ga0068859_100148275 | 3300005617 | Bacteria | 2421 |
| 115 | Ga0068859_101155805 | 3300005617 | Bacteria | 852 |
| 116 | Ga0068864_100160392 | 3300005618 | Bacteria | 2044 |
| 117 | Ga0068861_100175120 | 3300005719 | Bacteria | 1781 |
| 118 | Ga0068870_10139598 | 3300005840 | Bacteria | 1417 |
| 119 | Ga0068863_100041127 | 3300005841 | Bacteria | 4394 |
| 120 | Ga0068863_100274159 | 3300005841 | Bacteria | 1633 |
| 121 | Ga0068863_100389488 | 3300005841 | Bacteria | 1362 |
| 122 | Ga0068863_100497111 | 3300005841 | Bacteria | 1201 |
| 123 | Ga0068858_100115674 | 3300005842 | Bacteria | 2506 |
| 124 | Ga0068860_100275370 | 3300005843 | Bacteria | 1643 |
| 125 | Ga0068862_100117793 | 3300005844 | Bacteria | 2338 |
| 126 | Ga0081455_10000298 | 3300005937 | Bacteria | 65765 |
| 127 | Ga0081455_10004995 | 3300005937 | Bacteria | 14669 |
| 128 | Ga0081538_10000172 | 3300005981 | Bacteria | 69506 |
| 129 | Ga0070717_10105387 | 3300006028 | Bacteria | 2400 |
| 130 | Ga0070717_10153398 | 3300006028 | Bacteria | 1994 |
| 131 | Ga0070717_10174006 | 3300006028 | Bacteria | 1873 |
| 132 | Ga0070717_10224206 | 3300006028 | Bacteria | 1653 |
| 133 | Ga0070717_10781022 | 3300006028 | Bacteria | 869 |
| 134 | Ga0070715_10006535 | 3300006163 | Bacteria | 3971 |
| 135 | Ga0070715_10081417 | 3300006163 | Bacteria | 1470 |
| 136 | Ga0070715_10085910 | 3300006163 | Bacteria | 1438 |
| 137 | Ga0070715_10208928 | 3300006163 | Bacteria | 996 |
| 138 | Ga0070716_100013454 | 3300006173 | Bacteria | 4170 |
| 139 | Ga0070716_100061224 | 3300006173 | Bacteria | 2177 |
| 140 | Ga0070716_100075502 | 3300006173 | Bacteria | 1995 |
| 141 | Ga0070712_100066264 | 3300006175 | Bacteria | 2566 |
| 142 | Ga0070712_100099106 | 3300006175 | Bacteria | 2150 |
| 143 | Ga0070712_100252327 | 3300006175 | Bacteria | 1410 |
| 144 | Ga0070712_100421388 | 3300006175 | Bacteria | 1106 |
| 145 | Ga0097621_100253610 | 3300006237 | Bacteria | 1541 |
| 146 | Ga0068871_100390481 | 3300006358 | Bacteria | 1238 |
| 147 | Ga0075430_100066567 | 3300006846 | Bacteria | 3025 |
| 148 | Ga0075431_100001963 | 3300006847 | Bacteria | 19621 |
| 149 | Ga0075431_100021939 | 3300006847 | Bacteria | 6528 |
| 150 | Ga0075434_100103207 | 3300006871 | Bacteria | 2859 |
| 151 | Ga0075434_100290148 | 3300006871 | Bacteria | 1656 |
| 152 | Ga0075429_100011256 | 3300006880 | Bacteria | 7742 |
| 153 | Ga0068865_100077337 | 3300006881 | Bacteria | 2378 |
| 154 | Ga0075436_100138665 | 3300006914 | Bacteria | 1708 |
| 155 | Ga0075436_100273009 | 3300006914 | Bacteria | 1208 |
| 156 | Ga0097620_100148275 | 3300006931 | Bacteria | 2421 |
| 157 | Ga0097620_101156164 | 3300006931 | Bacteria | 852 |
| 158 | Ga0075435_100840634 | 3300007076 | Bacteria | 800 |
| 159 | Ga0099794_10102355 | 3300007265 | Bacteria | 1430 |
| 160 | Ga0105251_10053999 | 3300009011 | Bacteria | 1909 |
| 161 | Ga0105240_10006823 | 3300009093 | Bacteria | 16700 |
| 162 | Ga0105240_10331744 | 3300009093 | Bacteria | 1731 |
| 163 | Ga0111539_10017115 | 3300009094 | Bacteria | 8973 |
| 164 | Ga0105245_10022733 | 3300009098 | Bacteria | 5503 |
| 165 | Ga0105247_10110550 | 3300009101 | Bacteria | 1768 |
| 166 | Ga0114129_10214373 | 3300009147 | Bacteria | 2601 |
| 167 | Ga0105242_10118796 | 3300009176 | Bacteria | 2265 |
| 168 | Ga0105249_10497062 | 3300009553 | Bacteria | 1264 |
| 169 | Ga0099796_10224783 | 3300010159 | Bacteria | 770 |
| 170 | Ga0105239_10642627 | 3300010375 | Bacteria | 1212 |
| 171 | Ga0105246_10023695 | 3300011119 | Bacteria | 3975 |
| 172 | Ga0157370_10030913 | 3300013104 | Bacteria | 5245 |
| 173 | Ga0157370_10361866 | 3300013104 | Bacteria | 1337 |
| 174 | Ga0157370_10478468 | 3300013104 | Bacteria | 1144 |
| 175 | Ga0157370_10707181 | 3300013104 | Bacteria | 920 |
| 176 | Ga0157369_10032231 | 3300013105 | Bacteria | 5764 |
| 177 | Ga0157369_10305829 | 3300013105 | Bacteria | 1654 |
| 178 | Ga0157369_10688078 | 3300013105 | Bacteria | 1053 |
| 179 | Ga0157374_10047464 | 3300013296 | Bacteria | 3982 |
| 180 | Ga0163162_10240209 | 3300013306 | Bacteria | 1942 |
| 181 | Ga0157372_10426469 | 3300013307 | Bacteria | 1546 |
| 182 | Ga0157372_11232780 | 3300013307 | Bacteria | 864 |
| 183 | Ga0157375_10192017 | 3300013308 | Bacteria | 2197 |
| 184 | Ga0157375_10362289 | 3300013308 | Bacteria | 1616 |
| 185 | Ga0157375_11051676 | 3300013308 | Bacteria | 952 |
| 186 | Ga0163163_10097356 | 3300014325 | Bacteria | 2962 |
| 187 | Ga0163163_10222750 | 3300014325 | Bacteria | 1935 |
| 188 | Ga0163163_10326385 | 3300014325 | Bacteria | 1589 |
| 189 | Ga0157379_10003574 | 3300014968 | Bacteria | 13173 |
| 190 | Ga0157376_10030150 | 3300014969 | Bacteria | 4327 |
| 191 | Ga0206356_10079390 | 3300020070 | Bacteria | 703 |
| 192 | Ga0206356_10858152 | 3300020070 | Bacteria | 1965 |
| 193 | Ga0206355_1707556 | 3300020076 | Bacteria | 1064 |
| 194 | Ga0206351_10334080 | 3300020077 | Bacteria | 1461 |
| 195 | Ga0206354_11234884 | 3300020081 | Bacteria | 680 |
| 196 | Ga0206353_10353071 | 3300020082 | Bacteria | 34977 |
| 197 | Ga0206353_11049559 | 3300020082 | Bacteria | 1518 |
| 198 | Ga0213875_10002903 | 3300021388 | Bacteria | 10011 |
| 199 | Ga0213875_10003162 | 3300021388 | Bacteria | 9468 |
| 200 | Ga0213875_10005542 | 3300021388 | Bacteria | 6759 |
| 201 | Ga0213875_10011884 | 3300021388 | Bacteria | 4316 |
| 202 | Ga0224712_10013011 | 3300022467 | Bacteria | 2637 |
| 203 | Ga0224712_10075106 | 3300022467 | Bacteria | 1382 |
| 204 | Ga0224712_10084406 | 3300022467 | Bacteria | 1318 |
| 205 | Ga0224712_10203796 | 3300022467 | Bacteria | 900 |
| 206 | Ga0224712_10209247 | 3300022467 | Bacteria | 889 |
| 207 | Ga0224712_10214792 | 3300022467 | Bacteria | 878 |
| 208 | Ga0228600_1007971 | 3300024123 | Bacteria | 801 |
| 209 | Ga0207653_10002021 | 3300025885 | Bacteria | 6477 |
| 210 | Ga0207692_10002193 | 3300025898 | Bacteria | 7467 |
| 211 | Ga0207692_10184580 | 3300025898 | Bacteria | 1217 |
| 212 | Ga0207692_10265066 | 3300025898 | Bacteria | 1034 |
| 213 | Ga0207692_10289022 | 3300025898 | Bacteria | 994 |
| 214 | Ga0207692_10373979 | 3300025898 | Bacteria | 883 |
| 215 | Ga0207688_10005447 | 3300025901 | Bacteria | 6918 |
| 216 | Ga0207685_10022730 | 3300025905 | Bacteria | 2124 |
| 217 | Ga0207685_10199739 | 3300025905 | Bacteria | 938 |
| 218 | Ga0207685_10272829 | 3300025905 | Bacteria | 827 |
| 219 | Ga0207699_10004150 | 3300025906 | Bacteria | 6936 |
| 220 | Ga0207699_10005417 | 3300025906 | Bacteria | 6110 |
| 221 | Ga0207699_10053042 | 3300025906 | Bacteria | 2403 |
| 222 | Ga0207699_10069542 | 3300025906 | Bacteria | 2147 |
| 223 | Ga0207643_10030552 | 3300025908 | Bacteria | 2999 |
| 224 | Ga0207705_10002552 | 3300025909 | Bacteria | 13998 |
| 225 | Ga0207684_10007038 | 3300025910 | Bacteria | 10174 |
| 226 | Ga0207684_10028508 | 3300025910 | Bacteria | 4757 |
| 227 | Ga0207684_10030012 | 3300025910 | Bacteria | 4629 |
| 228 | Ga0207684_10081557 | 3300025910 | Bacteria | 2753 |
| 229 | Ga0207684_10081851 | 3300025910 | Bacteria | 2748 |
| 230 | Ga0207684_10092287 | 3300025910 | Bacteria | 2580 |
| 231 | Ga0207684_10206361 | 3300025910 | Bacteria | 1695 |
| 232 | Ga0207684_10234507 | 3300025910 | Bacteria | 1583 |
| 233 | Ga0207684_10291055 | 3300025910 | Bacteria | 1408 |
| 234 | Ga0207654_10305857 | 3300025911 | Bacteria | 1083 |
| 235 | Ga0207707_10001870 | 3300025912 | Bacteria | 19239 |
| 236 | Ga0207671_10108928 | 3300025914 | Bacteria | 2106 |
| 237 | Ga0207693_10001994 | 3300025915 | Bacteria | 17915 |
| 238 | Ga0207693_10040554 | 3300025915 | Bacteria | 3667 |
| 239 | Ga0207693_10131639 | 3300025915 | Bacteria | 1966 |
| 240 | Ga0207693_10137599 | 3300025915 | Bacteria | 1920 |
| 241 | Ga0207693_10189644 | 3300025915 | Bacteria | 1618 |
| 242 | Ga0207663_10019696 | 3300025916 | Bacteria | 3807 |
| 243 | Ga0207663_10181583 | 3300025916 | Bacteria | 1503 |
| 244 | Ga0207663_10197403 | 3300025916 | Bacteria | 1449 |
| 245 | Ga0207663_10294477 | 3300025916 | Bacteria | 1210 |
| 246 | Ga0207663_10368759 | 3300025916 | Bacteria | 1091 |
| 247 | Ga0207660_10000283 | 3300025917 | Bacteria | 33496 |
| 248 | Ga0207660_10191350 | 3300025917 | Bacteria | 1593 |
| 249 | Ga0207662_10004275 | 3300025918 | Bacteria | 7499 |
| 250 | Ga0207657_10022638 | 3300025919 | Bacteria | 5874 |
| 251 | Ga0207657_10115550 | 3300025919 | Bacteria | 2212 |
| 252 | Ga0207652_10000792 | 3300025921 | Bacteria | 30180 |
| 253 | Ga0207652_10119326 | 3300025921 | Bacteria | 2345 |
| 254 | Ga0207652_10292138 | 3300025921 | Bacteria | 1471 |
