F463147

General Info

Members Datasets Scaffolds Average Seq Length
555 270 548 207

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0224639|Ga0495674_0224639_612_1307
Length 231
Sequence MSPADRPFCGIRTVLLWLKVHMPLHESTEQVPAQVDFWFDPICPWAWITSRWILEVQKVRPVNITWHVMSLSVLNEDKDDLPEQYRELLQTGWGPVRVLIAAEQAHGPEVLGPLYTALGTRFHHEKAPRDRETIEAALAEAGLPAHLADAMDSTDYDAALRASHTEGIERVGYDVGTPVITVNGLSVFGPVVSPIPRGEAAARLWDGVLLIAGTEGFFELKRSRTRDPIFD

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
4 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
5 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
6 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
270 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.22
Metatranscriptomes 2.52
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.88
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10026532 3300003373 Bacteria 1503
2 Ga0070658_10001528 3300005327 Bacteria 19605
3 Ga0070683_100167911 3300005329 Bacteria 2082
4 Ga0070683_100295778 3300005329 Bacteria 1540
5 Ga0068869_100531595 3300005334 Bacteria 985
6 Ga0070666_10052573 3300005335 Bacteria 2745
7 Ga0070680_100001058 3300005336 Bacteria 19716
8 Ga0070680_100289755 3300005336 Bacteria 1387
9 Ga0070660_100080911 3300005339 Bacteria 2550
10 Ga0070689_100230671 3300005340 Bacteria 1522
11 Ga0070661_100071147 3300005344 Bacteria 2559
12 Ga0070668_100020039 3300005347 Bacteria 5043
13 Ga0070675_100351684 3300005354 Bacteria 1307
14 Ga0070671_100136093 3300005355 Bacteria 2071
15 Ga0070674_100691619 3300005356 Bacteria 871
16 Ga0070673_100009103 3300005364 Bacteria 6648
17 Ga0070659_100050830 3300005366 Bacteria 3258
18 Ga0070659_100909453 3300005366 Bacteria 769
19 Ga0070667_100035056 3300005367 Bacteria 4202
20 Ga0070709_10026042 3300005434 Bacteria 3461
21 Ga0070709_10086653 3300005434 Bacteria 2056
22 Ga0070709_10323509 3300005434 Bacteria 1132
23 Ga0070714_100000680 3300005435 Bacteria 23985
24 Ga0070714_100026874 3300005435 Bacteria 4760
25 Ga0070714_100032593 3300005435 Bacteria 4351
26 Ga0070714_100036291 3300005435 Bacteria 4133
27 Ga0070714_100081330 3300005435 Bacteria 2820
28 Ga0070714_100114789 3300005435 Bacteria 2389
29 Ga0070714_100139918 3300005435 Bacteria 2171
30 Ga0070714_100251036 3300005435 Bacteria 1636
31 Ga0070714_100372699 3300005435 Bacteria 1344
32 Ga0070714_100482789 3300005435 Bacteria 1180
33 Ga0070713_100653507 3300005436 Bacteria 1001
34 Ga0070713_100819485 3300005436 Bacteria 893
35 Ga0070710_10012246 3300005437 Bacteria 4254
36 Ga0070710_10062119 3300005437 Bacteria 2129
37 Ga0070710_10066666 3300005437 Bacteria 2064
38 Ga0070710_10288758 3300005437 Bacteria 1067
39 Ga0070710_10363940 3300005437 Bacteria 960
40 Ga0070710_10490162 3300005437 Bacteria 840
41 Ga0070701_10079588 3300005438 Bacteria 1771
42 Ga0070711_100039417 3300005439 Bacteria 3182
43 Ga0070711_100051486 3300005439 Bacteria 2828
44 Ga0070711_100446953 3300005439 Bacteria 1057
45 Ga0070711_100448734 3300005439 Bacteria 1055
46 Ga0070700_100461514 3300005441 Bacteria 969
47 Ga0070708_100059206 3300005445 Bacteria 3414
48 Ga0070708_100100957 3300005445 Bacteria 2641
49 Ga0070708_100623903 3300005445 Bacteria 1016
50 Ga0070681_10006754 3300005458 Bacteria 11166
51 Ga0070681_10393932 3300005458 Bacteria 1296
52 Ga0070706_100003775 3300005467 Bacteria 14784
53 Ga0070706_100006621 3300005467 Bacteria 10928
54 Ga0070706_100008872 3300005467 Bacteria 9365
55 Ga0070706_100013498 3300005467 Bacteria 7556
56 Ga0070706_100017317 3300005467 Bacteria 6650
57 Ga0070706_100051472 3300005467 Bacteria 3801
58 Ga0070706_100054929 3300005467 Bacteria 3676
59 Ga0070706_100073303 3300005467 Bacteria 3169
60 Ga0070706_100127734 3300005467 Bacteria 2371
61 Ga0070706_100253261 3300005467 Bacteria 1644
62 Ga0070707_100000099 3300005468 Bacteria 78915
63 Ga0070707_100059424 3300005468 Bacteria 3668
64 Ga0070707_100070467 3300005468 Bacteria 3367
65 Ga0070707_100114435 3300005468 Bacteria 2617
66 Ga0070707_100245641 3300005468 Bacteria 1742
67 Ga0070707_100302217 3300005468 Bacteria 1555
68 Ga0070698_100000057 3300005471 Bacteria 79148
69 Ga0070698_100001403 3300005471 Bacteria 26681
70 Ga0070698_100003947 3300005471 Bacteria 16312
71 Ga0070698_100016931 3300005471 Bacteria 7685
72 Ga0070698_100028229 3300005471 Bacteria 5830
73 Ga0070698_100051939 3300005471 Bacteria 4173
74 Ga0070698_100060560 3300005471 Bacteria 3821
75 Ga0070698_100303289 3300005471 Bacteria 1528
76 Ga0070698_100401080 3300005471 Bacteria 1305
77 Ga0070699_100015608 3300005518 Bacteria 6524
78 Ga0070699_100051463 3300005518 Bacteria 3565
79 Ga0070699_100093494 3300005518 Bacteria 2631
80 Ga0070699_100402984 3300005518 Bacteria 1237
81 Ga0070679_100005432 3300005530 Bacteria 11812
82 Ga0070679_100024438 3300005530 Bacteria 5920
83 Ga0070679_100240106 3300005530 Bacteria 1769
84 Ga0070679_100273502 3300005530 Bacteria 1643
85 Ga0070684_100127264 3300005535 Bacteria 2295
86 Ga0070684_100148588 3300005535 Bacteria 2122
87 Ga0070684_100222133 3300005535 Bacteria 1723
88 Ga0070684_100345606 3300005535 Bacteria 1368
89 Ga0070697_100175535 3300005536 Bacteria 1815
90 Ga0070697_100507800 3300005536 Bacteria 1055
91 Ga0070697_100709780 3300005536 Bacteria 887
92 Ga0068853_100366198 3300005539 Bacteria 1344
93 Ga0070686_100056200 3300005544 Bacteria 2523
94 Ga0070695_100360551 3300005545 Bacteria 1091
95 Ga0070696_100055182 3300005546 Bacteria 2770
96 Ga0070693_100009277 3300005547 Bacteria 4888
97 Ga0070665_100238015 3300005548 Bacteria 1821
98 Ga0068855_100009145 3300005563 Bacteria 11966
99 Ga0068855_100494964 3300005563 Bacteria 1329
100 Ga0068855_100793321 3300005563 Bacteria 1007
101 Ga0070664_100304669 3300005564 Bacteria 1440
102 Ga0070664_100608682 3300005564 Bacteria 1013
103 Ga0068857_100142186 3300005577 Bacteria 2169
104 Ga0068857_100176265 3300005577 Bacteria 1945
105 Ga0068857_100518665 3300005577 Bacteria 1120
106 Ga0068857_101045423 3300005577 Bacteria 787
107 Ga0068854_100026554 3300005578 Bacteria 3981
108 Ga0068856_100048503 3300005614 Bacteria 4186
109 Ga0068856_100461196 3300005614 Bacteria 1291
110 Ga0068856_100531143 3300005614 Bacteria 1197
111 Ga0068856_100756805 3300005614 Bacteria 991
112 Ga0070702_100025172 3300005615 Bacteria 3185
113 Ga0068852_100461552 3300005616 Bacteria 1259
114 Ga0068859_100148275 3300005617 Bacteria 2421
115 Ga0068859_101155805 3300005617 Bacteria 852
116 Ga0068864_100160392 3300005618 Bacteria 2044
117 Ga0068861_100175120 3300005719 Bacteria 1781
118 Ga0068870_10139598 3300005840 Bacteria 1417
119 Ga0068863_100041127 3300005841 Bacteria 4394
120 Ga0068863_100274159 3300005841 Bacteria 1633
121 Ga0068863_100389488 3300005841 Bacteria 1362
122 Ga0068863_100497111 3300005841 Bacteria 1201
123 Ga0068858_100115674 3300005842 Bacteria 2506
124 Ga0068860_100275370 3300005843 Bacteria 1643
125 Ga0068862_100117793 3300005844 Bacteria 2338
126 Ga0081455_10000298 3300005937 Bacteria 65765
127 Ga0081455_10004995 3300005937 Bacteria 14669
128 Ga0081538_10000172 3300005981 Bacteria 69506
129 Ga0070717_10105387 3300006028 Bacteria 2400
130 Ga0070717_10153398 3300006028 Bacteria 1994
131 Ga0070717_10174006 3300006028 Bacteria 1873
132 Ga0070717_10224206 3300006028 Bacteria 1653
133 Ga0070717_10781022 3300006028 Bacteria 869
134 Ga0070715_10006535 3300006163 Bacteria 3971
135 Ga0070715_10081417 3300006163 Bacteria 1470
136 Ga0070715_10085910 3300006163 Bacteria 1438
137 Ga0070715_10208928 3300006163 Bacteria 996
138 Ga0070716_100013454 3300006173 Bacteria 4170
139 Ga0070716_100061224 3300006173 Bacteria 2177
140 Ga0070716_100075502 3300006173 Bacteria 1995
141 Ga0070712_100066264 3300006175 Bacteria 2566
142 Ga0070712_100099106 3300006175 Bacteria 2150
143 Ga0070712_100252327 3300006175 Bacteria 1410
144 Ga0070712_100421388 3300006175 Bacteria 1106
145 Ga0097621_100253610 3300006237 Bacteria 1541
146 Ga0068871_100390481 3300006358 Bacteria 1238
147 Ga0075430_100066567 3300006846 Bacteria 3025
148 Ga0075431_100001963 3300006847 Bacteria 19621
149 Ga0075431_100021939 3300006847 Bacteria 6528
150 Ga0075434_100103207 3300006871 Bacteria 2859
151 Ga0075434_100290148 3300006871 Bacteria 1656
152 Ga0075429_100011256 3300006880 Bacteria 7742
153 Ga0068865_100077337 3300006881 Bacteria 2378
154 Ga0075436_100138665 3300006914 Bacteria 1708
155 Ga0075436_100273009 3300006914 Bacteria 1208
156 Ga0097620_100148275 3300006931 Bacteria 2421
157 Ga0097620_101156164 3300006931 Bacteria 852
158 Ga0075435_100840634 3300007076 Bacteria 800
159 Ga0099794_10102355 3300007265 Bacteria 1430
160 Ga0105251_10053999 3300009011 Bacteria 1909
161 Ga0105240_10006823 3300009093 Bacteria 16700
162 Ga0105240_10331744 3300009093 Bacteria 1731
163 Ga0111539_10017115 3300009094 Bacteria 8973
164 Ga0105245_10022733 3300009098 Bacteria 5503
165 Ga0105247_10110550 3300009101 Bacteria 1768
166 Ga0114129_10214373 3300009147 Bacteria 2601
167 Ga0105242_10118796 3300009176 Bacteria 2265
168 Ga0105249_10497062 3300009553 Bacteria 1264
169 Ga0099796_10224783 3300010159 Bacteria 770
170 Ga0105239_10642627 3300010375 Bacteria 1212
171 Ga0105246_10023695 3300011119 Bacteria 3975
172 Ga0157370_10030913 3300013104 Bacteria 5245
173 Ga0157370_10361866 3300013104 Bacteria 1337
174 Ga0157370_10478468 3300013104 Bacteria 1144
175 Ga0157370_10707181 3300013104 Bacteria 920
176 Ga0157369_10032231 3300013105 Bacteria 5764
177 Ga0157369_10305829 3300013105 Bacteria 1654
178 Ga0157369_10688078 3300013105 Bacteria 1053
179 Ga0157374_10047464 3300013296 Bacteria 3982
180 Ga0163162_10240209 3300013306 Bacteria 1942
181 Ga0157372_10426469 3300013307 Bacteria 1546
182 Ga0157372_11232780 3300013307 Bacteria 864
183 Ga0157375_10192017 3300013308 Bacteria 2197
184 Ga0157375_10362289 3300013308 Bacteria 1616
185 Ga0157375_11051676 3300013308 Bacteria 952
186 Ga0163163_10097356 3300014325 Bacteria 2962
187 Ga0163163_10222750 3300014325 Bacteria 1935
188 Ga0163163_10326385 3300014325 Bacteria 1589
189 Ga0157379_10003574 3300014968 Bacteria 13173
190 Ga0157376_10030150 3300014969 Bacteria 4327
191 Ga0206356_10079390 3300020070 Bacteria 703
192 Ga0206356_10858152 3300020070 Bacteria 1965
193 Ga0206355_1707556 3300020076 Bacteria 1064
194 Ga0206351_10334080 3300020077 Bacteria 1461
195 Ga0206354_11234884 3300020081 Bacteria 680
196 Ga0206353_10353071 3300020082 Bacteria 34977
197 Ga0206353_11049559 3300020082 Bacteria 1518
198 Ga0213875_10002903 3300021388 Bacteria 10011
199 Ga0213875_10003162 3300021388 Bacteria 9468
200 Ga0213875_10005542 3300021388 Bacteria 6759
201 Ga0213875_10011884 3300021388 Bacteria 4316
202 Ga0224712_10013011 3300022467 Bacteria 2637
203 Ga0224712_10075106 3300022467 Bacteria 1382
204 Ga0224712_10084406 3300022467 Bacteria 1318
205 Ga0224712_10203796 3300022467 Bacteria 900
206 Ga0224712_10209247 3300022467 Bacteria 889
207 Ga0224712_10214792 3300022467 Bacteria 878
208 Ga0228600_1007971 3300024123 Bacteria 801
209 Ga0207653_10002021 3300025885 Bacteria 6477
210 Ga0207692_10002193 3300025898 Bacteria 7467
211 Ga0207692_10184580 3300025898 Bacteria 1217
212 Ga0207692_10265066 3300025898 Bacteria 1034
213 Ga0207692_10289022 3300025898 Bacteria 994
214 Ga0207692_10373979 3300025898 Bacteria 883
215 Ga0207688_10005447 3300025901 Bacteria 6918
216 Ga0207685_10022730 3300025905 Bacteria 2124
217 Ga0207685_10199739 3300025905 Bacteria 938
218 Ga0207685_10272829 3300025905 Bacteria 827
219 Ga0207699_10004150 3300025906 Bacteria 6936
220 Ga0207699_10005417 3300025906 Bacteria 6110
221 Ga0207699_10053042 3300025906 Bacteria 2403
222 Ga0207699_10069542 3300025906 Bacteria 2147
223 Ga0207643_10030552 3300025908 Bacteria 2999
224 Ga0207705_10002552 3300025909 Bacteria 13998
225 Ga0207684_10007038 3300025910 Bacteria 10174
226 Ga0207684_10028508 3300025910 Bacteria 4757
227 Ga0207684_10030012 3300025910 Bacteria 4629
228 Ga0207684_10081557 3300025910 Bacteria 2753
229 Ga0207684_10081851 3300025910 Bacteria 2748
230 Ga0207684_10092287 3300025910 Bacteria 2580
231 Ga0207684_10206361 3300025910 Bacteria 1695
232 Ga0207684_10234507 3300025910 Bacteria 1583
233 Ga0207684_10291055 3300025910 Bacteria 1408
234 Ga0207654_10305857 3300025911 Bacteria 1083
235 Ga0207707_10001870 3300025912 Bacteria 19239
236 Ga0207671_10108928 3300025914 Bacteria 2106
237 Ga0207693_10001994 3300025915 Bacteria 17915
238 Ga0207693_10040554 3300025915 Bacteria 3667
239 Ga0207693_10131639 3300025915 Bacteria 1966
240 Ga0207693_10137599 3300025915 Bacteria 1920
241 Ga0207693_10189644 3300025915 Bacteria 1618
242 Ga0207663_10019696 3300025916 Bacteria 3807
243 Ga0207663_10181583 3300025916 Bacteria 1503
244 Ga0207663_10197403 3300025916 Bacteria 1449
245 Ga0207663_10294477 3300025916 Bacteria 1210
246 Ga0207663_10368759 3300025916 Bacteria 1091
247 Ga0207660_10000283 3300025917 Bacteria 33496
248 Ga0207660_10191350 3300025917 Bacteria 1593
249 Ga0207662_10004275 3300025918 Bacteria 7499
250 Ga0207657_10022638 3300025919 Bacteria 5874
251 Ga0207657_10115550 3300025919 Bacteria 2212
252 Ga0207652_10000792 3300025921 Bacteria 30180
253 Ga0207652_10119326 3300025921 Bacteria 2345
254 Ga0207652_10292138 3300025921 Bacteria 1471
255 Ga0207646_10020733 3300025922 Bacteria 6086
256 Ga0207646_10023758 3300025922 Bacteria 5625
257 Ga0207646_10050956 3300025922 Bacteria 3704
258 Ga0207646_10158336 3300025922 Bacteria 2043
259 Ga0207646_10186433 3300025922 Bacteria 1874
260 Ga0207646_10192941 3300025922 Bacteria 1840
261 Ga0207646_10245408 3300025922 Bacteria 1618
262 Ga0207646_10509897 3300025922 Bacteria 1083
263 Ga0207646_10594701 3300025922 Bacteria 993
264 Ga0207687_10144697 3300025927 Bacteria 1807
265 Ga0207700_10094684 3300025928 Bacteria 2367
266 Ga0207700_10135247 3300025928 Bacteria 2018
267 Ga0207700_10148282 3300025928 Bacteria 1936
268 Ga0207700_10523692 3300025928 Bacteria 1051
269 Ga0207700_10874514 3300025928 Bacteria 804
270 Ga0207664_10001098 3300025929 Bacteria 18046
271 Ga0207664_10029688 3300025929 Bacteria 4167
272 Ga0207664_10075730 3300025929 Bacteria 2721
273 Ga0207664_10083611 3300025929 Bacteria 2602
274 Ga0207664_10098290 3300025929 Bacteria 2413
275 Ga0207664_10113486 3300025929 Bacteria 2256
276 Ga0207664_10297951 3300025929 Bacteria 1418
277 Ga0207664_10403634 3300025929 Bacteria 1216
278 Ga0207690_10631629 3300025932 Bacteria 876
279 Ga0207686_10460751 3300025934 Bacteria 980
280 Ga0207709_10509246 3300025935 Bacteria 941
281 Ga0207670_10077628 3300025936 Bacteria 2314
282 Ga0207665_10000894 3300025939 Bacteria 20058
283 Ga0207665_10018309 3300025939 Bacteria 4601
284 Ga0207665_10075528 3300025939 Bacteria 2309
285 Ga0207711_10229371 3300025941 Bacteria 1700
286 Ga0207711_10660625 3300025941 Bacteria 975
287 Ga0207689_10020014 3300025942 Bacteria 5637
288 Ga0207661_10161083 3300025944 Bacteria 1947
289 Ga0207679_10052015 3300025945 Bacteria 3002
290 Ga0207667_10043494 3300025949 Bacteria 4766
291 Ga0207667_10180384 3300025949 Bacteria 2169
292 Ga0207667_11053728 3300025949 Bacteria 798
293 Ga0207651_10406057 3300025960 Bacteria 1160
294 Ga0207712_10158109 3300025961 Bacteria 1758
295 Ga0207640_11027071 3300025981 Bacteria 726
296 Ga0207658_10079161 3300025986 Bacteria 2513
297 Ga0207703_10078473 3300026035 Bacteria 2743
298 Ga0207639_10120047 3300026041 Bacteria 2158
299 Ga0207678_10016063 3300026067 Bacteria 6573
300 Ga0207702_10020452 3300026078 Bacteria 5483
301 Ga0207702_10088410 3300026078 Bacteria 2706
302 Ga0207702_10090053 3300026078 Bacteria 2684
303 Ga0207641_10093352 3300026088 Bacteria 2638
304 Ga0207641_10132503 3300026088 Bacteria 2239
305 Ga0207641_10594386 3300026088 Bacteria 1083