| 255 | Ga0207646_10020733 | 3300025922 | Bacteria | 6086 |
| 256 | Ga0207646_10023758 | 3300025922 | Bacteria | 5625 |
| 257 | Ga0207646_10050956 | 3300025922 | Bacteria | 3704 |
| 258 | Ga0207646_10158336 | 3300025922 | Bacteria | 2043 |
| 259 | Ga0207646_10186433 | 3300025922 | Bacteria | 1874 |
| 260 | Ga0207646_10192941 | 3300025922 | Bacteria | 1840 |
| 261 | Ga0207646_10245408 | 3300025922 | Bacteria | 1618 |
| 262 | Ga0207646_10509897 | 3300025922 | Bacteria | 1083 |
| 263 | Ga0207646_10594701 | 3300025922 | Bacteria | 993 |
| 264 | Ga0207687_10144697 | 3300025927 | Bacteria | 1807 |
| 265 | Ga0207700_10094684 | 3300025928 | Bacteria | 2367 |
| 266 | Ga0207700_10135247 | 3300025928 | Bacteria | 2018 |
| 267 | Ga0207700_10148282 | 3300025928 | Bacteria | 1936 |
| 268 | Ga0207700_10523692 | 3300025928 | Bacteria | 1051 |
| 269 | Ga0207700_10874514 | 3300025928 | Bacteria | 804 |
| 270 | Ga0207664_10001098 | 3300025929 | Bacteria | 18046 |
| 271 | Ga0207664_10029688 | 3300025929 | Bacteria | 4167 |
| 272 | Ga0207664_10075730 | 3300025929 | Bacteria | 2721 |
| 273 | Ga0207664_10083611 | 3300025929 | Bacteria | 2602 |
| 274 | Ga0207664_10098290 | 3300025929 | Bacteria | 2413 |
| 275 | Ga0207664_10113486 | 3300025929 | Bacteria | 2256 |
| 276 | Ga0207664_10297951 | 3300025929 | Bacteria | 1418 |
| 277 | Ga0207664_10403634 | 3300025929 | Bacteria | 1216 |
| 278 | Ga0207690_10631629 | 3300025932 | Bacteria | 876 |
| 279 | Ga0207686_10460751 | 3300025934 | Bacteria | 980 |
| 280 | Ga0207709_10509246 | 3300025935 | Bacteria | 941 |
| 281 | Ga0207670_10077628 | 3300025936 | Bacteria | 2314 |
| 282 | Ga0207665_10000894 | 3300025939 | Bacteria | 20058 |
| 283 | Ga0207665_10018309 | 3300025939 | Bacteria | 4601 |
| 284 | Ga0207665_10075528 | 3300025939 | Bacteria | 2309 |
| 285 | Ga0207711_10229371 | 3300025941 | Bacteria | 1700 |
| 286 | Ga0207711_10660625 | 3300025941 | Bacteria | 975 |
| 287 | Ga0207689_10020014 | 3300025942 | Bacteria | 5637 |
| 288 | Ga0207661_10161083 | 3300025944 | Bacteria | 1947 |
| 289 | Ga0207679_10052015 | 3300025945 | Bacteria | 3002 |
| 290 | Ga0207667_10043494 | 3300025949 | Bacteria | 4766 |
| 291 | Ga0207667_10180384 | 3300025949 | Bacteria | 2169 |
| 292 | Ga0207667_11053728 | 3300025949 | Bacteria | 798 |
| 293 | Ga0207651_10406057 | 3300025960 | Bacteria | 1160 |
| 294 | Ga0207712_10158109 | 3300025961 | Bacteria | 1758 |
| 295 | Ga0207640_11027071 | 3300025981 | Bacteria | 726 |
| 296 | Ga0207658_10079161 | 3300025986 | Bacteria | 2513 |
| 297 | Ga0207703_10078473 | 3300026035 | Bacteria | 2743 |
| 298 | Ga0207639_10120047 | 3300026041 | Bacteria | 2158 |
| 299 | Ga0207678_10016063 | 3300026067 | Bacteria | 6573 |
| 300 | Ga0207702_10020452 | 3300026078 | Bacteria | 5483 |
| 301 | Ga0207702_10088410 | 3300026078 | Bacteria | 2706 |
| 302 | Ga0207702_10090053 | 3300026078 | Bacteria | 2684 |
| 303 | Ga0207641_10093352 | 3300026088 | Bacteria | 2638 |
| 304 | Ga0207641_10132503 | 3300026088 | Bacteria | 2239 |
| 305 | Ga0207641_10594386 | 3300026088 | Bacteria | 1083 |
| 306 | Ga0207641_10620317 | 3300026088 | Bacteria | 1060 |
| 307 | Ga0207676_10168489 | 3300026095 | Bacteria | 1906 |
| 308 | Ga0207674_10128353 | 3300026116 | Bacteria | 2500 |
| 309 | Ga0207674_10203370 | 3300026116 | Bacteria | 1930 |
| 310 | Ga0207674_10228003 | 3300026116 | Bacteria | 1811 |
| 311 | Ga0207674_10260062 | 3300026116 | Bacteria | 1683 |
| 312 | Ga0207683_10069998 | 3300026121 | Bacteria | 3099 |
| 313 | Ga0207683_11280610 | 3300026121 | Bacteria | 679 |
| 314 | Ga0207698_10345267 | 3300026142 | Bacteria | 1404 |
| 315 | Ga0207428_10025216 | 3300027907 | Bacteria | 4978 |
| 316 | Ga0265336_10048541 | 3300028666 | Bacteria | 1287 |
| 317 | Ga0307515_10090850 | 3300028794 | Bacteria | 3824 |
| 318 | Ga0265338_10001490 | 3300028800 | Bacteria | 37899 |
| 319 | Ga0265762_1022676 | 3300030760 | Bacteria | 1162 |
| 320 | Ga0307516_10419673 | 3300031730 | Bacteria | 996 |
| 321 | Ga0307405_10002762 | 3300031731 | Bacteria | 7868 |
| 322 | Ga0307410_10064338 | 3300031852 | Bacteria | 2520 |
| 323 | Ga0307407_10508096 | 3300031903 | Bacteria | 884 |
| 324 | Ga0307412_10172458 | 3300031911 | Bacteria | 1619 |
| 325 | Ga0307409_100000452 | 3300031995 | Bacteria | 17397 |
| 326 | Ga0307416_100000505 | 3300032002 | Bacteria | 19894 |
| 327 | Ga0307416_100133157 | 3300032002 | Bacteria | 2243 |
| 328 | Ga0307415_100001254 | 3300032126 | Bacteria | 11927 |
| 329 | Ga0307415_101237993 | 3300032126 | Bacteria | 705 |
| 330 | Ga0307507_10029089 | 3300033179 | Bacteria | 5868 |
| 331 | Ga0307507_10068751 | 3300033179 | Bacteria | 3229 |
| 332 | Ga0307510_10094315 | 3300033180 | Bacteria | 2819 |
| 333 | Ga0316214_1007944 | 3300033545 | Bacteria | 1422 |
| 334 | Ga0373959_0013236 | 3300034820 | Bacteria | 1485 |
| 335 | Ga0373926_0020750 | 3300035083 | Bacteria | 2271 |
| 336 | Ga0373926_0032604 | 3300035083 | Bacteria | 1838 |
| 337 | Ga0373926_0179210 | 3300035083 | Bacteria | 812 |
| 338 | Ga0373934_0000053 | 3300035086 | Bacteria | 39071 |
| 339 | Ga0373934_0021412 | 3300035086 | Bacteria | 2489 |
| 340 | Ga0373923_0027194 | 3300035111 | Bacteria | 2281 |
| 341 | Ga0373923_0063243 | 3300035111 | Bacteria | 1576 |
| 342 | Ga0373923_0143704 | 3300035111 | Bacteria | 1080 |
| 343 | Ga0373936_0028386 | 3300035113 | Bacteria | 2199 |
| 344 | Ga0373936_0206417 | 3300035113 | Bacteria | 868 |
| 345 | Ga0373945_0022793 | 3300035116 | Bacteria | 2159 |
| 346 | Ga0373953_0090239 | 3300035117 | Bacteria | 1281 |
| 347 | Ga0373954_0000809 | 3300035118 | Bacteria | 12111 |
| 348 | Ga0373956_0000325 | 3300035119 | Bacteria | 19198 |
| 349 | Ga0373957_0000015 | 3300035120 | Bacteria | 43575 |
| 350 | Ga0373957_0010422 | 3300035120 | Bacteria | 3073 |
| 351 | Ga0373943_0004435 | 3300035170 | Bacteria | 6350 |
| 352 | Ga0373943_0172891 | 3300035170 | Bacteria | 1183 |
| 353 | Ga0373943_0385357 | 3300035170 | Bacteria | 807 |
| 354 | Ga0373946_0069927 | 3300035171 | Bacteria | 1513 |
| 355 | Ga0373946_0249354 | 3300035171 | Bacteria | 865 |
| 356 | Ga0373955_0000027 | 3300035172 | Bacteria | 58251 |
| 357 | Ga0373955_0012415 | 3300035172 | Bacteria | 4094 |
| 358 | Ga0373955_0033336 | 3300035172 | Bacteria | 2712 |
| 359 | Ga0373955_0093467 | 3300035172 | Bacteria | 1717 |
| 360 | Ga0373924_0000084 | 3300035410 | Bacteria | 25342 |
| 361 | Ga0373935_0154721 | 3300035692 | Bacteria | 1559 |
| 362 | Ga0373935_0347073 | 3300035692 | Bacteria | 1057 |
| 363 | Ga0373927_0014646 | 3300035695 | Bacteria | 5186 |
| 364 | Ga0373933_0000025 | 3300035724 | Bacteria | 90735 |
| 365 | Ga0373933_0009754 | 3300035724 | Bacteria | 5255 |
| 366 | Ga0373947_0194610 | 3300035725 | Bacteria | 1324 |
| 367 | Ga0373937_0000034 | 3300036401 | Bacteria | 116552 |
| 368 | Ga0373937_0053710 | 3300036401 | Bacteria | 3695 |
| 369 | Ga0373937_0199772 | 3300036401 | Bacteria | 1879 |
| 370 | Ga0373925_0000946 | 3300037068 | Bacteria | 26389 |
| 371 | Ga0373925_0022657 | 3300037068 | Bacteria | 4582 |
| 372 | Ga0373925_0317317 | 3300037068 | Bacteria | 1260 |
| 373 | Ga0373925_0351149 | 3300037068 | Bacteria | 1197 |
| 374 | Ga0395899_0148635 | 3300037312 | Bacteria | 1662 |
| 375 | Ga0395900_0034368 | 3300037418 | Bacteria | 5220 |
| 376 | Ga0395898_0033446 | 3300037466 | Bacteria | 5131 |
| 377 | Ga0436364_0360509 | 3300037853 | Bacteria | 7787 |
| 378 | Ga0436364_0378794 | 3300037853 | Bacteria | 13052 |
| 379 | Ga0436364_1336918 | 3300037853 | Bacteria | 10058 |
| 380 | Ga0436364_1463345 | 3300037853 | Bacteria | 72937 |
| 381 | Ga0395901_0162840 | 3300038443 | Bacteria | 2342 |
| 382 | Ga0436360_0331769 | 3300039438 | Bacteria | 930 |
| 383 | Ga0436361_1013087 | 3300039447 | Bacteria | 758 |
| 384 | Ga0436362_0272762 | 3300039453 | Bacteria | 987 |
| 385 | Ga0466963_0248206 | 3300044694 | Bacteria | 1249 |
| 386 | Ga0466968_0048688 | 3300044735 | Bacteria | 1804 |
| 387 | Ga0466970_0080697 | 3300044765 | Bacteria | 1758 |
| 388 | Ga0466957_0675841 | 3300044842 | Bacteria | 727 |
| 389 | Ga0466960_0206185 | 3300044901 | Bacteria | 1076 |
| 390 | Ga0466959_0055634 | 3300045049 | Bacteria | 2888 |
| 391 | Ga0466967_0094661 | 3300045976 | Bacteria | 2720 |
| 392 | Ga0466967_0585395 | 3300045976 | Bacteria | 1100 |
| 393 | Ga0466967_0667345 | 3300045976 | Bacteria | 1029 |
| 394 | Ga0495592_0000016 | 3300046454 | Bacteria | 144922 |
| 395 | Ga0495592_0005572 | 3300046454 | Bacteria | 9313 |
| 396 | Ga0495629_0205153 | 3300046459 | Bacteria | 1362 |
| 397 | Ga0495641_0007334 | 3300046461 | Bacteria | 6906 |