306 Ga0207641_10620317 3300026088 Bacteria 1060
307 Ga0207676_10168489 3300026095 Bacteria 1906
308 Ga0207674_10128353 3300026116 Bacteria 2500
309 Ga0207674_10203370 3300026116 Bacteria 1930
310 Ga0207674_10228003 3300026116 Bacteria 1811
311 Ga0207674_10260062 3300026116 Bacteria 1683
312 Ga0207683_10069998 3300026121 Bacteria 3099
313 Ga0207683_11280610 3300026121 Bacteria 679
314 Ga0207698_10345267 3300026142 Bacteria 1404
315 Ga0207428_10025216 3300027907 Bacteria 4978
316 Ga0265336_10048541 3300028666 Bacteria 1287
317 Ga0307515_10090850 3300028794 Bacteria 3824
318 Ga0265338_10001490 3300028800 Bacteria 37899
319 Ga0265762_1022676 3300030760 Bacteria 1162
320 Ga0307516_10419673 3300031730 Bacteria 996
321 Ga0307405_10002762 3300031731 Bacteria 7868
322 Ga0307410_10064338 3300031852 Bacteria 2520
323 Ga0307407_10508096 3300031903 Bacteria 884
324 Ga0307412_10172458 3300031911 Bacteria 1619
325 Ga0307409_100000452 3300031995 Bacteria 17397
326 Ga0307416_100000505 3300032002 Bacteria 19894
327 Ga0307416_100133157 3300032002 Bacteria 2243
328 Ga0307415_100001254 3300032126 Bacteria 11927
329 Ga0307415_101237993 3300032126 Bacteria 705
330 Ga0307507_10029089 3300033179 Bacteria 5868
331 Ga0307507_10068751 3300033179 Bacteria 3229
332 Ga0307510_10094315 3300033180 Bacteria 2819
333 Ga0316214_1007944 3300033545 Bacteria 1422
334 Ga0373959_0013236 3300034820 Bacteria 1485
335 Ga0373926_0020750 3300035083 Bacteria 2271
336 Ga0373926_0032604 3300035083 Bacteria 1838
337 Ga0373926_0179210 3300035083 Bacteria 812
338 Ga0373934_0000053 3300035086 Bacteria 39071
339 Ga0373934_0021412 3300035086 Bacteria 2489
340 Ga0373923_0027194 3300035111 Bacteria 2281
341 Ga0373923_0063243 3300035111 Bacteria 1576
342 Ga0373923_0143704 3300035111 Bacteria 1080
343 Ga0373936_0028386 3300035113 Bacteria 2199
344 Ga0373936_0206417 3300035113 Bacteria 868
345 Ga0373945_0022793 3300035116 Bacteria 2159
346 Ga0373953_0090239 3300035117 Bacteria 1281
347 Ga0373954_0000809 3300035118 Bacteria 12111
348 Ga0373956_0000325 3300035119 Bacteria 19198
349 Ga0373957_0000015 3300035120 Bacteria 43575
350 Ga0373957_0010422 3300035120 Bacteria 3073
351 Ga0373943_0004435 3300035170 Bacteria 6350
352 Ga0373943_0172891 3300035170 Bacteria 1183
353 Ga0373943_0385357 3300035170 Bacteria 807
354 Ga0373946_0069927 3300035171 Bacteria 1513
355 Ga0373946_0249354 3300035171 Bacteria 865
356 Ga0373955_0000027 3300035172 Bacteria 58251
357 Ga0373955_0012415 3300035172 Bacteria 4094
358 Ga0373955_0033336 3300035172 Bacteria 2712
359 Ga0373955_0093467 3300035172 Bacteria 1717
360 Ga0373924_0000084 3300035410 Bacteria 25342
361 Ga0373935_0154721 3300035692 Bacteria 1559
362 Ga0373935_0347073 3300035692 Bacteria 1057
363 Ga0373927_0014646 3300035695 Bacteria 5186
364 Ga0373933_0000025 3300035724 Bacteria 90735
365 Ga0373933_0009754 3300035724 Bacteria 5255
366 Ga0373947_0194610 3300035725 Bacteria 1324
367 Ga0373937_0000034 3300036401 Bacteria 116552
368 Ga0373937_0053710 3300036401 Bacteria 3695
369 Ga0373937_0199772 3300036401 Bacteria 1879
370 Ga0373925_0000946 3300037068 Bacteria 26389
371 Ga0373925_0022657 3300037068 Bacteria 4582
372 Ga0373925_0317317 3300037068 Bacteria 1260
373 Ga0373925_0351149 3300037068 Bacteria 1197
374 Ga0395899_0148635 3300037312 Bacteria 1662
375 Ga0395900_0034368 3300037418 Bacteria 5220
376 Ga0395898_0033446 3300037466 Bacteria 5131
377 Ga0436364_0360509 3300037853 Bacteria 7787
378 Ga0436364_0378794 3300037853 Bacteria 13052
379 Ga0436364_1336918 3300037853 Bacteria 10058
380 Ga0436364_1463345 3300037853 Bacteria 72937
381 Ga0395901_0162840 3300038443 Bacteria 2342
382 Ga0436360_0331769 3300039438 Bacteria 930
383 Ga0436361_1013087 3300039447 Bacteria 758
384 Ga0436362_0272762 3300039453 Bacteria 987
385 Ga0466963_0248206 3300044694 Bacteria 1249
386 Ga0466968_0048688 3300044735 Bacteria 1804
387 Ga0466970_0080697 3300044765 Bacteria 1758
388 Ga0466957_0675841 3300044842 Bacteria 727
389 Ga0466960_0206185 3300044901 Bacteria 1076
390 Ga0466959_0055634 3300045049 Bacteria 2888
391 Ga0466967_0094661 3300045976 Bacteria 2720
392 Ga0466967_0585395 3300045976 Bacteria 1100
393 Ga0466967_0667345 3300045976 Bacteria 1029
394 Ga0495592_0000016 3300046454 Bacteria 144922
395 Ga0495592_0005572 3300046454 Bacteria 9313
396 Ga0495629_0205153 3300046459 Bacteria 1362
397 Ga0495641_0007334 3300046461 Bacteria 6906
398 Ga0495641_0104898 3300046461 Bacteria 1261
399 Ga0495641_0108118 3300046461 Bacteria 1241
400 Ga0495651_0000005 3300046462 Bacteria 173396
401 Ga0495651_0013770 3300046462 Bacteria 6253
402 Ga0495651_0021813 3300046462 Bacteria 4979
403 Ga0495651_0109327 3300046462 Bacteria 2046
404 Ga0495653_0001819 3300046463 Bacteria 16822
405 Ga0495653_0049406 3300046463 Bacteria 3240
406 Ga0495653_0057203 3300046463 Bacteria 2969
407 Ga0495582_0263024 3300046473 Bacteria 990
408 Ga0495662_0017665 3300046476 Bacteria 3453
409 Ga0495662_0018322 3300046476 Bacteria 3388
410 Ga0495662_0185400 3300046476 Bacteria 1026
411 Ga0495662_0196322 3300046476 Bacteria 995
412 Ga0495664_0001359 3300046477 Bacteria 12905
413 Ga0495664_0010940 3300046477 Bacteria 5104
414 Ga0495664_0056179 3300046477 Bacteria 2341
415 Ga0495594_0036192 3300046499 Bacteria 2691
416 Ga0495608_0000057 3300046511 Bacteria 90735
417 Ga0495608_0084400 3300046511 Bacteria 2060
418 Ga0495608_0218037 3300046511 Bacteria 1198
419 Ga0495618_0148422 3300046514 Bacteria 1498
420 Ga0495618_0148457 3300046514 Bacteria 1498
421 Ga0495628_0000073 3300046516 Bacteria 79628
422 Ga0495628_0040416 3300046516 Bacteria 3727
423 Ga0495628_0068378 3300046516 Bacteria 2772
424 Ga0495628_0138762 3300046516 Bacteria 1856
425 Ga0495628_0162640 3300046516 Bacteria 1696
426 Ga0495630_0062897 3300046517 Bacteria 2788
427 Ga0495630_0088256 3300046517 Bacteria 2342
428 Ga0495630_0392619 3300046517 Bacteria 1063
429 Ga0495630_0529788 3300046517 Bacteria 903
430 Ga0495652_0000054 3300046529 Bacteria 116611
431 Ga0495652_0010609 3300046529 Bacteria 8347
432 Ga0495652_0018557 3300046529 Bacteria 6200
433 Ga0495652_0037757 3300046529 Bacteria 4188
434 Ga0495652_0139361 3300046529 Bacteria 1909
435 Ga0495652_0175212 3300046529 Bacteria 1652
436 Ga0495652_0195597 3300046529 Bacteria 1539
437 Ga0495665_0045996 3300046531 Bacteria 2318
438 Ga0495640_0008894 3300046533 Bacteria 7843
439 Ga0495587_0000030 3300046536 Bacteria 135844
440 Ga0495587_0031277 3300046536 Bacteria 3223
441 Ga0495587_0053159 3300046536 Bacteria 2388
442 Ga0495587_0132134 3300046536 Bacteria 1426
443 Ga0495645_0028521 3300046543 Bacteria 4057
444 Ga0495645_0128725 3300046543 Bacteria 1777
445 Ga0495667_0000025 3300046559 Bacteria 155090
446 Ga0495667_0034199 3300046559 Bacteria 3398
447 Ga0495667_0125747 3300046559 Bacteria 1654
448 Ga0495667_0152604 3300046559 Bacteria 1487
449 Ga0495667_0169178 3300046559 Bacteria 1404
450 Ga0495667_0210965 3300046559 Bacteria 1241
451 Ga0495667_0214430 3300046559 Bacteria 1230
452 Ga0495634_0173659 3300046642 Bacteria 1353
453 Ga0495635_0035584 3300046663 Bacteria 3453
454 Ga0495635_0125886 3300046663 Bacteria 1747
455 Ga0495588_0091753 3300046674 Bacteria 1592
456 Ga0495657_0000018 3300046675 Bacteria 173397
457 Ga0495657_0023842 3300046675 Bacteria 4366
458 Ga0495657_0029368 3300046675 Bacteria 3857
459 Ga0495657_0037984 3300046675 Bacteria 3315
460 Ga0495657_0063434 3300046675 Bacteria 2437
461 Ga0495599_0000054 3300046678 Bacteria 79938
462 Ga0495599_0001992 3300046678 Bacteria 11813
463 Ga0495599_0056818 3300046678 Bacteria 2449
464 Ga0495599_0069194 3300046678 Bacteria 2203
465 Ga0495599_0125415 3300046678 Bacteria 1596
466 Ga0495599_0185014 3300046678 Bacteria 1283
467 Ga0495623_0000582 3300046679 Bacteria 24382
468 Ga0495646_0013644 3300046680 Bacteria 5166
469 Ga0495646_0061139 3300046680 Bacteria 2244