| 398 | Ga0495641_0104898 | 3300046461 | Bacteria | 1261 |
| 399 | Ga0495641_0108118 | 3300046461 | Bacteria | 1241 |
| 400 | Ga0495651_0000005 | 3300046462 | Bacteria | 173396 |
| 401 | Ga0495651_0013770 | 3300046462 | Bacteria | 6253 |
| 402 | Ga0495651_0021813 | 3300046462 | Bacteria | 4979 |
| 403 | Ga0495651_0109327 | 3300046462 | Bacteria | 2046 |
| 404 | Ga0495653_0001819 | 3300046463 | Bacteria | 16822 |
| 405 | Ga0495653_0049406 | 3300046463 | Bacteria | 3240 |
| 406 | Ga0495653_0057203 | 3300046463 | Bacteria | 2969 |
| 407 | Ga0495582_0263024 | 3300046473 | Bacteria | 990 |
| 408 | Ga0495662_0017665 | 3300046476 | Bacteria | 3453 |
| 409 | Ga0495662_0018322 | 3300046476 | Bacteria | 3388 |
| 410 | Ga0495662_0185400 | 3300046476 | Bacteria | 1026 |
| 411 | Ga0495662_0196322 | 3300046476 | Bacteria | 995 |
| 412 | Ga0495664_0001359 | 3300046477 | Bacteria | 12905 |
| 413 | Ga0495664_0010940 | 3300046477 | Bacteria | 5104 |
| 414 | Ga0495664_0056179 | 3300046477 | Bacteria | 2341 |
| 415 | Ga0495594_0036192 | 3300046499 | Bacteria | 2691 |
| 416 | Ga0495608_0000057 | 3300046511 | Bacteria | 90735 |
| 417 | Ga0495608_0084400 | 3300046511 | Bacteria | 2060 |
| 418 | Ga0495608_0218037 | 3300046511 | Bacteria | 1198 |
| 419 | Ga0495618_0148422 | 3300046514 | Bacteria | 1498 |
| 420 | Ga0495618_0148457 | 3300046514 | Bacteria | 1498 |
| 421 | Ga0495628_0000073 | 3300046516 | Bacteria | 79628 |
| 422 | Ga0495628_0040416 | 3300046516 | Bacteria | 3727 |
| 423 | Ga0495628_0068378 | 3300046516 | Bacteria | 2772 |
| 424 | Ga0495628_0138762 | 3300046516 | Bacteria | 1856 |
| 425 | Ga0495628_0162640 | 3300046516 | Bacteria | 1696 |
| 426 | Ga0495630_0062897 | 3300046517 | Bacteria | 2788 |
| 427 | Ga0495630_0088256 | 3300046517 | Bacteria | 2342 |
| 428 | Ga0495630_0392619 | 3300046517 | Bacteria | 1063 |
| 429 | Ga0495630_0529788 | 3300046517 | Bacteria | 903 |
| 430 | Ga0495652_0000054 | 3300046529 | Bacteria | 116611 |
| 431 | Ga0495652_0010609 | 3300046529 | Bacteria | 8347 |
| 432 | Ga0495652_0018557 | 3300046529 | Bacteria | 6200 |
| 433 | Ga0495652_0037757 | 3300046529 | Bacteria | 4188 |
| 434 | Ga0495652_0139361 | 3300046529 | Bacteria | 1909 |
| 435 | Ga0495652_0175212 | 3300046529 | Bacteria | 1652 |
| 436 | Ga0495652_0195597 | 3300046529 | Bacteria | 1539 |
| 437 | Ga0495665_0045996 | 3300046531 | Bacteria | 2318 |
| 438 | Ga0495640_0008894 | 3300046533 | Bacteria | 7843 |
| 439 | Ga0495587_0000030 | 3300046536 | Bacteria | 135844 |
| 440 | Ga0495587_0031277 | 3300046536 | Bacteria | 3223 |
| 441 | Ga0495587_0053159 | 3300046536 | Bacteria | 2388 |
| 442 | Ga0495587_0132134 | 3300046536 | Bacteria | 1426 |
| 443 | Ga0495645_0028521 | 3300046543 | Bacteria | 4057 |
| 444 | Ga0495645_0128725 | 3300046543 | Bacteria | 1777 |
| 445 | Ga0495667_0000025 | 3300046559 | Bacteria | 155090 |
| 446 | Ga0495667_0034199 | 3300046559 | Bacteria | 3398 |
| 447 | Ga0495667_0125747 | 3300046559 | Bacteria | 1654 |
| 448 | Ga0495667_0152604 | 3300046559 | Bacteria | 1487 |
| 449 | Ga0495667_0169178 | 3300046559 | Bacteria | 1404 |
| 450 | Ga0495667_0210965 | 3300046559 | Bacteria | 1241 |
| 451 | Ga0495667_0214430 | 3300046559 | Bacteria | 1230 |
| 452 | Ga0495634_0173659 | 3300046642 | Bacteria | 1353 |
| 453 | Ga0495635_0035584 | 3300046663 | Bacteria | 3453 |
| 454 | Ga0495635_0125886 | 3300046663 | Bacteria | 1747 |
| 455 | Ga0495588_0091753 | 3300046674 | Bacteria | 1592 |
| 456 | Ga0495657_0000018 | 3300046675 | Bacteria | 173397 |
| 457 | Ga0495657_0023842 | 3300046675 | Bacteria | 4366 |
| 458 | Ga0495657_0029368 | 3300046675 | Bacteria | 3857 |
| 459 | Ga0495657_0037984 | 3300046675 | Bacteria | 3315 |
| 460 | Ga0495657_0063434 | 3300046675 | Bacteria | 2437 |
| 461 | Ga0495599_0000054 | 3300046678 | Bacteria | 79938 |
| 462 | Ga0495599_0001992 | 3300046678 | Bacteria | 11813 |
| 463 | Ga0495599_0056818 | 3300046678 | Bacteria | 2449 |
| 464 | Ga0495599_0069194 | 3300046678 | Bacteria | 2203 |
| 465 | Ga0495599_0125415 | 3300046678 | Bacteria | 1596 |
| 466 | Ga0495599_0185014 | 3300046678 | Bacteria | 1283 |
| 467 | Ga0495623_0000582 | 3300046679 | Bacteria | 24382 |
| 468 | Ga0495646_0013644 | 3300046680 | Bacteria | 5166 |
| 469 | Ga0495646_0061139 | 3300046680 | Bacteria | 2244 |
| 470 | Ga0495624_0007142 | 3300046690 | Bacteria | 7860 |
| 471 | Ga0495600_0022171 | 3300046809 | Bacteria | 4075 |
| 472 | Ga0495600_0090349 | 3300046809 | Bacteria | 1997 |
| 473 | Ga0495600_0119277 | 3300046809 | Bacteria | 1716 |
| 474 | Ga0495600_0336879 | 3300046809 | Bacteria | 946 |
| 475 | Ga0495604_0000066 | 3300047317 | Bacteria | 90720 |
| 476 | Ga0495604_0014421 | 3300047317 | Bacteria | 6304 |
| 477 | Ga0495604_0075260 | 3300047317 | Bacteria | 2543 |
| 478 | Ga0495674_0058742 | 3300047319 | Bacteria | 3361 |
| 479 | Ga0495674_0077903 | 3300047319 | Bacteria | 2849 |
| 480 | Ga0495674_0218662 | 3300047319 | Bacteria | 1575 |
| 481 | Ga0495674_0224639 | 3300047319 | Bacteria | 1551 |
| 482 | Ga0495674_0341224 | 3300047319 | Bacteria | 1217 |
| 483 | Ga0495676_0145894 | 3300047321 | Bacteria | 1690 |
| 484 | Ga0495680_0000032 | 3300047322 | Bacteria | 108460 |
| 485 | Ga0495680_0019660 | 3300047322 | Bacteria | 5698 |
| 486 | Ga0495680_0083599 | 3300047322 | Bacteria | 2406 |
| 487 | Ga0495680_0090283 | 3300047322 | Bacteria | 2298 |
| 488 | Ga0495680_0270407 | 3300047322 | Bacteria | 1200 |
| 489 | Ga0495675_0002070 | 3300047444 | Bacteria | 11973 |
| 490 | Ga0495675_0044645 | 3300047444 | Bacteria | 2823 |
| 491 | Ga0495675_0078204 | 3300047444 | Bacteria | 2083 |
| 492 | Ga0495684_0006951 | 3300047471 | Bacteria | 8787 |
| 493 | Ga0495684_0016877 | 3300047471 | Bacteria | 5625 |
| 494 | Ga0495684_0029249 | 3300047471 | Bacteria | 4229 |
| 495 | Ga0495684_0294190 | 3300047471 | Bacteria | 1168 |
| 496 | Ga0495602_0000123 | 3300048088 | Bacteria | 72994 |
| 497 | Ga0495602_0046260 | 3300048088 | Bacteria | 3932 |
| 498 | Ga0495602_0101420 | 3300048088 | Bacteria | 2361 |
| 499 | Ga0496102_0056828 | 3300048905 | Bacteria | 3571 |
| 500 | Ga0496104_0000379 | 3300048907 | Bacteria | 39343 |
| 501 | Ga0496104_0033643 | 3300048907 | Bacteria | 4777 |
| 502 | Ga0496104_0244494 | 3300048907 | Bacteria | 1707 |
| 503 | Ga0496104_0975568 | 3300048907 | Bacteria | 752 |
| 504 | Ga0496105_0003646 | 3300048908 | Bacteria | 11445 |
| 505 | Ga0496105_0042563 | 3300048908 | Bacteria | 3744 |
| 506 | Ga0496105_0318676 | 3300048908 | Bacteria | 1247 |
| 507 | Ga0496106_0109881 | 3300048909 | Bacteria | 2146 |
| 508 | Ga0496106_0256095 | 3300048909 | Bacteria | 1400 |
| 509 | Ga0496108_0010156 | 3300048911 | Bacteria | 7641 |
| 510 | Ga0496108_0037134 | 3300048911 | Bacteria | 4056 |
| 511 | Ga0496109_0026333 | 3300048912 | Bacteria | 5186 |
| 512 | Ga0496109_0048764 | 3300048912 | Bacteria | 3853 |
| 513 | Ga0496112_0224441 | 3300048915 | Bacteria | 1834 |
| 514 | Ga0496115_0240645 | 3300048918 | Bacteria | 1491 |
| 515 | Ga0496119_0244684 | 3300048922 | Bacteria | 907 |
| 516 | Ga0501034_0029357 | 3300049571 | Bacteria | 5588 |
| 517 | Ga0501036_0000627 | 3300049572 | Bacteria | 25739 |
| 518 | Ga0501037_0006911 | 3300049573 | Bacteria | 8285 |
| 519 | Ga0501038_0017684 | 3300049574 | Bacteria | 6444 |
| 520 | Ga0501038_0081933 | 3300049574 | Bacteria | 2718 |
| 521 | Ga0501039_0022612 | 3300049575 | Bacteria | 4826 |
| 522 | Ga0501042_0003012 | 3300049578 | Bacteria | 10481 |
| 523 | Ga0501043_0002045 | 3300049579 | Bacteria | 17217 |
| 524 | Ga0501047_0009755 | 3300049581 | Bacteria | 9071 |
| 525 | Ga0501048_0003714 | 3300049582 | Bacteria | 11633 |
| 526 | Ga0501070_0037175 | 3300049586 | Bacteria | 4065 |
| 527 | Ga0501073_0057055 | 3300049589 | Bacteria | 2730 |
| 528 | Ga0501074_0000296 | 3300049590 | Bacteria | 28700 |
| 529 | Ga0501074_0319180 | 3300049590 | Bacteria | 1103 |
| 530 | Ga0501077_0132912 | 3300049593 | Bacteria | 1578 |
| 531 | Ga0501044_0030529 | 3300049823 | Bacteria | 5679 |
| 532 | nmdc:mga05p37_152_c1 | 3300050507 | Bacteria | 65549 |
| 533 | nmdc:mga09592_63_c1 | 3300050508 | Bacteria | 60777 |
| 534 | nmdc:mga0qj67_39354_c1 | 3300050509 | Bacteria | 3712 |
| 535 | nmdc:mga06r32_1726_c1 | 3300050510 | Bacteria | 19669 |
| 536 | nmdc:mga06r32_9202_c1 | 3300050510 | Bacteria | 8905 |
| 537 | nmdc:mga0rr50_719069_c1 | 3300050513 | Bacteria | 852 |
| 538 | nmdc:mga08x19_213444_c1 | 3300050514 | Bacteria | 1325 |
| 539 | nmdc:mga0a205_165978_c1 | 3300050515 | Bacteria | 2104 |
| 540 | Ga0495612_0027311 | 3300053078 | Bacteria | 2295 |