470 Ga0495624_0007142 3300046690 Bacteria 7860
471 Ga0495600_0022171 3300046809 Bacteria 4075
472 Ga0495600_0090349 3300046809 Bacteria 1997
473 Ga0495600_0119277 3300046809 Bacteria 1716
474 Ga0495600_0336879 3300046809 Bacteria 946
475 Ga0495604_0000066 3300047317 Bacteria 90720
476 Ga0495604_0014421 3300047317 Bacteria 6304
477 Ga0495604_0075260 3300047317 Bacteria 2543
478 Ga0495674_0058742 3300047319 Bacteria 3361
479 Ga0495674_0077903 3300047319 Bacteria 2849
480 Ga0495674_0218662 3300047319 Bacteria 1575
481 Ga0495674_0224639 3300047319 Bacteria 1551
482 Ga0495674_0341224 3300047319 Bacteria 1217
483 Ga0495676_0145894 3300047321 Bacteria 1690
484 Ga0495680_0000032 3300047322 Bacteria 108460
485 Ga0495680_0019660 3300047322 Bacteria 5698
486 Ga0495680_0083599 3300047322 Bacteria 2406
487 Ga0495680_0090283 3300047322 Bacteria 2298
488 Ga0495680_0270407 3300047322 Bacteria 1200
489 Ga0495675_0002070 3300047444 Bacteria 11973
490 Ga0495675_0044645 3300047444 Bacteria 2823
491 Ga0495675_0078204 3300047444 Bacteria 2083
492 Ga0495684_0006951 3300047471 Bacteria 8787
493 Ga0495684_0016877 3300047471 Bacteria 5625
494 Ga0495684_0029249 3300047471 Bacteria 4229
495 Ga0495684_0294190 3300047471 Bacteria 1168
496 Ga0495602_0000123 3300048088 Bacteria 72994
497 Ga0495602_0046260 3300048088 Bacteria 3932
498 Ga0495602_0101420 3300048088 Bacteria 2361
499 Ga0496102_0056828 3300048905 Bacteria 3571
500 Ga0496104_0000379 3300048907 Bacteria 39343
501 Ga0496104_0033643 3300048907 Bacteria 4777
502 Ga0496104_0244494 3300048907 Bacteria 1707
503 Ga0496104_0975568 3300048907 Bacteria 752
504 Ga0496105_0003646 3300048908 Bacteria 11445
505 Ga0496105_0042563 3300048908 Bacteria 3744
506 Ga0496105_0318676 3300048908 Bacteria 1247
507 Ga0496106_0109881 3300048909 Bacteria 2146
508 Ga0496106_0256095 3300048909 Bacteria 1400
509 Ga0496108_0010156 3300048911 Bacteria 7641
510 Ga0496108_0037134 3300048911 Bacteria 4056
511 Ga0496109_0026333 3300048912 Bacteria 5186
512 Ga0496109_0048764 3300048912 Bacteria 3853
513 Ga0496112_0224441 3300048915 Bacteria 1834
514 Ga0496115_0240645 3300048918 Bacteria 1491
515 Ga0496119_0244684 3300048922 Bacteria 907
516 Ga0501034_0029357 3300049571 Bacteria 5588
517 Ga0501036_0000627 3300049572 Bacteria 25739
518 Ga0501037_0006911 3300049573 Bacteria 8285
519 Ga0501038_0017684 3300049574 Bacteria 6444
520 Ga0501038_0081933 3300049574 Bacteria 2718
521 Ga0501039_0022612 3300049575 Bacteria 4826
522 Ga0501042_0003012 3300049578 Bacteria 10481
523 Ga0501043_0002045 3300049579 Bacteria 17217
524 Ga0501047_0009755 3300049581 Bacteria 9071
525 Ga0501048_0003714 3300049582 Bacteria 11633
526 Ga0501070_0037175 3300049586 Bacteria 4065
527 Ga0501073_0057055 3300049589 Bacteria 2730
528 Ga0501074_0000296 3300049590 Bacteria 28700
529 Ga0501074_0319180 3300049590 Bacteria 1103
530 Ga0501077_0132912 3300049593 Bacteria 1578
531 Ga0501044_0030529 3300049823 Bacteria 5679
532 nmdc:mga05p37_152_c1 3300050507 Bacteria 65549
533 nmdc:mga09592_63_c1 3300050508 Bacteria 60777
534 nmdc:mga0qj67_39354_c1 3300050509 Bacteria 3712
535 nmdc:mga06r32_1726_c1 3300050510 Bacteria 19669
536 nmdc:mga06r32_9202_c1 3300050510 Bacteria 8905
537 nmdc:mga0rr50_719069_c1 3300050513 Bacteria 852
538 nmdc:mga08x19_213444_c1 3300050514 Bacteria 1325
539 nmdc:mga0a205_165978_c1 3300050515 Bacteria 2104
540 Ga0495612_0027311 3300053078 Bacteria 2295
541 Ga0495612_0059072 3300053078 Bacteria 1585
542 Ga0495612_0087596 3300053078 Bacteria 1314
543 Ga0495595_0032546 3300053084 Bacteria 2349
544 Ga0495595_0218364 3300053084 Bacteria 951
545 Ga0495619_0281806 3300053085 Bacteria 1152
546 Ga0495619_0504505 3300053085 Bacteria 832
547 Ga0500594_0056576 3300053118 Bacteria 1119
548 Ga0500588_0005290 3300053146 Bacteria 2858

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0975568 Ga0496104_0975568_62_562 160
2 3300046559 Ga0495667_0214430 Ga0495667_0214430_110_649 168
3 3300047322 Ga0495680_0270407 Ga0495680_0270407_499_1038 168
4 3300053084 Ga0495595_0218364 Ga0495595_0218364_306_845 168
5 3300053085 Ga0495619_0504505 Ga0495619_0504505_173_712 168
6 3300025981 Ga0207640_11027071 Ga0207640_110270711 184
7 3300032002 Ga0307416_100133157 Ga0307416_1001331573 187
8 3300005435 Ga0070714_100251036 Ga0070714_1002510362 188
9 3300009098 Ga0105245_10022733 Ga0105245_100227334 189
10 3300009176 Ga0105242_10118796 Ga0105242_101187962 189
11 3300009553 Ga0105249_10497062 Ga0105249_104970622 189
12 3300013307 Ga0157372_11232780 Ga0157372_112327801 189
13 3300013308 Ga0157375_11051676 Ga0157375_110516762 189
14 3300014325 Ga0163163_10222750 Ga0163163_102227502 189
15 3300005471 Ga0070698_100051939 Ga0070698_1000519392 190
16 3300005445 Ga0070708_100059206 Ga0070708_1000592064 191
17 3300025922 Ga0207646_10186433 Ga0207646_101864332 191
18 3300032126 Ga0307415_101237993 Ga0307415_1012379931 191
19 3300005467 Ga0070706_100017317 Ga0070706_1000173175 192
20 3300005471 Ga0070698_100060560 Ga0070698_1000605602 192
21 3300025910 Ga0207684_10028508 Ga0207684_100285082 192
22 3300005467 Ga0070706_100253261 Ga0070706_1002532612 193
23 3300005356 Ga0070674_100691619 Ga0070674_1006916192 194
24 3300005437 Ga0070710_10288758 Ga0070710_102887581 194
25 3300009094 Ga0111539_10017115 Ga0111539_100171155 194
26 3300009147 Ga0114129_10214373 Ga0114129_102143734 194
27 3300025898 Ga0207692_10184580 Ga0207692_101845802 194
28 3300044694 Ga0466963_0248206 Ga0466963_0248206_78_710 194
29 3300045049 Ga0466959_0055634 Ga0466959_0055634_1535_2167 194
30 3300050507 nmdc:mga05p37_152_c1 nmdc:mga05p37_152_c1_36887_37471 194
31 3300050508 nmdc:mga09592_63_c1 nmdc:mga09592_63_c1_20727_21311 194
32 3300050509 nmdc:mga0qj67_39354_c1 nmdc:mga0qj67_39354_c1_2255_2839 194
33 3300050510 nmdc:mga06r32_9202_c1 nmdc:mga06r32_9202_c1_992_1576 194
34 3300053146 Ga0500588_0005290 Ga0500588_0005290_848_1450 194
35 3300005436 Ga0070713_100819485 Ga0070713_1008194851 195
36 3300006028 Ga0070717_10781022 Ga0070717_107810221 195
37 3300025928 Ga0207700_10523692 Ga0207700_105236922 195
38 3300028794 Ga0307515_10090850 Ga0307515_100908502 195
39 3300005435 Ga0070714_100482789 Ga0070714_1004827892 196
40 3300005467 Ga0070706_100006621 Ga0070706_1000066216 196
41 3300005468 Ga0070707_100000099 Ga0070707_10000009911 196
42 3300005468 Ga0070707_100059424 Ga0070707_1000594244 196
43 3300005471 Ga0070698_100001403 Ga0070698_10000140318 196
44 3300005518 Ga0070699_100015608 Ga0070699_1000156083 196
45 3300005577 Ga0068857_100176265 Ga0068857_1001762652 196
46 3300005614 Ga0068856_100531143 Ga0068856_1005311432 196
47 3300005841 Ga0068863_100497111 Ga0068863_1004971112 196
48 3300006175 Ga0070712_100099106 Ga0070712_1000991062 196
49 3300010375 Ga0105239_10642627 Ga0105239_106426271 196
50 3300025905 Ga0207685_10022730 Ga0207685_100227302 196
51 3300025906 Ga0207699_10053042 Ga0207699_100530422 196
52 3300025915 Ga0207693_10001994 Ga0207693_100019946 196
53 3300025916 Ga0207663_10181583 Ga0207663_101815832 196
54 3300025939 Ga0207665_10018309 Ga0207665_100183092 196
55 3300026088 Ga0207641_10093352 Ga0207641_100933522 196
56 3300044765 Ga0466970_0080697 Ga0466970_0080697_31_621 196
57 3300045976 Ga0466967_0585395 Ga0466967_0585395_42_635 196
58 3300046516 Ga0495628_0040416 Ga0495628_0040416_2034_2636 196
59 3300049574 Ga0501038_0081933 Ga0501038_0081933_1170_1760 196
60 3300049593 Ga0501077_0132912 Ga0501077_0132912_913_1503 196
61 3300005329 Ga0070683_100295778 Ga0070683_1002957781 197
62 3300005435 Ga0070714_100026874 Ga0070714_1000268742 197
63 3300005436 Ga0070713_100653507 Ga0070713_1006535072 197
64 3300005437 Ga0070710_10066666 Ga0070710_100666662 197
65 3300005437 Ga0070710_10490162 Ga0070710_104901621 197
66 3300005439 Ga0070711_100446953 Ga0070711_1004469532 197
67 3300005535 Ga0070684_100345606 Ga0070684_1003456061 197