| 541 | Ga0495612_0059072 | 3300053078 | Bacteria | 1585 |
| 542 | Ga0495612_0087596 | 3300053078 | Bacteria | 1314 |
| 543 | Ga0495595_0032546 | 3300053084 | Bacteria | 2349 |
| 544 | Ga0495595_0218364 | 3300053084 | Bacteria | 951 |
| 545 | Ga0495619_0281806 | 3300053085 | Bacteria | 1152 |
| 546 | Ga0495619_0504505 | 3300053085 | Bacteria | 832 |
| 547 | Ga0500594_0056576 | 3300053118 | Bacteria | 1119 |
| 548 | Ga0500588_0005290 | 3300053146 | Bacteria | 2858 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0975568 | Ga0496104_0975568_62_562 | 160 |
| 2 | 3300046559 | Ga0495667_0214430 | Ga0495667_0214430_110_649 | 168 |
| 3 | 3300047322 | Ga0495680_0270407 | Ga0495680_0270407_499_1038 | 168 |
| 4 | 3300053084 | Ga0495595_0218364 | Ga0495595_0218364_306_845 | 168 |
| 5 | 3300053085 | Ga0495619_0504505 | Ga0495619_0504505_173_712 | 168 |
| 6 | 3300025981 | Ga0207640_11027071 | Ga0207640_110270711 | 184 |
| 7 | 3300032002 | Ga0307416_100133157 | Ga0307416_1001331573 | 187 |
| 8 | 3300005435 | Ga0070714_100251036 | Ga0070714_1002510362 | 188 |
| 9 | 3300009098 | Ga0105245_10022733 | Ga0105245_100227334 | 189 |
| 10 | 3300009176 | Ga0105242_10118796 | Ga0105242_101187962 | 189 |
| 11 | 3300009553 | Ga0105249_10497062 | Ga0105249_104970622 | 189 |
| 12 | 3300013307 | Ga0157372_11232780 | Ga0157372_112327801 | 189 |
| 13 | 3300013308 | Ga0157375_11051676 | Ga0157375_110516762 | 189 |
| 14 | 3300014325 | Ga0163163_10222750 | Ga0163163_102227502 | 189 |
| 15 | 3300005471 | Ga0070698_100051939 | Ga0070698_1000519392 | 190 |
| 16 | 3300005445 | Ga0070708_100059206 | Ga0070708_1000592064 | 191 |
| 17 | 3300025922 | Ga0207646_10186433 | Ga0207646_101864332 | 191 |
| 18 | 3300032126 | Ga0307415_101237993 | Ga0307415_1012379931 | 191 |
| 19 | 3300005467 | Ga0070706_100017317 | Ga0070706_1000173175 | 192 |
| 20 | 3300005471 | Ga0070698_100060560 | Ga0070698_1000605602 | 192 |
| 21 | 3300025910 | Ga0207684_10028508 | Ga0207684_100285082 | 192 |
| 22 | 3300005467 | Ga0070706_100253261 | Ga0070706_1002532612 | 193 |
| 23 | 3300005356 | Ga0070674_100691619 | Ga0070674_1006916192 | 194 |
| 24 | 3300005437 | Ga0070710_10288758 | Ga0070710_102887581 | 194 |
| 25 | 3300009094 | Ga0111539_10017115 | Ga0111539_100171155 | 194 |
| 26 | 3300009147 | Ga0114129_10214373 | Ga0114129_102143734 | 194 |
| 27 | 3300025898 | Ga0207692_10184580 | Ga0207692_101845802 | 194 |
| 28 | 3300044694 | Ga0466963_0248206 | Ga0466963_0248206_78_710 | 194 |
| 29 | 3300045049 | Ga0466959_0055634 | Ga0466959_0055634_1535_2167 | 194 |
| 30 | 3300050507 | nmdc:mga05p37_152_c1 | nmdc:mga05p37_152_c1_36887_37471 | 194 |
| 31 | 3300050508 | nmdc:mga09592_63_c1 | nmdc:mga09592_63_c1_20727_21311 | 194 |
| 32 | 3300050509 | nmdc:mga0qj67_39354_c1 | nmdc:mga0qj67_39354_c1_2255_2839 | 194 |
| 33 | 3300050510 | nmdc:mga06r32_9202_c1 | nmdc:mga06r32_9202_c1_992_1576 | 194 |
| 34 | 3300053146 | Ga0500588_0005290 | Ga0500588_0005290_848_1450 | 194 |
| 35 | 3300005436 | Ga0070713_100819485 | Ga0070713_1008194851 | 195 |
| 36 | 3300006028 | Ga0070717_10781022 | Ga0070717_107810221 | 195 |
| 37 | 3300025928 | Ga0207700_10523692 | Ga0207700_105236922 | 195 |
| 38 | 3300028794 | Ga0307515_10090850 | Ga0307515_100908502 | 195 |
| 39 | 3300005435 | Ga0070714_100482789 | Ga0070714_1004827892 | 196 |
| 40 | 3300005467 | Ga0070706_100006621 | Ga0070706_1000066216 | 196 |
| 41 | 3300005468 | Ga0070707_100000099 | Ga0070707_10000009911 | 196 |
| 42 | 3300005468 | Ga0070707_100059424 | Ga0070707_1000594244 | 196 |
| 43 | 3300005471 | Ga0070698_100001403 | Ga0070698_10000140318 | 196 |
| 44 | 3300005518 | Ga0070699_100015608 | Ga0070699_1000156083 | 196 |
| 45 | 3300005577 | Ga0068857_100176265 | Ga0068857_1001762652 | 196 |
| 46 | 3300005614 | Ga0068856_100531143 | Ga0068856_1005311432 | 196 |
| 47 | 3300005841 | Ga0068863_100497111 | Ga0068863_1004971112 | 196 |
| 48 | 3300006175 | Ga0070712_100099106 | Ga0070712_1000991062 | 196 |
| 49 | 3300010375 | Ga0105239_10642627 | Ga0105239_106426271 | 196 |
| 50 | 3300025905 | Ga0207685_10022730 | Ga0207685_100227302 | 196 |
| 51 | 3300025906 | Ga0207699_10053042 | Ga0207699_100530422 | 196 |
| 52 | 3300025915 | Ga0207693_10001994 | Ga0207693_100019946 | 196 |
| 53 | 3300025916 | Ga0207663_10181583 | Ga0207663_101815832 | 196 |
| 54 | 3300025939 | Ga0207665_10018309 | Ga0207665_100183092 | 196 |
| 55 | 3300026088 | Ga0207641_10093352 | Ga0207641_100933522 | 196 |
| 56 | 3300044765 | Ga0466970_0080697 | Ga0466970_0080697_31_621 | 196 |
| 57 | 3300045976 | Ga0466967_0585395 | Ga0466967_0585395_42_635 | 196 |
| 58 | 3300046516 | Ga0495628_0040416 | Ga0495628_0040416_2034_2636 | 196 |
| 59 | 3300049574 | Ga0501038_0081933 | Ga0501038_0081933_1170_1760 | 196 |
| 60 | 3300049593 | Ga0501077_0132912 | Ga0501077_0132912_913_1503 | 196 |
| 61 | 3300005329 | Ga0070683_100295778 | Ga0070683_1002957781 | 197 |
| 62 | 3300005435 | Ga0070714_100026874 | Ga0070714_1000268742 | 197 |
| 63 | 3300005436 | Ga0070713_100653507 | Ga0070713_1006535072 | 197 |
| 64 | 3300005437 | Ga0070710_10066666 | Ga0070710_100666662 | 197 |
| 65 | 3300005437 | Ga0070710_10490162 | Ga0070710_104901621 | 197 |
| 66 | 3300005439 | Ga0070711_100446953 | Ga0070711_1004469532 | 197 |
| 67 | 3300005535 | Ga0070684_100345606 | Ga0070684_1003456061 | 197 |
| 68 | 3300005614 | Ga0068856_100461196 | Ga0068856_1004611962 | 197 |
| 69 | 3300005614 | Ga0068856_100756805 | Ga0068856_1007568051 | 197 |
| 70 | 3300006173 | Ga0070716_100075502 | Ga0070716_1000755023 | 197 |
| 71 | 3300006871 | Ga0075434_100290148 | Ga0075434_1002901482 | 197 |
| 72 | 3300013104 | Ga0157370_10707181 | Ga0157370_107071811 | 197 |
| 73 | 3300013105 | Ga0157369_10305829 | Ga0157369_103058292 | 197 |
| 74 | 3300025898 | Ga0207692_10289022 | Ga0207692_102890221 | 197 |
| 75 | 3300025915 | Ga0207693_10040554 | Ga0207693_100405541 | 197 |
| 76 | 3300025915 | Ga0207693_10189644 | Ga0207693_101896442 | 197 |
| 77 | 3300025916 | Ga0207663_10368759 | Ga0207663_103687591 | 197 |
| 78 | 3300025928 | Ga0207700_10135247 | Ga0207700_101352471 | 197 |
| 79 | 3300025929 | Ga0207664_10075730 | Ga0207664_100757303 | 197 |
| 80 | 3300025944 | Ga0207661_10161083 | Ga0207661_101610831 | 197 |
| 81 | 3300026078 | Ga0207702_10088410 | Ga0207702_100884102 | 197 |
| 82 | 3300026088 | Ga0207641_10594386 | Ga0207641_105943862 | 197 |
| 83 | 3300035083 | Ga0373926_0020750 | Ga0373926_0020750_1161_1772 | 197 |
| 84 | 3300035111 | Ga0373923_0143704 | Ga0373923_0143704_185_796 | 197 |
| 85 | 3300044901 | Ga0466960_0206185 | Ga0466960_0206185_242_841 | 197 |
| 86 | 3300046461 | Ga0495641_0108118 | Ga0495641_0108118_381_992 | 197 |
| 87 | 3300046511 | Ga0495608_0218037 | Ga0495608_0218037_434_1045 | 197 |
| 88 | 3300046559 | Ga0495667_0152604 | Ga0495667_0152604_309_920 | 197 |
| 89 | 3300005347 | Ga0070668_100020039 | Ga0070668_1000200392 | 198 |
| 90 | 3300005467 | Ga0070706_100051472 | Ga0070706_1000514725 | 198 |
| 91 | 3300005467 | Ga0070706_100127734 | Ga0070706_1001277343 | 198 |
| 92 | 3300005468 | Ga0070707_100114435 | Ga0070707_1001144352 | 198 |
| 93 | 3300005471 | Ga0070698_100401080 | Ga0070698_1004010802 | 198 |
| 94 | 3300005536 | Ga0070697_100709780 | Ga0070697_1007097802 | 198 |
| 95 | 3300025910 | Ga0207684_10081851 | Ga0207684_100818512 | 198 |
| 96 | 3300031730 | Ga0307516_10419673 | Ga0307516_104196731 | 198 |
| 97 | 3300033179 | Ga0307507_10029089 | Ga0307507_100290897 | 198 |
| 98 | 3300033179 | Ga0307507_10068751 | Ga0307507_100687512 | 198 |
| 99 | 3300033180 | Ga0307510_10094315 | Ga0307510_100943152 | 198 |
| 100 | iso_pu_bacteria | 2891395885 | 2891396429 | 198 |
| 101 | iso_pu_bacteria | 2891554331 | 2891557894 | 198 |
| 102 | 3300005530 | Ga0070679_100273502 | Ga0070679_1002735022 | 199 |
| 103 | 3300005535 | Ga0070684_100148588 | Ga0070684_1001485882 | 199 |
| 104 | 3300031731 | Ga0307405_10002762 | Ga0307405_100027625 | 199 |
| 105 | 3300031852 | Ga0307410_10064338 | Ga0307410_100643382 | 199 |
| 106 | 3300031903 | Ga0307407_10508096 | Ga0307407_105080961 | 199 |
| 107 | 3300031911 | Ga0307412_10172458 | Ga0307412_101724582 | 199 |
| 108 | 3300031995 | Ga0307409_100000452 | Ga0307409_1000004528 | 199 |
| 109 | 3300032002 | Ga0307416_100000505 | Ga0307416_1000005052 | 199 |
| 110 | 3300032126 | Ga0307415_100001254 | Ga0307415_1000012544 | 199 |
| 111 | iso_pu_bacteria | 2515154155 | 2515855636 | 199 |
| 112 | iso_pu_bacteria | 2675903058 | 2676475660 | 199 |
| 113 | iso_pu_bacteria | 2827628540 | 2827631388 | 199 |
| 114 | 3300005563 | Ga0068855_100009145 | Ga0068855_1000091456 | 200 |
| 115 | 3300020076 | Ga0206355_1707556 | Ga0206355_17075561 | 200 |
| 116 | 3300020077 | Ga0206351_10334080 | Ga0206351_103340802 | 200 |
| 117 | 3300022467 | Ga0224712_10084406 | Ga0224712_100844063 | 200 |
| 118 | 3300025949 | Ga0207667_10043494 | Ga0207667_100434944 | 200 |
| 119 | 3300026142 | Ga0207698_10345267 | Ga0207698_103452672 | 200 |
| 120 | 3300046499 | Ga0495594_0036192 | Ga0495594_0036192_1398_2009 | 200 |
| 121 | iso_pu_bacteria | 8053945823 | 8053950021 | 200 |
| 122 | 3300005327 | Ga0070658_10001528 | Ga0070658_100015286 | 201 |
| 123 | 3300005336 | Ga0070680_100001058 | Ga0070680_10000105812 | 201 |
| 124 | 3300005339 | Ga0070660_100080911 | Ga0070660_1000809112 | 201 |
| 125 | 3300005458 | Ga0070681_10006754 | Ga0070681_100067547 | 201 |
| 126 | 3300005530 | Ga0070679_100005432 | Ga0070679_1000054326 | 201 |
| 127 | 3300005563 | Ga0068855_100793321 | Ga0068855_1007933211 | 201 |
| 128 | 3300009093 | Ga0105240_10331744 | Ga0105240_103317441 | 201 |
| 129 | 3300013104 | Ga0157370_10478468 | Ga0157370_104784682 | 201 |
| 130 | 3300013105 | Ga0157369_10688078 | Ga0157369_106880782 | 201 |
| 131 | 3300020082 | Ga0206353_10353071 | Ga0206353_1035307128 | 201 |
| 132 | 3300025909 | Ga0207705_10002552 | Ga0207705_1000255212 | 201 |
| 133 | 3300025912 | Ga0207707_10001870 | Ga0207707_1000187012 | 201 |
| 134 | 3300025917 | Ga0207660_10000283 | Ga0207660_1000028332 | 201 |
| 135 | 3300025919 | Ga0207657_10115550 | Ga0207657_101155502 | 201 |
| 136 | 3300025921 | Ga0207652_10000792 | Ga0207652_100007922 | 201 |
| 137 | 3300053118 | Ga0500594_0056576 | Ga0500594_0056576_74_703 | 201 |
| 138 | 3300025934 | Ga0207686_10460751 | Ga0207686_104607512 | 202 |
| 139 | 3300005445 | Ga0070708_100100957 | Ga0070708_1001009572 | 203 |
| 140 | 3300005467 | Ga0070706_100008872 | Ga0070706_1000088722 | 203 |
| 141 | 3300005471 | Ga0070698_100003947 | Ga0070698_10000394713 | 203 |
| 142 | 3300005518 | Ga0070699_100051463 | Ga0070699_1000514634 | 203 |
| 143 | 3300025910 | Ga0207684_10234507 | Ga0207684_102345071 | 203 |
| 144 | 3300025922 | Ga0207646_10023758 | Ga0207646_100237581 | 203 |
| 145 | 3300026095 | Ga0207676_10168489 | Ga0207676_101684892 | 203 |
| 146 | 3300005366 | Ga0070659_100909453 | Ga0070659_1009094531 | 204 |
| 147 | 3300005367 | Ga0070667_100035056 | Ga0070667_1000350562 | 204 |
| 148 | 3300005434 | Ga0070709_10026042 | Ga0070709_100260423 | 204 |
| 149 | 3300005434 | Ga0070709_10086653 | Ga0070709_100866532 | 204 |
| 150 | 3300005435 | Ga0070714_100000680 | Ga0070714_1000006807 | 204 |
| 151 | 3300005435 | Ga0070714_100032593 | Ga0070714_1000325932 | 204 |
| 152 | 3300005435 | Ga0070714_100081330 | Ga0070714_1000813302 | 204 |
| 153 | 3300005435 | Ga0070714_100139918 | Ga0070714_1001399182 | 204 |
| 154 | 3300005435 | Ga0070714_100372699 | Ga0070714_1003726991 | 204 |
| 155 | 3300005437 | Ga0070710_10012246 | Ga0070710_100122463 | 204 |
| 156 | 3300005437 | Ga0070710_10363940 | Ga0070710_103639401 | 204 |
| 157 | 3300005439 | Ga0070711_100039417 | Ga0070711_1000394172 | 204 |
| 158 | 3300005439 | Ga0070711_100051486 | Ga0070711_1000514862 | 204 |
| 159 | 3300005458 | Ga0070681_10393932 | Ga0070681_103939321 | 204 |
| 160 | 3300005467 | Ga0070706_100003775 | Ga0070706_1000037752 | 204 |
| 161 | 3300005467 | Ga0070706_100013498 | Ga0070706_1000134987 | 204 |
| 162 | 3300005467 | Ga0070706_100054929 | Ga0070706_1000549293 | 204 |
| 163 | 3300005467 | Ga0070706_100073303 | Ga0070706_1000733033 | 204 |
| 164 | 3300005468 | Ga0070707_100070467 | Ga0070707_1000704672 | 204 |
| 165 | 3300005468 | Ga0070707_100245641 | Ga0070707_1002456412 | 204 |
| 166 | 3300005468 | Ga0070707_100302217 | Ga0070707_1003022172 | 204 |
| 167 | 3300005471 | Ga0070698_100000057 | Ga0070698_10000005775 | 204 |
| 168 | 3300005471 | Ga0070698_100016931 | Ga0070698_1000169318 | 204 |
| 169 | 3300005471 | Ga0070698_100028229 | Ga0070698_1000282298 | 204 |
| 170 | 3300005471 | Ga0070698_100303289 | Ga0070698_1003032892 | 204 |
| 171 | 3300005518 | Ga0070699_100093494 | Ga0070699_1000934942 | 204 |
| 172 | 3300005530 | Ga0070679_100024438 | Ga0070679_1000244382 | 204 |
| 173 | 3300005535 | Ga0070684_100222133 | Ga0070684_1002221332 | 204 |
| 174 | 3300005536 | Ga0070697_100175535 | Ga0070697_1001755352 | 204 |
| 175 | 3300005548 | Ga0070665_100238015 | Ga0070665_1002380152 | 204 |
| 176 | 3300005563 | Ga0068855_100494964 | Ga0068855_1004949642 | 204 |
| 177 | 3300005577 | Ga0068857_100518665 | Ga0068857_1005186652 | 204 |
| 178 | 3300005577 | Ga0068857_101045423 | Ga0068857_1010454231 | 204 |
| 179 | 3300005614 | Ga0068856_100048503 | Ga0068856_1000485032 | 204 |
| 180 | 3300005616 | Ga0068852_100461552 | Ga0068852_1004615522 | 204 |
| 181 | 3300005617 | Ga0068859_101155805 | Ga0068859_1011558051 | 204 |
| 182 | 3300005618 | Ga0068864_100160392 | Ga0068864_1001603923 | 204 |
| 183 | 3300005841 | Ga0068863_100274159 | Ga0068863_1002741592 | 204 |
| 184 | 3300005937 | Ga0081455_10004995 | Ga0081455_1000499512 | 204 |
| 185 | 3300005981 | Ga0081538_10000172 | Ga0081538_1000017232 | 204 |
| 186 | 3300006028 | Ga0070717_10105387 | Ga0070717_101053873 | 204 |
| 187 | 3300006028 | Ga0070717_10153398 | Ga0070717_101533982 | 204 |
| 188 | 3300006028 | Ga0070717_10174006 | Ga0070717_101740062 | 204 |
| 189 | 3300006028 | Ga0070717_10224206 | Ga0070717_102242062 | 204 |
| 190 | 3300006163 | Ga0070715_10006535 | Ga0070715_100065352 | 204 |
| 191 | 3300006163 | Ga0070715_10081417 | Ga0070715_100814171 | 204 |
| 192 | 3300006173 | Ga0070716_100013454 | Ga0070716_1000134541 | 204 |
| 193 | 3300006175 | Ga0070712_100066264 | Ga0070712_1000662643 | 204 |
| 194 | 3300006175 | Ga0070712_100421388 | Ga0070712_1004213882 | 204 |
| 195 | 3300006358 | Ga0068871_100390481 | Ga0068871_1003904812 | 204 |
| 196 | 3300006914 | Ga0075436_100138665 | Ga0075436_1001386652 | 204 |
| 197 | 3300006931 | Ga0097620_101156164 | Ga0097620_1011561641 | 204 |
| 198 | 3300007265 | Ga0099794_10102355 | Ga0099794_101023552 | 204 |
| 199 | 3300009101 | Ga0105247_10110550 | Ga0105247_101105502 | 204 |
| 200 | 3300013104 | Ga0157370_10361866 | Ga0157370_103618661 | 204 |
| 201 | 3300013296 | Ga0157374_10047464 | Ga0157374_100474642 | 204 |
| 202 | 3300013306 | Ga0163162_10240209 | Ga0163162_102402091 | 204 |
| 203 | 3300013307 | Ga0157372_10426469 | Ga0157372_104264692 | 204 |
| 204 | 3300013308 | Ga0157375_10192017 | Ga0157375_101920172 | 204 |
| 205 | 3300014325 | Ga0163163_10097356 | Ga0163163_100973562 | 204 |
| 206 | 3300014968 | Ga0157379_10003574 | Ga0157379_100035747 | 204 |
| 207 | 3300014969 | Ga0157376_10030150 | Ga0157376_100301502 | 204 |
| 208 | 3300020070 | Ga0206356_10079390 | Ga0206356_100793901 | 204 |
| 209 | 3300020081 | Ga0206354_11234884 | Ga0206354_112348841 | 204 |
| 210 | 3300021388 | Ga0213875_10002903 | Ga0213875_100029035 | 204 |
| 211 | 3300021388 | Ga0213875_10003162 | Ga0213875_100031628 | 204 |
| 212 | 3300021388 | Ga0213875_10005542 | Ga0213875_100055422 | 204 |
| 213 | 3300021388 | Ga0213875_10011884 | Ga0213875_100118843 | 204 |
| 214 | 3300022467 | Ga0224712_10075106 | Ga0224712_100751061 | 204 |
| 215 | 3300022467 | Ga0224712_10203796 | Ga0224712_102037962 | 204 |
| 216 | 3300022467 | Ga0224712_10209247 | Ga0224712_102092471 | 204 |
| 217 | 3300022467 | Ga0224712_10214792 | Ga0224712_102147921 | 204 |
| 218 | 3300024123 | Ga0228600_1007971 | Ga0228600_10079712 | 204 |
| 219 | 3300025898 | Ga0207692_10002193 | Ga0207692_100021932 | 204 |
| 220 | 3300025898 | Ga0207692_10373979 | Ga0207692_103739792 | 204 |
| 221 | 3300025905 | Ga0207685_10199739 | Ga0207685_101997391 | 204 |
| 222 | 3300025905 | Ga0207685_10272829 | Ga0207685_102728291 | 204 |
| 223 | 3300025906 | Ga0207699_10005417 | Ga0207699_100054172 | 204 |
| 224 | 3300025910 | Ga0207684_10007038 | Ga0207684_100070388 | 204 |
| 225 | 3300025910 | Ga0207684_10030012 | Ga0207684_100300122 | 204 |
| 226 | 3300025910 | Ga0207684_10081557 | Ga0207684_100815572 | 204 |
| 227 | 3300025910 | Ga0207684_10092287 | Ga0207684_100922872 | 204 |
| 228 | 3300025910 | Ga0207684_10291055 | Ga0207684_102910552 | 204 |
| 229 | 3300025915 | Ga0207693_10137599 | Ga0207693_101375993 | 204 |
| 230 | 3300025916 | Ga0207663_10197403 | Ga0207663_101974032 | 204 |
| 231 | 3300025916 | Ga0207663_10294477 | Ga0207663_102944772 | 204 |
| 232 | 3300025921 | Ga0207652_10292138 | Ga0207652_102921382 | 204 |
| 233 | 3300025922 | Ga0207646_10020733 | Ga0207646_100207332 | 204 |