68 3300005614 Ga0068856_100461196 Ga0068856_1004611962 197
69 3300005614 Ga0068856_100756805 Ga0068856_1007568051 197
70 3300006173 Ga0070716_100075502 Ga0070716_1000755023 197
71 3300006871 Ga0075434_100290148 Ga0075434_1002901482 197
72 3300013104 Ga0157370_10707181 Ga0157370_107071811 197
73 3300013105 Ga0157369_10305829 Ga0157369_103058292 197
74 3300025898 Ga0207692_10289022 Ga0207692_102890221 197
75 3300025915 Ga0207693_10040554 Ga0207693_100405541 197
76 3300025915 Ga0207693_10189644 Ga0207693_101896442 197
77 3300025916 Ga0207663_10368759 Ga0207663_103687591 197
78 3300025928 Ga0207700_10135247 Ga0207700_101352471 197
79 3300025929 Ga0207664_10075730 Ga0207664_100757303 197
80 3300025944 Ga0207661_10161083 Ga0207661_101610831 197
81 3300026078 Ga0207702_10088410 Ga0207702_100884102 197
82 3300026088 Ga0207641_10594386 Ga0207641_105943862 197
83 3300035083 Ga0373926_0020750 Ga0373926_0020750_1161_1772 197
84 3300035111 Ga0373923_0143704 Ga0373923_0143704_185_796 197
85 3300044901 Ga0466960_0206185 Ga0466960_0206185_242_841 197
86 3300046461 Ga0495641_0108118 Ga0495641_0108118_381_992 197
87 3300046511 Ga0495608_0218037 Ga0495608_0218037_434_1045 197
88 3300046559 Ga0495667_0152604 Ga0495667_0152604_309_920 197
89 3300005347 Ga0070668_100020039 Ga0070668_1000200392 198
90 3300005467 Ga0070706_100051472 Ga0070706_1000514725 198
91 3300005467 Ga0070706_100127734 Ga0070706_1001277343 198
92 3300005468 Ga0070707_100114435 Ga0070707_1001144352 198
93 3300005471 Ga0070698_100401080 Ga0070698_1004010802 198
94 3300005536 Ga0070697_100709780 Ga0070697_1007097802 198
95 3300025910 Ga0207684_10081851 Ga0207684_100818512 198
96 3300031730 Ga0307516_10419673 Ga0307516_104196731 198
97 3300033179 Ga0307507_10029089 Ga0307507_100290897 198
98 3300033179 Ga0307507_10068751 Ga0307507_100687512 198
99 3300033180 Ga0307510_10094315 Ga0307510_100943152 198
100 iso_pu_bacteria 2891395885 2891396429 198
101 iso_pu_bacteria 2891554331 2891557894 198
102 3300005530 Ga0070679_100273502 Ga0070679_1002735022 199
103 3300005535 Ga0070684_100148588 Ga0070684_1001485882 199
104 3300031731 Ga0307405_10002762 Ga0307405_100027625 199
105 3300031852 Ga0307410_10064338 Ga0307410_100643382 199
106 3300031903 Ga0307407_10508096 Ga0307407_105080961 199
107 3300031911 Ga0307412_10172458 Ga0307412_101724582 199
108 3300031995 Ga0307409_100000452 Ga0307409_1000004528 199
109 3300032002 Ga0307416_100000505 Ga0307416_1000005052 199
110 3300032126 Ga0307415_100001254 Ga0307415_1000012544 199
111 iso_pu_bacteria 2515154155 2515855636 199
112 iso_pu_bacteria 2675903058 2676475660 199
113 iso_pu_bacteria 2827628540 2827631388 199
114 3300005563 Ga0068855_100009145 Ga0068855_1000091456 200
115 3300020076 Ga0206355_1707556 Ga0206355_17075561 200
116 3300020077 Ga0206351_10334080 Ga0206351_103340802 200
117 3300022467 Ga0224712_10084406 Ga0224712_100844063 200
118 3300025949 Ga0207667_10043494 Ga0207667_100434944 200
119 3300026142 Ga0207698_10345267 Ga0207698_103452672 200
120 3300046499 Ga0495594_0036192 Ga0495594_0036192_1398_2009 200
121 iso_pu_bacteria 8053945823 8053950021 200
122 3300005327 Ga0070658_10001528 Ga0070658_100015286 201
123 3300005336 Ga0070680_100001058 Ga0070680_10000105812 201
124 3300005339 Ga0070660_100080911 Ga0070660_1000809112 201
125 3300005458 Ga0070681_10006754 Ga0070681_100067547 201
126 3300005530 Ga0070679_100005432 Ga0070679_1000054326 201
127 3300005563 Ga0068855_100793321 Ga0068855_1007933211 201
128 3300009093 Ga0105240_10331744 Ga0105240_103317441 201
129 3300013104 Ga0157370_10478468 Ga0157370_104784682 201
130 3300013105 Ga0157369_10688078 Ga0157369_106880782 201
131 3300020082 Ga0206353_10353071 Ga0206353_1035307128 201
132 3300025909 Ga0207705_10002552 Ga0207705_1000255212 201
133 3300025912 Ga0207707_10001870 Ga0207707_1000187012 201
134 3300025917 Ga0207660_10000283 Ga0207660_1000028332 201
135 3300025919 Ga0207657_10115550 Ga0207657_101155502 201
136 3300025921 Ga0207652_10000792 Ga0207652_100007922 201
137 3300053118 Ga0500594_0056576 Ga0500594_0056576_74_703 201
138 3300025934 Ga0207686_10460751 Ga0207686_104607512 202
139 3300005445 Ga0070708_100100957 Ga0070708_1001009572 203
140 3300005467 Ga0070706_100008872 Ga0070706_1000088722 203
141 3300005471 Ga0070698_100003947 Ga0070698_10000394713 203
142 3300005518 Ga0070699_100051463 Ga0070699_1000514634 203
143 3300025910 Ga0207684_10234507 Ga0207684_102345071 203
144 3300025922 Ga0207646_10023758 Ga0207646_100237581 203
145 3300026095 Ga0207676_10168489 Ga0207676_101684892 203
146 3300005366 Ga0070659_100909453 Ga0070659_1009094531 204
147 3300005367 Ga0070667_100035056 Ga0070667_1000350562 204
148 3300005434 Ga0070709_10026042 Ga0070709_100260423 204
149 3300005434 Ga0070709_10086653 Ga0070709_100866532 204
150 3300005435 Ga0070714_100000680 Ga0070714_1000006807 204
151 3300005435 Ga0070714_100032593 Ga0070714_1000325932 204
152 3300005435 Ga0070714_100081330 Ga0070714_1000813302 204
153 3300005435 Ga0070714_100139918 Ga0070714_1001399182 204
154 3300005435 Ga0070714_100372699 Ga0070714_1003726991 204
155 3300005437 Ga0070710_10012246 Ga0070710_100122463 204
156 3300005437 Ga0070710_10363940 Ga0070710_103639401 204
157 3300005439 Ga0070711_100039417 Ga0070711_1000394172 204
158 3300005439 Ga0070711_100051486 Ga0070711_1000514862 204
159 3300005458 Ga0070681_10393932 Ga0070681_103939321 204
160 3300005467 Ga0070706_100003775 Ga0070706_1000037752 204
161 3300005467 Ga0070706_100013498 Ga0070706_1000134987 204
162 3300005467 Ga0070706_100054929 Ga0070706_1000549293 204
163 3300005467 Ga0070706_100073303 Ga0070706_1000733033 204
164 3300005468 Ga0070707_100070467 Ga0070707_1000704672 204
165 3300005468 Ga0070707_100245641 Ga0070707_1002456412 204
166 3300005468 Ga0070707_100302217 Ga0070707_1003022172 204
167 3300005471 Ga0070698_100000057 Ga0070698_10000005775 204
168 3300005471 Ga0070698_100016931 Ga0070698_1000169318 204
169 3300005471 Ga0070698_100028229 Ga0070698_1000282298 204
170 3300005471 Ga0070698_100303289 Ga0070698_1003032892 204
171 3300005518 Ga0070699_100093494 Ga0070699_1000934942 204
172 3300005530 Ga0070679_100024438 Ga0070679_1000244382 204
173 3300005535 Ga0070684_100222133 Ga0070684_1002221332 204
174 3300005536 Ga0070697_100175535 Ga0070697_1001755352 204
175 3300005548 Ga0070665_100238015 Ga0070665_1002380152 204
176 3300005563 Ga0068855_100494964 Ga0068855_1004949642 204
177 3300005577 Ga0068857_100518665 Ga0068857_1005186652 204
178 3300005577 Ga0068857_101045423 Ga0068857_1010454231 204
179 3300005614 Ga0068856_100048503 Ga0068856_1000485032 204
180 3300005616 Ga0068852_100461552 Ga0068852_1004615522 204
181 3300005617 Ga0068859_101155805 Ga0068859_1011558051 204
182 3300005618 Ga0068864_100160392 Ga0068864_1001603923 204
183 3300005841 Ga0068863_100274159 Ga0068863_1002741592 204
184 3300005937 Ga0081455_10004995 Ga0081455_1000499512 204
185 3300005981 Ga0081538_10000172 Ga0081538_1000017232 204
186 3300006028 Ga0070717_10105387 Ga0070717_101053873 204
187 3300006028 Ga0070717_10153398 Ga0070717_101533982 204
188 3300006028 Ga0070717_10174006 Ga0070717_101740062 204
189 3300006028 Ga0070717_10224206 Ga0070717_102242062 204
190 3300006163 Ga0070715_10006535 Ga0070715_100065352 204
191 3300006163 Ga0070715_10081417 Ga0070715_100814171 204
192 3300006173 Ga0070716_100013454 Ga0070716_1000134541 204
193 3300006175 Ga0070712_100066264 Ga0070712_1000662643 204
194 3300006175 Ga0070712_100421388 Ga0070712_1004213882 204
195 3300006358 Ga0068871_100390481 Ga0068871_1003904812 204
196 3300006914 Ga0075436_100138665 Ga0075436_1001386652 204
197 3300006931 Ga0097620_101156164 Ga0097620_1011561641 204
198 3300007265 Ga0099794_10102355 Ga0099794_101023552 204
199 3300009101 Ga0105247_10110550 Ga0105247_101105502 204