| 234 | 3300025922 | Ga0207646_10050956 | Ga0207646_100509562 | 204 |
| 235 | 3300025922 | Ga0207646_10158336 | Ga0207646_101583362 | 204 |
| 236 | 3300025922 | Ga0207646_10192941 | Ga0207646_101929412 | 204 |
| 237 | 3300025922 | Ga0207646_10245408 | Ga0207646_102454081 | 204 |
| 238 | 3300025922 | Ga0207646_10509897 | Ga0207646_105098972 | 204 |
| 239 | 3300025927 | Ga0207687_10144697 | Ga0207687_101446972 | 204 |
| 240 | 3300025928 | Ga0207700_10094684 | Ga0207700_100946841 | 204 |
| 241 | 3300025928 | Ga0207700_10148282 | Ga0207700_101482822 | 204 |
| 242 | 3300025928 | Ga0207700_10874514 | Ga0207700_108745141 | 204 |
| 243 | 3300025929 | Ga0207664_10001098 | Ga0207664_100010986 | 204 |
| 244 | 3300025929 | Ga0207664_10029688 | Ga0207664_100296883 | 204 |
| 245 | 3300025929 | Ga0207664_10083611 | Ga0207664_100836113 | 204 |
| 246 | 3300025929 | Ga0207664_10098290 | Ga0207664_100982901 | 204 |
| 247 | 3300025929 | Ga0207664_10113486 | Ga0207664_101134862 | 204 |
| 248 | 3300025929 | Ga0207664_10403634 | Ga0207664_104036342 | 204 |
| 249 | 3300025939 | Ga0207665_10000894 | Ga0207665_1000089414 | 204 |
| 250 | 3300025939 | Ga0207665_10075528 | Ga0207665_100755282 | 204 |
| 251 | 3300025941 | Ga0207711_10229371 | Ga0207711_102293712 | 204 |
| 252 | 3300025949 | Ga0207667_10180384 | Ga0207667_101803842 | 204 |
| 253 | 3300025960 | Ga0207651_10406057 | Ga0207651_104060572 | 204 |
| 254 | 3300025986 | Ga0207658_10079161 | Ga0207658_100791612 | 204 |
| 255 | 3300026035 | Ga0207703_10078473 | Ga0207703_100784732 | 204 |
| 256 | 3300026078 | Ga0207702_10090053 | Ga0207702_100900532 | 204 |
| 257 | 3300026116 | Ga0207674_10128353 | Ga0207674_101283533 | 204 |
| 258 | 3300026121 | Ga0207683_11280610 | Ga0207683_112806101 | 204 |
| 259 | 3300028666 | Ga0265336_10048541 | Ga0265336_100485412 | 204 |
| 260 | 3300028800 | Ga0265338_10001490 | Ga0265338_100014908 | 204 |
| 261 | 3300030760 | Ga0265762_1022676 | Ga0265762_10226762 | 204 |
| 262 | 3300033545 | Ga0316214_1007944 | Ga0316214_10079442 | 204 |
| 263 | 3300035083 | Ga0373926_0179210 | Ga0373926_0179210_34_651 | 204 |
| 264 | 3300035086 | Ga0373934_0021412 | Ga0373934_0021412_421_1038 | 204 |
| 265 | 3300035170 | Ga0373943_0385357 | Ga0373943_0385357_11_628 | 204 |
| 266 | 3300035171 | Ga0373946_0249354 | Ga0373946_0249354_39_656 | 204 |
| 267 | 3300035172 | Ga0373955_0012415 | Ga0373955_0012415_2641_3258 | 204 |
| 268 | 3300035692 | Ga0373935_0154721 | Ga0373935_0154721_18_650 | 204 |
| 269 | 3300035692 | Ga0373935_0347073 | Ga0373935_0347073_315_932 | 204 |
| 270 | 3300036401 | Ga0373937_0199772 | Ga0373937_0199772_160_777 | 204 |
| 271 | 3300037068 | Ga0373925_0000946 | Ga0373925_0000946_17315_17932 | 204 |
| 272 | 3300037068 | Ga0373925_0317317 | Ga0373925_0317317_137_754 | 204 |
| 273 | 3300037853 | Ga0436364_0360509 | Ga0436364_0360509_4139_4756 | 204 |
| 274 | 3300037853 | Ga0436364_0378794 | Ga0436364_0378794_13_630 | 204 |
| 275 | 3300037853 | Ga0436364_1336918 | Ga0436364_1336918_5833_6450 | 204 |
| 276 | 3300037853 | Ga0436364_1463345 | Ga0436364_1463345_71308_71937 | 204 |
| 277 | 3300039438 | Ga0436360_0331769 | Ga0436360_0331769_126_743 | 204 |
| 278 | 3300039447 | Ga0436361_1013087 | Ga0436361_1013087_72_689 | 204 |
| 279 | 3300039453 | Ga0436362_0272762 | Ga0436362_0272762_197_814 | 204 |
| 280 | 3300044842 | Ga0466957_0675841 | Ga0466957_0675841_12_626 | 204 |
| 281 | 3300045976 | Ga0466967_0667345 | Ga0466967_0667345_399_1016 | 204 |
| 282 | 3300046454 | Ga0495592_0005572 | Ga0495592_0005572_4734_5351 | 204 |
| 283 | 3300046459 | Ga0495629_0205153 | Ga0495629_0205153_584_1201 | 204 |
| 284 | 3300046461 | Ga0495641_0104898 | Ga0495641_0104898_201_818 | 204 |
| 285 | 3300046462 | Ga0495651_0013770 | Ga0495651_0013770_4510_5127 | 204 |
| 286 | 3300046463 | Ga0495653_0049406 | Ga0495653_0049406_2040_2657 | 204 |
| 287 | 3300046473 | Ga0495582_0263024 | Ga0495582_0263024_152_769 | 204 |
| 288 | 3300046476 | Ga0495662_0017665 | Ga0495662_0017665_2543_3160 | 204 |
| 289 | 3300046476 | Ga0495662_0185400 | Ga0495662_0185400_370_990 | 204 |
| 290 | 3300046477 | Ga0495664_0010940 | Ga0495664_0010940_632_1249 | 204 |
| 291 | 3300046514 | Ga0495618_0148422 | Ga0495618_0148422_707_1324 | 204 |
| 292 | 3300046514 | Ga0495618_0148457 | Ga0495618_0148457_10_630 | 204 |
| 293 | 3300046516 | Ga0495628_0138762 | Ga0495628_0138762_893_1510 | 204 |
| 294 | 3300046517 | Ga0495630_0088256 | Ga0495630_0088256_271_888 | 204 |
| 295 | 3300046517 | Ga0495630_0392619 | Ga0495630_0392619_55_675 | 204 |
| 296 | 3300046529 | Ga0495652_0010609 | Ga0495652_0010609_1654_2271 | 204 |
| 297 | 3300046529 | Ga0495652_0139361 | Ga0495652_0139361_406_1026 | 204 |
| 298 | 3300046529 | Ga0495652_0175212 | Ga0495652_0175212_986_1618 | 204 |
| 299 | 3300046529 | Ga0495652_0195597 | Ga0495652_0195597_713_1330 | 204 |
| 300 | 3300046531 | Ga0495665_0045996 | Ga0495665_0045996_376_993 | 204 |
| 301 | 3300046533 | Ga0495640_0008894 | Ga0495640_0008894_2108_2725 | 204 |
| 302 | 3300046536 | Ga0495587_0031277 | Ga0495587_0031277_1800_2417 | 204 |
| 303 | 3300046543 | Ga0495645_0028521 | Ga0495645_0028521_2919_3536 | 204 |
| 304 | 3300046559 | Ga0495667_0125747 | Ga0495667_0125747_585_1202 | 204 |
| 305 | 3300046559 | Ga0495667_0210965 | Ga0495667_0210965_225_854 | 204 |
| 306 | 3300046642 | Ga0495634_0173659 | Ga0495634_0173659_443_1060 | 204 |
| 307 | 3300046674 | Ga0495588_0091753 | Ga0495588_0091753_359_976 | 204 |
| 308 | 3300046675 | Ga0495657_0023842 | Ga0495657_0023842_681_1298 | 204 |
| 309 | 3300046678 | Ga0495599_0001992 | Ga0495599_0001992_9942_10559 | 204 |
| 310 | 3300046678 | Ga0495599_0069194 | Ga0495599_0069194_847_1467 | 204 |
| 311 | 3300047317 | Ga0495604_0014421 | Ga0495604_0014421_2012_2629 | 204 |
| 312 | 3300047319 | Ga0495674_0077903 | Ga0495674_0077903_1855_2472 | 204 |
| 313 | 3300047319 | Ga0495674_0341224 | Ga0495674_0341224_370_990 | 204 |
| 314 | 3300047444 | Ga0495675_0044645 | Ga0495675_0044645_1898_2515 | 204 |
| 315 | 3300047471 | Ga0495684_0006951 | Ga0495684_0006951_6656_7273 | 204 |
| 316 | 3300048905 | Ga0496102_0056828 | Ga0496102_0056828_2023_2640 | 204 |
| 317 | 3300048907 | Ga0496104_0000379 | Ga0496104_0000379_38685_39302 | 204 |
| 318 | 3300048907 | Ga0496104_0033643 | Ga0496104_0033643_3698_4315 | 204 |
| 319 | 3300048908 | Ga0496105_0003646 | Ga0496105_0003646_88_705 | 204 |
| 320 | 3300048908 | Ga0496105_0042563 | Ga0496105_0042563_2883_3500 | 204 |
| 321 | 3300048909 | Ga0496106_0109881 | Ga0496106_0109881_1426_2043 | 204 |
| 322 | 3300048909 | Ga0496106_0256095 | Ga0496106_0256095_230_847 | 204 |
| 323 | 3300048911 | Ga0496108_0010156 | Ga0496108_0010156_739_1356 | 204 |
| 324 | 3300048911 | Ga0496108_0037134 | Ga0496108_0037134_1958_2575 | 204 |
| 325 | 3300048912 | Ga0496109_0026333 | Ga0496109_0026333_3717_4334 | 204 |
| 326 | 3300048912 | Ga0496109_0048764 | Ga0496109_0048764_3031_3648 | 204 |
| 327 | 3300048918 | Ga0496115_0240645 | Ga0496115_0240645_760_1377 | 204 |
| 328 | 3300049586 | Ga0501070_0037175 | Ga0501070_0037175_1911_2531 | 204 |
| 329 | 3300049590 | Ga0501074_0319180 | Ga0501074_0319180_426_1046 | 204 |
| 330 | 3300050514 | nmdc:mga08x19_213444_c1 | nmdc:mga08x19_213444_c1_344_961 | 204 |
| 331 | 3300053078 | Ga0495612_0059072 | Ga0495612_0059072_104_724 | 204 |
| 332 | 3300053078 | Ga0495612_0087596 | Ga0495612_0087596_537_1154 | 204 |
| 333 | 3300053084 | Ga0495595_0032546 | Ga0495595_0032546_1178_1795 | 204 |
| 334 | iso_pu_bacteria | 2995463766 | 2995471561 | 204 |
| 335 | 3300009093 | Ga0105240_10006823 | Ga0105240_100068234 | 205 |
| 336 | 3300013104 | Ga0157370_10030913 | Ga0157370_100309134 | 205 |
| 337 | 3300013105 | Ga0157369_10032231 | Ga0157369_100322312 | 205 |
| 338 | 3300037312 | Ga0395899_0148635 | Ga0395899_0148635_626_1246 | 205 |
| 339 | 3300037418 | Ga0395900_0034368 | Ga0395900_0034368_2736_3356 | 205 |
| 340 | 3300037466 | Ga0395898_0033446 | Ga0395898_0033446_434_1054 | 205 |
| 341 | 3300038443 | Ga0395901_0162840 | Ga0395901_0162840_970_1590 | 205 |
| 342 | 3300044735 | Ga0466968_0048688 | Ga0466968_0048688_661_1287 | 207 |
| 343 | 3300048922 | Ga0496119_0244684 | Ga0496119_0244684_13_639 | 207 |
| 344 | 3300026116 | Ga0207674_10203370 | Ga0207674_102033702 | 208 |
| 345 | 3300005329 | Ga0070683_100167911 | Ga0070683_1001679113 | 209 |
| 346 | 3300005334 | Ga0068869_100531595 | Ga0068869_1005315951 | 209 |
| 347 | 3300005335 | Ga0070666_10052573 | Ga0070666_100525732 | 209 |
| 348 | 3300005336 | Ga0070680_100289755 | Ga0070680_1002897552 | 209 |
| 349 | 3300005340 | Ga0070689_100230671 | Ga0070689_1002306711 | 209 |
| 350 | 3300005344 | Ga0070661_100071147 | Ga0070661_1000711471 | 209 |
| 351 | 3300005354 | Ga0070675_100351684 | Ga0070675_1003516842 | 209 |
| 352 | 3300005355 | Ga0070671_100136093 | Ga0070671_1001360932 | 209 |
| 353 | 3300005364 | Ga0070673_100009103 | Ga0070673_1000091032 | 209 |
| 354 | 3300005366 | Ga0070659_100050830 | Ga0070659_1000508303 | 209 |
| 355 | 3300005434 | Ga0070709_10323509 | Ga0070709_103235092 | 209 |
| 356 | 3300005435 | Ga0070714_100036291 | Ga0070714_1000362912 | 209 |
| 357 | 3300005435 | Ga0070714_100114789 | Ga0070714_1001147893 | 209 |
| 358 | 3300005437 | Ga0070710_10062119 | Ga0070710_100621192 | 209 |
| 359 | 3300005438 | Ga0070701_10079588 | Ga0070701_100795882 | 209 |
| 360 | 3300005439 | Ga0070711_100448734 | Ga0070711_1004487341 | 209 |
| 361 | 3300005441 | Ga0070700_100461514 | Ga0070700_1004615141 | 209 |
| 362 | 3300005518 | Ga0070699_100402984 | Ga0070699_1004029842 | 209 |
| 363 | 3300005530 | Ga0070679_100240106 | Ga0070679_1002401062 | 209 |
| 364 | 3300005535 | Ga0070684_100127264 | Ga0070684_1001272642 | 209 |
| 365 | 3300005536 | Ga0070697_100507800 | Ga0070697_1005078001 | 209 |
| 366 | 3300005539 | Ga0068853_100366198 | Ga0068853_1003661982 | 209 |
| 367 | 3300005544 | Ga0070686_100056200 | Ga0070686_1000562003 | 209 |
| 368 | 3300005545 | Ga0070695_100360551 | Ga0070695_1003605512 | 209 |
| 369 | 3300005546 | Ga0070696_100055182 | Ga0070696_1000551822 | 209 |
| 370 | 3300005547 | Ga0070693_100009277 | Ga0070693_1000092772 | 209 |
| 371 | 3300005564 | Ga0070664_100304669 | Ga0070664_1003046691 | 209 |
| 372 | 3300005564 | Ga0070664_100608682 | Ga0070664_1006086822 | 209 |
| 373 | 3300005577 | Ga0068857_100142186 | Ga0068857_1001421861 | 209 |
| 374 | 3300005578 | Ga0068854_100026554 | Ga0068854_1000265542 | 209 |
| 375 | 3300005615 | Ga0070702_100025172 | Ga0070702_1000251722 | 209 |
| 376 | 3300005617 | Ga0068859_100148275 | Ga0068859_1001482752 | 209 |
| 377 | 3300005719 | Ga0068861_100175120 | Ga0068861_1001751201 | 209 |
| 378 | 3300005840 | Ga0068870_10139598 | Ga0068870_101395982 | 209 |
| 379 | 3300005841 | Ga0068863_100041127 | Ga0068863_1000411272 | 209 |
| 380 | 3300005841 | Ga0068863_100389488 | Ga0068863_1003894882 | 209 |
| 381 | 3300005842 | Ga0068858_100115674 | Ga0068858_1001156742 | 209 |
| 382 | 3300005843 | Ga0068860_100275370 | Ga0068860_1002753701 | 209 |
| 383 | 3300005844 | Ga0068862_100117793 | Ga0068862_1001177932 | 209 |
| 384 | 3300006163 | Ga0070715_10085910 | Ga0070715_100859102 | 209 |
| 385 | 3300006163 | Ga0070715_10208928 | Ga0070715_102089282 | 209 |
| 386 | 3300006173 | Ga0070716_100061224 | Ga0070716_1000612243 | 209 |
| 387 | 3300006175 | Ga0070712_100252327 | Ga0070712_1002523272 | 209 |
| 388 | 3300006871 | Ga0075434_100103207 | Ga0075434_1001032072 | 209 |
| 389 | 3300006881 | Ga0068865_100077337 | Ga0068865_1000773372 | 209 |
| 390 | 3300006914 | Ga0075436_100273009 | Ga0075436_1002730092 | 209 |
| 391 | 3300006931 | Ga0097620_100148275 | Ga0097620_1001482752 | 209 |
| 392 | 3300007076 | Ga0075435_100840634 | Ga0075435_1008406341 | 209 |
| 393 | 3300009011 | Ga0105251_10053999 | Ga0105251_100539991 | 209 |
| 394 | 3300010159 | Ga0099796_10224783 | Ga0099796_102247831 | 209 |
| 395 | 3300011119 | Ga0105246_10023695 | Ga0105246_100236952 | 209 |
| 396 | 3300013308 | Ga0157375_10362289 | Ga0157375_103622891 | 209 |
| 397 | 3300014325 | Ga0163163_10326385 | Ga0163163_103263852 | 209 |
| 398 | 3300020070 | Ga0206356_10858152 | Ga0206356_108581522 | 209 |
| 399 | 3300020082 | Ga0206353_11049559 | Ga0206353_110495592 | 209 |
| 400 | 3300022467 | Ga0224712_10013011 | Ga0224712_100130112 | 209 |
| 401 | 3300025885 | Ga0207653_10002021 | Ga0207653_100020216 | 209 |
| 402 | 3300025898 | Ga0207692_10265066 | Ga0207692_102650661 | 209 |
| 403 | 3300025901 | Ga0207688_10005447 | Ga0207688_100054472 | 209 |
| 404 | 3300025906 | Ga0207699_10004150 | Ga0207699_100041505 | 209 |
| 405 | 3300025906 | Ga0207699_10069542 | Ga0207699_100695422 | 209 |
| 406 | 3300025908 | Ga0207643_10030552 | Ga0207643_100305523 | 209 |
| 407 | 3300025910 | Ga0207684_10206361 | Ga0207684_102063611 | 209 |
| 408 | 3300025911 | Ga0207654_10305857 | Ga0207654_103058571 | 209 |
| 409 | 3300025914 | Ga0207671_10108928 | Ga0207671_101089283 | 209 |
| 410 | 3300025915 | Ga0207693_10131639 | Ga0207693_101316392 | 209 |
| 411 | 3300025916 | Ga0207663_10019696 | Ga0207663_100196963 | 209 |
| 412 | 3300025917 | Ga0207660_10191350 | Ga0207660_101913501 | 209 |
| 413 | 3300025918 | Ga0207662_10004275 | Ga0207662_100042754 | 209 |
| 414 | 3300025919 | Ga0207657_10022638 | Ga0207657_100226381 | 209 |
| 415 | 3300025921 | Ga0207652_10119326 | Ga0207652_101193263 | 209 |
| 416 | 3300025929 | Ga0207664_10297951 | Ga0207664_102979512 | 209 |
| 417 | 3300025932 | Ga0207690_10631629 | Ga0207690_106316291 | 209 |
| 418 | 3300025935 | Ga0207709_10509246 | Ga0207709_105092462 | 209 |
| 419 | 3300025936 | Ga0207670_10077628 | Ga0207670_100776281 | 209 |
| 420 | 3300025941 | Ga0207711_10660625 | Ga0207711_106606252 | 209 |
| 421 | 3300025942 | Ga0207689_10020014 | Ga0207689_100200145 | 209 |
| 422 | 3300025945 | Ga0207679_10052015 | Ga0207679_100520153 | 209 |
| 423 | 3300025949 | Ga0207667_11053728 | Ga0207667_110537281 | 209 |
| 424 | 3300025961 | Ga0207712_10158109 | Ga0207712_101581093 | 209 |
| 425 | 3300026041 | Ga0207639_10120047 | Ga0207639_101200473 | 209 |
| 426 | 3300026067 | Ga0207678_10016063 | Ga0207678_100160636 | 209 |
| 427 | 3300026078 | Ga0207702_10020452 | Ga0207702_100204521 | 209 |
| 428 | 3300026088 | Ga0207641_10132503 | Ga0207641_101325031 | 209 |
| 429 | 3300026088 | Ga0207641_10620317 | Ga0207641_106203172 | 209 |
| 430 | 3300026116 | Ga0207674_10228003 | Ga0207674_102280032 | 209 |
| 431 | 3300026116 | Ga0207674_10260062 | Ga0207674_102600622 | 209 |
| 432 | 3300026121 | Ga0207683_10069998 | Ga0207683_100699983 | 209 |
| 433 | 3300034820 | Ga0373959_0013236 | Ga0373959_0013236_328_960 | 209 |
| 434 | 3300035083 | Ga0373926_0032604 | Ga0373926_0032604_699_1331 | 209 |
| 435 | 3300035111 | Ga0373923_0063243 | Ga0373923_0063243_664_1296 | 209 |
| 436 | 3300035113 | Ga0373936_0028386 | Ga0373936_0028386_1109_1741 | 209 |
| 437 | 3300035113 | Ga0373936_0206417 | Ga0373936_0206417_169_801 | 209 |
| 438 | 3300035116 | Ga0373945_0022793 | Ga0373945_0022793_1049_1681 | 209 |
| 439 | 3300035117 | Ga0373953_0090239 | Ga0373953_0090239_76_708 | 209 |
| 440 | 3300035120 | Ga0373957_0010422 | Ga0373957_0010422_971_1603 | 209 |
| 441 | 3300035170 | Ga0373943_0004435 | Ga0373943_0004435_354_986 | 209 |
| 442 | 3300035170 | Ga0373943_0172891 | Ga0373943_0172891_103_735 | 209 |
| 443 | 3300035171 | Ga0373946_0069927 | Ga0373946_0069927_859_1491 | 209 |
| 444 | 3300035172 | Ga0373955_0033336 | Ga0373955_0033336_1754_2386 | 209 |
| 445 | 3300035172 | Ga0373955_0093467 | Ga0373955_0093467_634_1266 | 209 |
| 446 | 3300035695 | Ga0373927_0014646 | Ga0373927_0014646_887_1519 | 209 |
| 447 | 3300035724 | Ga0373933_0009754 | Ga0373933_0009754_3704_4336 | 209 |
| 448 | 3300035725 | Ga0373947_0194610 | Ga0373947_0194610_209_841 | 209 |
| 449 | 3300036401 | Ga0373937_0053710 | Ga0373937_0053710_1024_1656 | 209 |
| 450 | 3300037068 | Ga0373925_0022657 | Ga0373925_0022657_1402_2034 | 209 |
| 451 | 3300037068 | Ga0373925_0351149 | Ga0373925_0351149_96_728 | 209 |
| 452 | 3300045976 | Ga0466967_0094661 | Ga0466967_0094661_877_1509 | 209 |
| 453 | 3300046461 | Ga0495641_0007334 | Ga0495641_0007334_5531_6163 | 209 |
| 454 | 3300046462 | Ga0495651_0021813 | Ga0495651_0021813_3159_3791 | 209 |
| 455 | 3300046462 | Ga0495651_0109327 | Ga0495651_0109327_936_1568 | 209 |
| 456 | 3300046463 | Ga0495653_0057203 | Ga0495653_0057203_1229_1861 | 209 |
| 457 | 3300046476 | Ga0495662_0018322 | Ga0495662_0018322_948_1580 | 209 |
| 458 | 3300046476 | Ga0495662_0196322 | Ga0495662_0196322_284_916 | 209 |
| 459 | 3300046477 | Ga0495664_0001359 | Ga0495664_0001359_1024_1656 | 209 |
| 460 | 3300046477 | Ga0495664_0056179 | Ga0495664_0056179_1150_1782 | 209 |
| 461 | 3300046511 | Ga0495608_0084400 | Ga0495608_0084400_948_1580 | 209 |
| 462 | 3300046516 | Ga0495628_0068378 | Ga0495628_0068378_1600_2232 | 209 |
| 463 | 3300046516 | Ga0495628_0162640 | Ga0495628_0162640_674_1306 | 209 |
| 464 | 3300046517 | Ga0495630_0062897 | Ga0495630_0062897_1390_2022 | 209 |
| 465 | 3300046517 | Ga0495630_0529788 | Ga0495630_0529788_221_853 | 209 |