200 3300013104 Ga0157370_10361866 Ga0157370_103618661 204
201 3300013296 Ga0157374_10047464 Ga0157374_100474642 204
202 3300013306 Ga0163162_10240209 Ga0163162_102402091 204
203 3300013307 Ga0157372_10426469 Ga0157372_104264692 204
204 3300013308 Ga0157375_10192017 Ga0157375_101920172 204
205 3300014325 Ga0163163_10097356 Ga0163163_100973562 204
206 3300014968 Ga0157379_10003574 Ga0157379_100035747 204
207 3300014969 Ga0157376_10030150 Ga0157376_100301502 204
208 3300020070 Ga0206356_10079390 Ga0206356_100793901 204
209 3300020081 Ga0206354_11234884 Ga0206354_112348841 204
210 3300021388 Ga0213875_10002903 Ga0213875_100029035 204
211 3300021388 Ga0213875_10003162 Ga0213875_100031628 204
212 3300021388 Ga0213875_10005542 Ga0213875_100055422 204
213 3300021388 Ga0213875_10011884 Ga0213875_100118843 204
214 3300022467 Ga0224712_10075106 Ga0224712_100751061 204
215 3300022467 Ga0224712_10203796 Ga0224712_102037962 204
216 3300022467 Ga0224712_10209247 Ga0224712_102092471 204
217 3300022467 Ga0224712_10214792 Ga0224712_102147921 204
218 3300024123 Ga0228600_1007971 Ga0228600_10079712 204
219 3300025898 Ga0207692_10002193 Ga0207692_100021932 204
220 3300025898 Ga0207692_10373979 Ga0207692_103739792 204
221 3300025905 Ga0207685_10199739 Ga0207685_101997391 204
222 3300025905 Ga0207685_10272829 Ga0207685_102728291 204
223 3300025906 Ga0207699_10005417 Ga0207699_100054172 204
224 3300025910 Ga0207684_10007038 Ga0207684_100070388 204
225 3300025910 Ga0207684_10030012 Ga0207684_100300122 204
226 3300025910 Ga0207684_10081557 Ga0207684_100815572 204
227 3300025910 Ga0207684_10092287 Ga0207684_100922872 204
228 3300025910 Ga0207684_10291055 Ga0207684_102910552 204
229 3300025915 Ga0207693_10137599 Ga0207693_101375993 204
230 3300025916 Ga0207663_10197403 Ga0207663_101974032 204
231 3300025916 Ga0207663_10294477 Ga0207663_102944772 204
232 3300025921 Ga0207652_10292138 Ga0207652_102921382 204
233 3300025922 Ga0207646_10020733 Ga0207646_100207332 204
234 3300025922 Ga0207646_10050956 Ga0207646_100509562 204
235 3300025922 Ga0207646_10158336 Ga0207646_101583362 204
236 3300025922 Ga0207646_10192941 Ga0207646_101929412 204
237 3300025922 Ga0207646_10245408 Ga0207646_102454081 204
238 3300025922 Ga0207646_10509897 Ga0207646_105098972 204
239 3300025927 Ga0207687_10144697 Ga0207687_101446972 204
240 3300025928 Ga0207700_10094684 Ga0207700_100946841 204
241 3300025928 Ga0207700_10148282 Ga0207700_101482822 204
242 3300025928 Ga0207700_10874514 Ga0207700_108745141 204
243 3300025929 Ga0207664_10001098 Ga0207664_100010986 204
244 3300025929 Ga0207664_10029688 Ga0207664_100296883 204
245 3300025929 Ga0207664_10083611 Ga0207664_100836113 204
246 3300025929 Ga0207664_10098290 Ga0207664_100982901 204
247 3300025929 Ga0207664_10113486 Ga0207664_101134862 204
248 3300025929 Ga0207664_10403634 Ga0207664_104036342 204
249 3300025939 Ga0207665_10000894 Ga0207665_1000089414 204
250 3300025939 Ga0207665_10075528 Ga0207665_100755282 204
251 3300025941 Ga0207711_10229371 Ga0207711_102293712 204
252 3300025949 Ga0207667_10180384 Ga0207667_101803842 204
253 3300025960 Ga0207651_10406057 Ga0207651_104060572 204
254 3300025986 Ga0207658_10079161 Ga0207658_100791612 204
255 3300026035 Ga0207703_10078473 Ga0207703_100784732 204
256 3300026078 Ga0207702_10090053 Ga0207702_100900532 204
257 3300026116 Ga0207674_10128353 Ga0207674_101283533 204
258 3300026121 Ga0207683_11280610 Ga0207683_112806101 204
259 3300028666 Ga0265336_10048541 Ga0265336_100485412 204
260 3300028800 Ga0265338_10001490 Ga0265338_100014908 204
261 3300030760 Ga0265762_1022676 Ga0265762_10226762 204
262 3300033545 Ga0316214_1007944 Ga0316214_10079442 204
263 3300035083 Ga0373926_0179210 Ga0373926_0179210_34_651 204
264 3300035086 Ga0373934_0021412 Ga0373934_0021412_421_1038 204
265 3300035170 Ga0373943_0385357 Ga0373943_0385357_11_628 204
266 3300035171 Ga0373946_0249354 Ga0373946_0249354_39_656 204
267 3300035172 Ga0373955_0012415 Ga0373955_0012415_2641_3258 204
268 3300035692 Ga0373935_0154721 Ga0373935_0154721_18_650 204
269 3300035692 Ga0373935_0347073 Ga0373935_0347073_315_932 204
270 3300036401 Ga0373937_0199772 Ga0373937_0199772_160_777 204
271 3300037068 Ga0373925_0000946 Ga0373925_0000946_17315_17932 204
272 3300037068 Ga0373925_0317317 Ga0373925_0317317_137_754 204
273 3300037853 Ga0436364_0360509 Ga0436364_0360509_4139_4756 204
274 3300037853 Ga0436364_0378794 Ga0436364_0378794_13_630 204
275 3300037853 Ga0436364_1336918 Ga0436364_1336918_5833_6450 204
276 3300037853 Ga0436364_1463345 Ga0436364_1463345_71308_71937 204
277 3300039438 Ga0436360_0331769 Ga0436360_0331769_126_743 204
278 3300039447 Ga0436361_1013087 Ga0436361_1013087_72_689 204
279 3300039453 Ga0436362_0272762 Ga0436362_0272762_197_814 204
280 3300044842 Ga0466957_0675841 Ga0466957_0675841_12_626 204
281 3300045976 Ga0466967_0667345 Ga0466967_0667345_399_1016 204
282 3300046454 Ga0495592_0005572 Ga0495592_0005572_4734_5351 204
283 3300046459 Ga0495629_0205153 Ga0495629_0205153_584_1201 204
284 3300046461 Ga0495641_0104898 Ga0495641_0104898_201_818 204
285 3300046462 Ga0495651_0013770 Ga0495651_0013770_4510_5127 204
286 3300046463 Ga0495653_0049406 Ga0495653_0049406_2040_2657 204
287 3300046473 Ga0495582_0263024 Ga0495582_0263024_152_769 204
288 3300046476 Ga0495662_0017665 Ga0495662_0017665_2543_3160 204
289 3300046476 Ga0495662_0185400 Ga0495662_0185400_370_990 204
290 3300046477 Ga0495664_0010940 Ga0495664_0010940_632_1249 204
291 3300046514 Ga0495618_0148422 Ga0495618_0148422_707_1324 204
292 3300046514 Ga0495618_0148457 Ga0495618_0148457_10_630 204
293 3300046516 Ga0495628_0138762 Ga0495628_0138762_893_1510 204
294 3300046517 Ga0495630_0088256 Ga0495630_0088256_271_888 204
295 3300046517 Ga0495630_0392619 Ga0495630_0392619_55_675 204
296 3300046529 Ga0495652_0010609 Ga0495652_0010609_1654_2271 204
297 3300046529 Ga0495652_0139361 Ga0495652_0139361_406_1026 204
298 3300046529 Ga0495652_0175212 Ga0495652_0175212_986_1618 204
299 3300046529 Ga0495652_0195597 Ga0495652_0195597_713_1330 204
300 3300046531 Ga0495665_0045996 Ga0495665_0045996_376_993 204
301 3300046533 Ga0495640_0008894 Ga0495640_0008894_2108_2725 204
302 3300046536 Ga0495587_0031277 Ga0495587_0031277_1800_2417 204
303 3300046543 Ga0495645_0028521 Ga0495645_0028521_2919_3536 204
304 3300046559 Ga0495667_0125747 Ga0495667_0125747_585_1202 204
305 3300046559 Ga0495667_0210965 Ga0495667_0210965_225_854 204
306 3300046642 Ga0495634_0173659 Ga0495634_0173659_443_1060 204
307 3300046674 Ga0495588_0091753 Ga0495588_0091753_359_976 204
308 3300046675 Ga0495657_0023842 Ga0495657_0023842_681_1298 204
309 3300046678 Ga0495599_0001992 Ga0495599_0001992_9942_10559 204
310 3300046678 Ga0495599_0069194 Ga0495599_0069194_847_1467 204
311 3300047317 Ga0495604_0014421 Ga0495604_0014421_2012_2629 204
312 3300047319 Ga0495674_0077903 Ga0495674_0077903_1855_2472 204
313 3300047319 Ga0495674_0341224 Ga0495674_0341224_370_990 204
314 3300047444 Ga0495675_0044645 Ga0495675_0044645_1898_2515 204
315 3300047471 Ga0495684_0006951 Ga0495684_0006951_6656_7273 204
316 3300048905 Ga0496102_0056828 Ga0496102_0056828_2023_2640 204
317 3300048907 Ga0496104_0000379 Ga0496104_0000379_38685_39302 204
318 3300048907 Ga0496104_0033643 Ga0496104_0033643_3698_4315 204
319 3300048908 Ga0496105_0003646 Ga0496105_0003646_88_705 204
320 3300048908 Ga0496105_0042563 Ga0496105_0042563_2883_3500 204
321 3300048909 Ga0496106_0109881 Ga0496106_0109881_1426_2043 204
322 3300048909 Ga0496106_0256095 Ga0496106_0256095_230_847 204
323 3300048911 Ga0496108_0010156 Ga0496108_0010156_739_1356 204
324 3300048911 Ga0496108_0037134 Ga0496108_0037134_1958_2575 204
325 3300048912 Ga0496109_0026333 Ga0496109_0026333_3717_4334 204
326 3300048912 Ga0496109_0048764 Ga0496109_0048764_3031_3648 204
327 3300048918 Ga0496115_0240645 Ga0496115_0240645_760_1377 204
328 3300049586 Ga0501070_0037175 Ga0501070_0037175_1911_2531 204
329 3300049590 Ga0501074_0319180 Ga0501074_0319180_426_1046 204
330 3300050514 nmdc:mga08x19_213444_c1 nmdc:mga08x19_213444_c1_344_961 204
331 3300053078 Ga0495612_0059072 Ga0495612_0059072_104_724 204
332 3300053078 Ga0495612_0087596 Ga0495612_0087596_537_1154 204
333 3300053084 Ga0495595_0032546 Ga0495595_0032546_1178_1795 204
334 iso_pu_bacteria 2995463766 2995471561 204
335 3300009093 Ga0105240_10006823 Ga0105240_100068234 205
336 3300013104 Ga0157370_10030913 Ga0157370_100309134 205
337 3300013105 Ga0157369_10032231 Ga0157369_100322312 205
338 3300037312 Ga0395899_0148635 Ga0395899_0148635_626_1246 205
339 3300037418 Ga0395900_0034368 Ga0395900_0034368_2736_3356 205
340 3300037466 Ga0395898_0033446 Ga0395898_0033446_434_1054 205
341 3300038443 Ga0395901_0162840 Ga0395901_0162840_970_1590 205
342 3300044735 Ga0466968_0048688 Ga0466968_0048688_661_1287 207
343 3300048922 Ga0496119_0244684 Ga0496119_0244684_13_639 207
344 3300026116 Ga0207674_10203370 Ga0207674_102033702 208
345 3300005329 Ga0070683_100167911 Ga0070683_1001679113 209
346 3300005334 Ga0068869_100531595 Ga0068869_1005315951 209
347 3300005335 Ga0070666_10052573 Ga0070666_100525732 209
348 3300005336 Ga0070680_100289755 Ga0070680_1002897552 209
349 3300005340 Ga0070689_100230671 Ga0070689_1002306711 209
350 3300005344 Ga0070661_100071147 Ga0070661_1000711471 209
351 3300005354 Ga0070675_100351684 Ga0070675_1003516842 209
352 3300005355 Ga0070671_100136093 Ga0070671_1001360932 209
353 3300005364 Ga0070673_100009103 Ga0070673_1000091032 209
354 3300005366 Ga0070659_100050830 Ga0070659_1000508303 209
355 3300005434 Ga0070709_10323509 Ga0070709_103235092 209
356 3300005435 Ga0070714_100036291 Ga0070714_1000362912 209
357 3300005435 Ga0070714_100114789 Ga0070714_1001147893 209
358 3300005437 Ga0070710_10062119 Ga0070710_100621192 209
359 3300005438 Ga0070701_10079588 Ga0070701_100795882 209
360 3300005439 Ga0070711_100448734 Ga0070711_1004487341 209
361 3300005441 Ga0070700_100461514 Ga0070700_1004615141 209
362 3300005518 Ga0070699_100402984 Ga0070699_1004029842 209
363 3300005530 Ga0070679_100240106 Ga0070679_1002401062 209
364 3300005535 Ga0070684_100127264 Ga0070684_1001272642 209
365 3300005536 Ga0070697_100507800 Ga0070697_1005078001 209
366 3300005539 Ga0068853_100366198 Ga0068853_1003661982 209
367 3300005544 Ga0070686_100056200 Ga0070686_1000562003 209
368 3300005545 Ga0070695_100360551 Ga0070695_1003605512 209
369 3300005546 Ga0070696_100055182 Ga0070696_1000551822 209
370 3300005547 Ga0070693_100009277 Ga0070693_1000092772 209
371 3300005564 Ga0070664_100304669 Ga0070664_1003046691 209
372 3300005564 Ga0070664_100608682 Ga0070664_1006086822 209
373 3300005577 Ga0068857_100142186 Ga0068857_1001421861 209
374 3300005578 Ga0068854_100026554 Ga0068854_1000265542 209
375 3300005615 Ga0070702_100025172 Ga0070702_1000251722 209
376 3300005617 Ga0068859_100148275 Ga0068859_1001482752 209
377 3300005719 Ga0068861_100175120 Ga0068861_1001751201 209
378 3300005840 Ga0068870_10139598 Ga0068870_101395982 209
379 3300005841 Ga0068863_100041127 Ga0068863_1000411272 209
380 3300005841 Ga0068863_100389488 Ga0068863_1003894882 209
381 3300005842 Ga0068858_100115674 Ga0068858_1001156742 209
382 3300005843 Ga0068860_100275370 Ga0068860_1002753701 209
383 3300005844 Ga0068862_100117793 Ga0068862_1001177932 209
384 3300006163 Ga0070715_10085910 Ga0070715_100859102 209
385 3300006163 Ga0070715_10208928 Ga0070715_102089282 209
386 3300006173 Ga0070716_100061224 Ga0070716_1000612243 209
387 3300006175 Ga0070712_100252327 Ga0070712_1002523272 209
388 3300006871 Ga0075434_100103207 Ga0075434_1001032072 209
389 3300006881 Ga0068865_100077337 Ga0068865_1000773372 209
390 3300006914 Ga0075436_100273009 Ga0075436_1002730092 209
391 3300006931 Ga0097620_100148275 Ga0097620_1001482752 209
392 3300007076 Ga0075435_100840634 Ga0075435_1008406341 209
393 3300009011 Ga0105251_10053999 Ga0105251_100539991 209
394 3300010159 Ga0099796_10224783 Ga0099796_102247831 209
395 3300011119 Ga0105246_10023695 Ga0105246_100236952 209
396 3300013308 Ga0157375_10362289 Ga0157375_103622891 209
397 3300014325 Ga0163163_10326385 Ga0163163_103263852 209
398 3300020070 Ga0206356_10858152 Ga0206356_108581522 209
399 3300020082 Ga0206353_11049559 Ga0206353_110495592 209
400 3300022467 Ga0224712_10013011 Ga0224712_100130112 209
401 3300025885 Ga0207653_10002021 Ga0207653_100020216 209
402 3300025898 Ga0207692_10265066 Ga0207692_102650661 209
403 3300025901 Ga0207688_10005447 Ga0207688_100054472 209
404 3300025906 Ga0207699_10004150 Ga0207699_100041505 209
405 3300025906 Ga0207699_10069542 Ga0207699_100695422 209
406 3300025908 Ga0207643_10030552 Ga0207643_100305523 209
407 3300025910 Ga0207684_10206361 Ga0207684_102063611 209
408 3300025911 Ga0207654_10305857 Ga0207654_103058571 209
409 3300025914 Ga0207671_10108928 Ga0207671_101089283 209
410 3300025915 Ga0207693_10131639 Ga0207693_101316392 209
411 3300025916 Ga0207663_10019696 Ga0207663_100196963 209
412 3300025917 Ga0207660_10191350 Ga0207660_101913501 209
413 3300025918 Ga0207662_10004275 Ga0207662_100042754 209
414 3300025919 Ga0207657_10022638 Ga0207657_100226381 209
415 3300025921 Ga0207652_10119326 Ga0207652_101193263 209
416 3300025929 Ga0207664_10297951 Ga0207664_102979512 209
417 3300025932 Ga0207690_10631629 Ga0207690_106316291 209
418 3300025935 Ga0207709_10509246 Ga0207709_105092462 209
419 3300025936 Ga0207670_10077628 Ga0207670_100776281 209
420 3300025941 Ga0207711_10660625 Ga0207711_106606252 209
421 3300025942 Ga0207689_10020014 Ga0207689_100200145 209
422 3300025945 Ga0207679_10052015 Ga0207679_100520153 209
423 3300025949 Ga0207667_11053728 Ga0207667_110537281 209
424 3300025961 Ga0207712_10158109 Ga0207712_101581093 209
425 3300026041 Ga0207639_10120047 Ga0207639_101200473 209
426 3300026067 Ga0207678_10016063 Ga0207678_100160636 209
427 3300026078 Ga0207702_10020452 Ga0207702_100204521 209
428 3300026088 Ga0207641_10132503 Ga0207641_101325031 209
429 3300026088 Ga0207641_10620317 Ga0207641_106203172 209
430 3300026116 Ga0207674_10228003 Ga0207674_102280032 209
431 3300026116 Ga0207674_10260062 Ga0207674_102600622 209
432 3300026121 Ga0207683_10069998 Ga0207683_100699983 209
433 3300034820 Ga0373959_0013236 Ga0373959_0013236_328_960 209
434 3300035083 Ga0373926_0032604 Ga0373926_0032604_699_1331 209
435 3300035111 Ga0373923_0063243 Ga0373923_0063243_664_1296 209
436 3300035113 Ga0373936_0028386 Ga0373936_0028386_1109_1741 209
437 3300035113 Ga0373936_0206417 Ga0373936_0206417_169_801 209
438 3300035116 Ga0373945_0022793 Ga0373945_0022793_1049_1681 209
439 3300035117 Ga0373953_0090239 Ga0373953_0090239_76_708 209
440 3300035120 Ga0373957_0010422 Ga0373957_0010422_971_1603 209
441 3300035170 Ga0373943_0004435 Ga0373943_0004435_354_986 209
442 3300035170 Ga0373943_0172891 Ga0373943_0172891_103_735 209
443 3300035171 Ga0373946_0069927 Ga0373946_0069927_859_1491 209
444 3300035172 Ga0373955_0033336 Ga0373955_0033336_1754_2386 209
445 3300035172 Ga0373955_0093467 Ga0373955_0093467_634_1266 209
446 3300035695 Ga0373927_0014646 Ga0373927_0014646_887_1519 209
447 3300035724 Ga0373933_0009754 Ga0373933_0009754_3704_4336 209
448 3300035725 Ga0373947_0194610 Ga0373947_0194610_209_841 209
449 3300036401 Ga0373937_0053710 Ga0373937_0053710_1024_1656 209
450 3300037068 Ga0373925_0022657 Ga0373925_0022657_1402_2034 209
451 3300037068 Ga0373925_0351149 Ga0373925_0351149_96_728 209
452 3300045976 Ga0466967_0094661 Ga0466967_0094661_877_1509 209
453 3300046461 Ga0495641_0007334 Ga0495641_0007334_5531_6163 209
454 3300046462 Ga0495651_0021813 Ga0495651_0021813_3159_3791 209
455 3300046462 Ga0495651_0109327 Ga0495651_0109327_936_1568 209
456 3300046463 Ga0495653_0057203 Ga0495653_0057203_1229_1861 209
457 3300046476 Ga0495662_0018322 Ga0495662_0018322_948_1580 209
458 3300046476 Ga0495662_0196322 Ga0495662_0196322_284_916 209
459 3300046477 Ga0495664_0001359 Ga0495664_0001359_1024_1656 209
460 3300046477 Ga0495664_0056179 Ga0495664_0056179_1150_1782 209
461 3300046511 Ga0495608_0084400 Ga0495608_0084400_948_1580 209
462 3300046516 Ga0495628_0068378 Ga0495628_0068378_1600_2232 209
463 3300046516 Ga0495628_0162640 Ga0495628_0162640_674_1306 209
464 3300046517 Ga0495630_0062897 Ga0495630_0062897_1390_2022 209
465 3300046517 Ga0495630_0529788 Ga0495630_0529788_221_853 209
466 3300046529 Ga0495652_0018557 Ga0495652_0018557_1925_2557 209
467 3300046529 Ga0495652_0037757 Ga0495652_0037757_352_984 209
468 3300046536 Ga0495587_0053159 Ga0495587_0053159_462_1094 209
469 3300046536 Ga0495587_0132134 Ga0495587_0132134_372_1004 209
470 3300046543 Ga0495645_0128725 Ga0495645_0128725_346_978 209
471 3300046559 Ga0495667_0034199 Ga0495667_0034199_547_1179 209
472 3300046559 Ga0495667_0169178 Ga0495667_0169178_650_1282 209
473 3300046663 Ga0495635_0035584 Ga0495635_0035584_1875_2507 209
474 3300046663 Ga0495635_0125886 Ga0495635_0125886_587_1219 209
475 3300046675 Ga0495657_0029368 Ga0495657_0029368_2117_2749 209
476 3300046675 Ga0495657_0037984 Ga0495657_0037984_2203_2835 209
477 3300046675 Ga0495657_0063434 Ga0495657_0063434_692_1324 209
478 3300046678 Ga0495599_0056818 Ga0495599_0056818_508_1140 209
479 3300046678 Ga0495599_0185014 Ga0495599_0185014_137_769 209
480 3300046680 Ga0495646_0061139 Ga0495646_0061139_1018_1650 209
481 3300046690 Ga0495624_0007142 Ga0495624_0007142_601_1233 209
482 3300046809 Ga0495600_0090349 Ga0495600_0090349_949_1581 209
483 3300046809 Ga0495600_0119277 Ga0495600_0119277_378_1010 209
484 3300046809 Ga0495600_0336879 Ga0495600_0336879_51_683 209
485 3300047317 Ga0495604_0075260 Ga0495604_0075260_1243_1875 209
486 3300047319 Ga0495674_0058742 Ga0495674_0058742_565_1197 209
487 3300047319 Ga0495674_0218662 Ga0495674_0218662_717_1349 209
488 3300047321 Ga0495676_0145894 Ga0495676_0145894_10_642 209
489 3300047322 Ga0495680_0019660 Ga0495680_0019660_3958_4590 209
490 3300047322 Ga0495680_0083599 Ga0495680_0083599_1662_2294 209
491 3300047322 Ga0495680_0090283 Ga0495680_0090283_724_1356 209
492 3300047444 Ga0495675_0078204 Ga0495675_0078204_1147_1779 209
493 3300047471 Ga0495684_0016877 Ga0495684_0016877_876_1508 209
494 3300047471 Ga0495684_0029249 Ga0495684_0029249_477_1109 209
495 3300047471 Ga0495684_0294190 Ga0495684_0294190_456_1088 209
496 3300048088 Ga0495602_0046260 Ga0495602_0046260_667_1299 209
497 3300048088 Ga0495602_0101420 Ga0495602_0101420_945_1577 209
498 3300048907 Ga0496104_0244494 Ga0496104_0244494_349_981 209
499 3300048908 Ga0496105_0318676 Ga0496105_0318676_132_785 209
500 3300048915 Ga0496112_0224441 Ga0496112_0224441_287_919 209
501 3300050513 nmdc:mga0rr50_719069_c1 nmdc:mga0rr50_719069_c1_67_699 209
502 3300053078 Ga0495612_0027311 Ga0495612_0027311_61_693 209
503 3300053085 Ga0495619_0281806 Ga0495619_0281806_501_1133 209
504 3300050510 nmdc:mga06r32_1726_c1 nmdc:mga06r32_1726_c1_9908_10540 210
505 3300047319 Ga0495674_0224639 Ga0495674_0224639_612_1307 212
506 3300049571 Ga0501034_0029357 Ga0501034_0029357_453_1094 212
507 3300049572 Ga0501036_0000627 Ga0501036_0000627_20473_21114 212
508 3300049573 Ga0501037_0006911 Ga0501037_0006911_3579_4220 212
509 3300049574 Ga0501038_0017684 Ga0501038_0017684_2435_3076 212
510 3300049575 Ga0501039_0022612 Ga0501039_0022612_1731_2372 212
511 3300049578 Ga0501042_0003012 Ga0501042_0003012_5073_5714 212
512 3300049579 Ga0501043_0002045 Ga0501043_0002045_1354_1995 212
513 3300049581 Ga0501047_0009755 Ga0501047_0009755_3910_4551 212
514 3300049582 Ga0501048_0003714 Ga0501048_0003714_4427_5068 212
515 3300049589 Ga0501073_0057055 Ga0501073_0057055_1731_2372 212
516 3300049590 Ga0501074_0000296 Ga0501074_0000296_22928_23569 212
517 3300049823 Ga0501044_0030529 Ga0501044_0030529_408_1049 212
518 3300050515 nmdc:mga0a205_165978_c1 nmdc:mga0a205_165978_c1_1388_2053 212
519 3300006237 Ga0097621_100253610 Ga0097621_1002536102 213
520 3300035086 Ga0373934_0000053 Ga0373934_0000053_19802_20482 215
521 3300035111 Ga0373923_0027194 Ga0373923_0027194_460_1140 215
522 3300035118 Ga0373954_0000809 Ga0373954_0000809_7149_7829 215
523 3300035119 Ga0373956_0000325 Ga0373956_0000325_4232_4912 215
524 3300035120 Ga0373957_0000015 Ga0373957_0000015_35969_36649 215
525 3300035172 Ga0373955_0000027 Ga0373955_0000027_20465_21145 215
526 3300035410 Ga0373924_0000084 Ga0373924_0000084_13886_14566 215
527 3300035724 Ga0373933_0000025 Ga0373933_0000025_20266_20946 215
528 3300036401 Ga0373937_0000034 Ga0373937_0000034_102911_103591 215
529 3300046454 Ga0495592_0000016 Ga0495592_0000016_69793_70473 215
530 3300046462 Ga0495651_0000005 Ga0495651_0000005_102927_103607 215
531 3300046463 Ga0495653_0001819 Ga0495653_0001819_12401_13081 215
532 3300046511 Ga0495608_0000057 Ga0495608_0000057_20266_20946 215
533 3300046516 Ga0495628_0000073 Ga0495628_0000073_9160_9840 215
534 3300046529 Ga0495652_0000054 Ga0495652_0000054_41442_42122 215
535 3300046536 Ga0495587_0000030 Ga0495587_0000030_102898_103578 215
536 3300046559 Ga0495667_0000025 Ga0495667_0000025_69790_70470 215
537 3300046675 Ga0495657_0000018 Ga0495657_0000018_102928_103608 215
538 3300046678 Ga0495599_0000054 Ga0495599_0000054_20147_20827 215
539 3300046679 Ga0495623_0000582 Ga0495623_0000582_15570_16250 215
540 3300046680 Ga0495646_0013644 Ga0495646_0013644_3302_3982 215
541 3300046809 Ga0495600_0022171 Ga0495600_0022171_752_1432 215
542 3300047317 Ga0495604_0000066 Ga0495604_0000066_69790_70470 215
543 3300047322 Ga0495680_0000032 Ga0495680_0000032_37992_38672 215
544 3300047444 Ga0495675_0002070 Ga0495675_0002070_8326_9006 215
545 3300048088 Ga0495602_0000123 Ga0495602_0000123_2525_3205 215
546 3300003373 JGI25407J50210_10026532 JGI25407J50210_100265322 216
547 3300005445 Ga0070708_100623903 Ga0070708_1006239031 216
548 3300005937 Ga0081455_10000298 Ga0081455_1000029849 216
549 3300006846 Ga0075430_100066567 Ga0075430_1000665671 216
550 3300006847 Ga0075431_100001963 Ga0075431_10000196312 216
551 3300006847 Ga0075431_100021939 Ga0075431_1000219392 216
552 3300006880 Ga0075429_100011256 Ga0075429_1000112564 216
553 3300025922 Ga0207646_10594701 Ga0207646_105947012 216
554 3300027907 Ga0207428_10025216 Ga0207428_100252165 216
555 3300046678 Ga0495599_0125415 Ga0495599_0125415_39_716 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

42

222

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9807 20 214
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.96 20 214
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9501 18 214
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9438 19 216
4nxi-assembly1.cif.gz_B rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis 0.9325 19 214
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9807 20 214 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.96 20 214 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8323 21 210 3.40.30.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8102 21 56 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8087 21 210 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V3N138-F1-model_v4 Disulfide bond formation protein DsbA 0.9907 20 149
AF-A0A372JL95-F1-model_v4 Disulfide bond formation protein DsbA 0.9866 18 216
AF-A0A1C6MN74-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.986 18 216
AF-A0A6N7GI81-F1-model_v4 Disulfide bond formation protein DsbA 0.9854 18 216
AF-A0A4Q1L040-F1-model_v4 Disulfide bond formation protein DsbA 0.9811 19 216

Feature Viewer

pLDDT pTM Quality
92.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map