| 466 | 3300046529 | Ga0495652_0018557 | Ga0495652_0018557_1925_2557 | 209 |
| 467 | 3300046529 | Ga0495652_0037757 | Ga0495652_0037757_352_984 | 209 |
| 468 | 3300046536 | Ga0495587_0053159 | Ga0495587_0053159_462_1094 | 209 |
| 469 | 3300046536 | Ga0495587_0132134 | Ga0495587_0132134_372_1004 | 209 |
| 470 | 3300046543 | Ga0495645_0128725 | Ga0495645_0128725_346_978 | 209 |
| 471 | 3300046559 | Ga0495667_0034199 | Ga0495667_0034199_547_1179 | 209 |
| 472 | 3300046559 | Ga0495667_0169178 | Ga0495667_0169178_650_1282 | 209 |
| 473 | 3300046663 | Ga0495635_0035584 | Ga0495635_0035584_1875_2507 | 209 |
| 474 | 3300046663 | Ga0495635_0125886 | Ga0495635_0125886_587_1219 | 209 |
| 475 | 3300046675 | Ga0495657_0029368 | Ga0495657_0029368_2117_2749 | 209 |
| 476 | 3300046675 | Ga0495657_0037984 | Ga0495657_0037984_2203_2835 | 209 |
| 477 | 3300046675 | Ga0495657_0063434 | Ga0495657_0063434_692_1324 | 209 |
| 478 | 3300046678 | Ga0495599_0056818 | Ga0495599_0056818_508_1140 | 209 |
| 479 | 3300046678 | Ga0495599_0185014 | Ga0495599_0185014_137_769 | 209 |
| 480 | 3300046680 | Ga0495646_0061139 | Ga0495646_0061139_1018_1650 | 209 |
| 481 | 3300046690 | Ga0495624_0007142 | Ga0495624_0007142_601_1233 | 209 |
| 482 | 3300046809 | Ga0495600_0090349 | Ga0495600_0090349_949_1581 | 209 |
| 483 | 3300046809 | Ga0495600_0119277 | Ga0495600_0119277_378_1010 | 209 |
| 484 | 3300046809 | Ga0495600_0336879 | Ga0495600_0336879_51_683 | 209 |
| 485 | 3300047317 | Ga0495604_0075260 | Ga0495604_0075260_1243_1875 | 209 |
| 486 | 3300047319 | Ga0495674_0058742 | Ga0495674_0058742_565_1197 | 209 |
| 487 | 3300047319 | Ga0495674_0218662 | Ga0495674_0218662_717_1349 | 209 |
| 488 | 3300047321 | Ga0495676_0145894 | Ga0495676_0145894_10_642 | 209 |
| 489 | 3300047322 | Ga0495680_0019660 | Ga0495680_0019660_3958_4590 | 209 |
| 490 | 3300047322 | Ga0495680_0083599 | Ga0495680_0083599_1662_2294 | 209 |
| 491 | 3300047322 | Ga0495680_0090283 | Ga0495680_0090283_724_1356 | 209 |
| 492 | 3300047444 | Ga0495675_0078204 | Ga0495675_0078204_1147_1779 | 209 |
| 493 | 3300047471 | Ga0495684_0016877 | Ga0495684_0016877_876_1508 | 209 |
| 494 | 3300047471 | Ga0495684_0029249 | Ga0495684_0029249_477_1109 | 209 |
| 495 | 3300047471 | Ga0495684_0294190 | Ga0495684_0294190_456_1088 | 209 |
| 496 | 3300048088 | Ga0495602_0046260 | Ga0495602_0046260_667_1299 | 209 |
| 497 | 3300048088 | Ga0495602_0101420 | Ga0495602_0101420_945_1577 | 209 |
| 498 | 3300048907 | Ga0496104_0244494 | Ga0496104_0244494_349_981 | 209 |
| 499 | 3300048908 | Ga0496105_0318676 | Ga0496105_0318676_132_785 | 209 |
| 500 | 3300048915 | Ga0496112_0224441 | Ga0496112_0224441_287_919 | 209 |
| 501 | 3300050513 | nmdc:mga0rr50_719069_c1 | nmdc:mga0rr50_719069_c1_67_699 | 209 |
| 502 | 3300053078 | Ga0495612_0027311 | Ga0495612_0027311_61_693 | 209 |
| 503 | 3300053085 | Ga0495619_0281806 | Ga0495619_0281806_501_1133 | 209 |
| 504 | 3300050510 | nmdc:mga06r32_1726_c1 | nmdc:mga06r32_1726_c1_9908_10540 | 210 |
| 505 | 3300047319 | Ga0495674_0224639 | Ga0495674_0224639_612_1307 | 212 |
| 506 | 3300049571 | Ga0501034_0029357 | Ga0501034_0029357_453_1094 | 212 |
| 507 | 3300049572 | Ga0501036_0000627 | Ga0501036_0000627_20473_21114 | 212 |
| 508 | 3300049573 | Ga0501037_0006911 | Ga0501037_0006911_3579_4220 | 212 |
| 509 | 3300049574 | Ga0501038_0017684 | Ga0501038_0017684_2435_3076 | 212 |
| 510 | 3300049575 | Ga0501039_0022612 | Ga0501039_0022612_1731_2372 | 212 |
| 511 | 3300049578 | Ga0501042_0003012 | Ga0501042_0003012_5073_5714 | 212 |
| 512 | 3300049579 | Ga0501043_0002045 | Ga0501043_0002045_1354_1995 | 212 |
| 513 | 3300049581 | Ga0501047_0009755 | Ga0501047_0009755_3910_4551 | 212 |
| 514 | 3300049582 | Ga0501048_0003714 | Ga0501048_0003714_4427_5068 | 212 |
| 515 | 3300049589 | Ga0501073_0057055 | Ga0501073_0057055_1731_2372 | 212 |
| 516 | 3300049590 | Ga0501074_0000296 | Ga0501074_0000296_22928_23569 | 212 |
| 517 | 3300049823 | Ga0501044_0030529 | Ga0501044_0030529_408_1049 | 212 |
| 518 | 3300050515 | nmdc:mga0a205_165978_c1 | nmdc:mga0a205_165978_c1_1388_2053 | 212 |
| 519 | 3300006237 | Ga0097621_100253610 | Ga0097621_1002536102 | 213 |
| 520 | 3300035086 | Ga0373934_0000053 | Ga0373934_0000053_19802_20482 | 215 |
| 521 | 3300035111 | Ga0373923_0027194 | Ga0373923_0027194_460_1140 | 215 |
| 522 | 3300035118 | Ga0373954_0000809 | Ga0373954_0000809_7149_7829 | 215 |
| 523 | 3300035119 | Ga0373956_0000325 | Ga0373956_0000325_4232_4912 | 215 |
| 524 | 3300035120 | Ga0373957_0000015 | Ga0373957_0000015_35969_36649 | 215 |
| 525 | 3300035172 | Ga0373955_0000027 | Ga0373955_0000027_20465_21145 | 215 |
| 526 | 3300035410 | Ga0373924_0000084 | Ga0373924_0000084_13886_14566 | 215 |
| 527 | 3300035724 | Ga0373933_0000025 | Ga0373933_0000025_20266_20946 | 215 |
| 528 | 3300036401 | Ga0373937_0000034 | Ga0373937_0000034_102911_103591 | 215 |
| 529 | 3300046454 | Ga0495592_0000016 | Ga0495592_0000016_69793_70473 | 215 |
| 530 | 3300046462 | Ga0495651_0000005 | Ga0495651_0000005_102927_103607 | 215 |
| 531 | 3300046463 | Ga0495653_0001819 | Ga0495653_0001819_12401_13081 | 215 |
| 532 | 3300046511 | Ga0495608_0000057 | Ga0495608_0000057_20266_20946 | 215 |
| 533 | 3300046516 | Ga0495628_0000073 | Ga0495628_0000073_9160_9840 | 215 |
| 534 | 3300046529 | Ga0495652_0000054 | Ga0495652_0000054_41442_42122 | 215 |
| 535 | 3300046536 | Ga0495587_0000030 | Ga0495587_0000030_102898_103578 | 215 |
| 536 | 3300046559 | Ga0495667_0000025 | Ga0495667_0000025_69790_70470 | 215 |
| 537 | 3300046675 | Ga0495657_0000018 | Ga0495657_0000018_102928_103608 | 215 |
| 538 | 3300046678 | Ga0495599_0000054 | Ga0495599_0000054_20147_20827 | 215 |
| 539 | 3300046679 | Ga0495623_0000582 | Ga0495623_0000582_15570_16250 | 215 |
| 540 | 3300046680 | Ga0495646_0013644 | Ga0495646_0013644_3302_3982 | 215 |
| 541 | 3300046809 | Ga0495600_0022171 | Ga0495600_0022171_752_1432 | 215 |
| 542 | 3300047317 | Ga0495604_0000066 | Ga0495604_0000066_69790_70470 | 215 |
| 543 | 3300047322 | Ga0495680_0000032 | Ga0495680_0000032_37992_38672 | 215 |
| 544 | 3300047444 | Ga0495675_0002070 | Ga0495675_0002070_8326_9006 | 215 |
| 545 | 3300048088 | Ga0495602_0000123 | Ga0495602_0000123_2525_3205 | 215 |
| 546 | 3300003373 | JGI25407J50210_10026532 | JGI25407J50210_100265322 | 216 |
| 547 | 3300005445 | Ga0070708_100623903 | Ga0070708_1006239031 | 216 |
| 548 | 3300005937 | Ga0081455_10000298 | Ga0081455_1000029849 | 216 |
| 549 | 3300006846 | Ga0075430_100066567 | Ga0075430_1000665671 | 216 |
| 550 | 3300006847 | Ga0075431_100001963 | Ga0075431_10000196312 | 216 |
| 551 | 3300006847 | Ga0075431_100021939 | Ga0075431_1000219392 | 216 |
| 552 | 3300006880 | Ga0075429_100011256 | Ga0075429_1000112564 | 216 |
| 553 | 3300025922 | Ga0207646_10594701 | Ga0207646_105947012 | 216 |
| 554 | 3300027907 | Ga0207428_10025216 | Ga0207428_100252165 | 216 |
| 555 | 3300046678 | Ga0495599_0125415 | Ga0495599_0125415_39_716 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wkw-assembly2.cif.gz_B | crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing | 0.9807 | 20 | 214 |
| 4wkw-assembly2.cif.gz_B | crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing | 0.96 | 20 | 214 |
| 4wkw-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing | 0.9501 | 18 | 214 |
| 4zil-assembly1.cif.gz_B | crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state | 0.9438 | 19 | 216 |
| 4nxi-assembly1.cif.gz_B | rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis | 0.9325 | 19 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wkwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9807 | 20 | 214 | 3.40.30.10 |
| 4wkwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.96 | 20 | 214 | 3.40.30.10 |
| af_P9WLE7_3_196_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8323 | 21 | 210 | 3.40.30.10 |
| 3touA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8102 | 21 | 56 | 3.40.30.10 |
| af_P9WLE7_3_196_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8087 | 21 | 210 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V3N138-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9907 | 20 | 149 |
|
| AF-A0A372JL95-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9866 | 18 | 216 |
|
| AF-A0A1C6MN74-F1-model_v4 | DSBA-like thioredoxin domain-containing protein | 0.986 | 18 | 216 |
|
| AF-A0A6N7GI81-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9854 | 18 | 216 |
|
| AF-A0A4Q1L040-F1-model_v4 | Disulfide bond formation protein DsbA | 0.9811 | 19 | 216 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar