F463133

General Info

Members Datasets Scaffolds Average Seq Length
555 250 553 340

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0009577|Ga0439449_0009577_27_1247
Length 406
Sequence MERPENKIEGRITSPSIGYLMPSLSGTPPLNLRFQITNLYNYLSLMNGPSSFWQTTWKRLRKNKGAVAGLVVISLAMFTALFGYLFAPDPSPFANRIILEIGGQKPGFQQTFILVKKVIQPQQPGFIKQLMQGKPDQYEYIPIVSWQAEGDSLIVQKYIDEGLSERMSFILSTLASEPVVRKTFLLGTDKFGRDILSRLIIGTRVSLSVGFITVIISLTVGIFLGAVGGYFGGKTDELVMWLVNVIWSIPTLLLVFAVTLLLGKGFWQVFIAVGLTMWVSVARLVRGQVLVTKELQYIEAARALGFSPGRIILKHILPNILGPILVIAASNFASAIIIEAGLSFLGIGVQPPRPSWGLMIKENYNFIITQNPMLALAPGFAIMLLVLAFNLMGNGLRDALSVRSKL

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
231 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
232 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 0.54
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007622 3300001979 Bacteria 4385
2 JGI24739J22299_10005191 3300001989 Bacteria 4964
3 JGI25406J46586_10001107 3300003203 Bacteria 12630
4 rootH2_10153927 3300003320 Bacteria 3538
5 rootH2_10157843 3300003320 Bacteria 4210
6 rootL2_10088716 3300003322 Bacteria 7091
7 rootL2_10250360 3300003322 Bacteria 3835
8 rootL2_10260837 3300003322 Bacteria 2145
9 rootH1_10010306 3300003323 Bacteria 26486
10 rootH1_10091716 3300003323 Bacteria 2337
11 JGI25160J50197_1005658 3300003354 Bacteria 5167
12 JGI25160J50197_1011008 3300003354 Bacteria 3237
13 Ga0055526_1032041 3300003771 Bacteria 1492
14 Ga0055528_1000060 3300003790 Bacteria 87471
15 Ga0055530_10000378 3300003791 Bacteria 40399
16 Ga0055543_1004307 3300004625 Bacteria 3913
17 Ga0070658_10030524 3300005327 Bacteria 4330
18 Ga0070676_10006487 3300005328 Bacteria 6252
19 Ga0070676_10010162 3300005328 Bacteria 5102
20 Ga0070676_10033667 3300005328 Bacteria 2940
21 Ga0070676_10048550 3300005328 Bacteria 2482
22 Ga0070676_10059953 3300005328 Bacteria 2258
23 Ga0070683_100010607 3300005329 Bacteria 7920
24 Ga0070683_100026609 3300005329 Bacteria 5211
25 Ga0070690_100003099 3300005330 Bacteria 9044
26 Ga0070670_100023427 3300005331 Bacteria 5314
27 Ga0070670_100131175 3300005331 Bacteria 2164
28 Ga0070670_100152846 3300005331 Bacteria 1998
29 Ga0070677_10024295 3300005333 Bacteria 2252
30 Ga0068869_100003697 3300005334 Bacteria 9411
31 Ga0068869_100020688 3300005334 Bacteria 4517
32 Ga0068869_100055233 3300005334 Bacteria 2894
33 Ga0070666_10000055 3300005335 Bacteria 92269
34 Ga0070666_10004569 3300005335 Bacteria 8439
35 Ga0070666_10085168 3300005335 Unclassified 2164
36 Ga0070680_100129435 3300005336 Unclassified 2111
37 Ga0070682_100000041 3300005337 Bacteria 142152
38 Ga0070682_100048406 3300005337 Bacteria 2646
39 Ga0068868_100015969 3300005338 Bacteria 5567
40 Ga0068868_100159761 3300005338 Unclassified 1860
41 Ga0068868_100168668 3300005338 Unclassified 1811
42 Ga0070660_100025464 3300005339 Unclassified 4397
43 Ga0070689_100081008 3300005340 Bacteria 2548
44 Ga0070687_100003360 3300005343 Bacteria 6198
45 Ga0070661_100030797 3300005344 Bacteria 3877
46 Ga0070668_100128667 3300005347 Bacteria 2030
47 Ga0070669_100043278 3300005353 Bacteria 3279
48 Ga0070675_100224150 3300005354 Unclassified 1638
49 Ga0070671_100092547 3300005355 Bacteria 2533
50 Ga0070674_100008425 3300005356 Bacteria 6140
51 Ga0070674_100088627 3300005356 Bacteria 2227
52 Ga0070674_100134857 3300005356 Unclassified 1845
53 Ga0070673_100026010 3300005364 Bacteria 4316
54 Ga0070673_100027929 3300005364 Bacteria 4190
55 Ga0070673_100031933 3300005364 Bacteria 3958
56 Ga0070673_100043636 3300005364 Bacteria 3466
57 Ga0070673_100092688 3300005364 Bacteria 2472
58 Ga0070673_100128902 3300005364 Bacteria 2120
59 Ga0070673_100415274 3300005364 Bacteria 1205
60 Ga0070688_100076382 3300005365 Bacteria 2155
61 Ga0070659_100243248 3300005366 Unclassified 1490
62 Ga0070667_100005019 3300005367 Bacteria 11075
63 Ga0070667_100013370 3300005367 Bacteria 6785
64 Ga0070667_100019186 3300005367 Bacteria 5670
65 Ga0070667_100024969 3300005367 Bacteria 4965
66 Ga0070667_100117229 3300005367 Bacteria 2313
67 Ga0070667_100135444 3300005367 Bacteria 2153
68 Ga0070667_100342979 3300005367 Unclassified 1351
69 Ga0070700_100083413 3300005441 Bacteria 2069
70 Ga0070678_100035659 3300005456 Bacteria 3475
71 Ga0070662_100012145 3300005457 Bacteria 5703
72 Ga0070662_100038343 3300005457 Unclassified 3404
73 Ga0070681_10040676 3300005458 Unclassified 4657
74 Ga0068867_100017424 3300005459 Bacteria 5103
75 Ga0068867_100021654 3300005459 Bacteria 4588
76 Ga0068867_100025016 3300005459 Bacteria 4281
77 Ga0068867_100209978 3300005459 Bacteria 1563
78 Ga0070685_10003458 3300005466 Bacteria 8029
79 Ga0070685_10010448 3300005466 Bacteria 4825
80 Ga0070685_10019950 3300005466 Bacteria 3624
81 Ga0070698_100005877 3300005471 Bacteria 13398
82 Ga0070698_100012587 3300005471 Bacteria 8958
83 Ga0070698_100016585 3300005471 Bacteria 7775
84 Ga0070698_100093247 3300005471 Bacteria 2991
85 Ga0070679_100037839 3300005530 Bacteria 4794
86 Ga0070684_100027800 3300005535 Unclassified 4777
87 Ga0068853_100000595 3300005539 Bacteria 24814
88 Ga0068853_100010504 3300005539 Bacteria 7487
89 Ga0068853_100040345 3300005539 Unclassified 3983
90 Ga0068853_100070809 3300005539 Bacteria 3036
91 Ga0068853_100089270 3300005539 Bacteria 2707
92 Ga0068853_100112970 3300005539 Unclassified 2414
93 Ga0068853_100116708 3300005539 Bacteria 2377
94 Ga0068853_100132520 3300005539 Unclassified 2232
95 Ga0068853_100138667 3300005539 Bacteria 2182
96 Ga0068853_100235583 3300005539 Bacteria 1676
97 Ga0070672_100040962 3300005543 Unclassified 3558
98 Ga0070672_100043080 3300005543 Bacteria 3478
99 Ga0070672_100082040 3300005543 Bacteria 2586
100 Ga0070672_100092260 3300005543 Bacteria 2445
101 Ga0070672_100268351 3300005543 Bacteria 1440
102 Ga0070686_100012522 3300005544 Bacteria 4833
103 Ga0070696_100306107 3300005546 Unclassified 1219
104 Ga0070665_100000014 3300005548 Bacteria 484881
105 Ga0070665_100019007 3300005548 Bacteria 6892
106 Ga0070704_100202317 3300005549 Unclassified 1604
107 Ga0068855_100009267 3300005563 Bacteria 11893
108 Ga0068855_100034302 3300005563 Bacteria 6054
109 Ga0068855_100074195 3300005563 Bacteria 3951
110 Ga0068855_100087415 3300005563 Bacteria 3603
111 Ga0068855_100190250 3300005563 Unclassified 2315
112 Ga0070664_100009648 3300005564 Bacteria 7831
113 Ga0070664_100213544 3300005564 Bacteria 1725
114 Ga0068857_100037368 3300005577 Bacteria 4301
115 Ga0068857_100038645 3300005577 Unclassified 4226
116 Ga0068857_100093965 3300005577 Bacteria 2685
117 Ga0068854_100016725 3300005578 Bacteria 4894
118 Ga0068854_100157071 3300005578 Unclassified 1758
119 Ga0068854_100212374 3300005578 Bacteria 1527
120 Ga0068856_100029902 3300005614 Bacteria 5323
121 Ga0068856_100047645 3300005614 Bacteria 4223
122 Ga0068852_100003367 3300005616 Bacteria 11159
123 Ga0068852_100003929 3300005616 Bacteria 10444
124 Ga0068852_100004742 3300005616 Bacteria 9652
125 Ga0068852_100144813 3300005616 Bacteria 2203
126 Ga0068859_100000003 3300005617 Bacteria 479218
127 Ga0068859_100001878 3300005617 Bacteria 21383
128 Ga0068859_100016964 3300005617 Bacteria 7309
129 Ga0068859_100049549 3300005617 Bacteria 4218
130 Ga0068859_100262777 3300005617 Bacteria 1817
131 Ga0068859_100400415 3300005617 Bacteria 1469
132 Ga0068864_100005880 3300005618 Bacteria 10053
133 Ga0068864_100033275 3300005618 Bacteria 4382
134 Ga0068864_100457911 3300005618 Bacteria 1221
135 Ga0068866_10012497 3300005718 Bacteria 3700
136 Ga0068861_100112292 3300005719 Bacteria 2185
137 Ga0068851_10004654 3300005834 Bacteria 6194
138 Ga0068870_10054329 3300005840 Unclassified 2130
139 Ga0068870_10134867 3300005840 Bacteria 1438
140 Ga0068863_100004065 3300005841 Bacteria 14447
141 Ga0068863_100006876 3300005841 Bacteria 11145
142 Ga0068863_100079031 3300005841 Bacteria 3115
143 Ga0068863_100156181 3300005841 Bacteria 2184
144 Ga0068863_100188510 3300005841 Bacteria 1982
145 Ga0068863_100205976 3300005841 Bacteria 1893
146 Ga0068863_100273236 3300005841 Bacteria 1636
147 Ga0068863_100392044 3300005841 Bacteria 1357
148 Ga0068858_100005095 3300005842 Bacteria 12876
149 Ga0068858_100032938 3300005842 Bacteria 4812
150 Ga0068858_100058456 3300005842 Bacteria 3565
151 Ga0068860_100000024 3300005843 Bacteria 271902
152 Ga0068860_100000691 3300005843 Bacteria 38802
153 Ga0068860_100001083 3300005843 Bacteria 30039
154 Ga0068860_100010599 3300005843 Bacteria 9103
155 Ga0068860_100010971 3300005843 Bacteria 8932
156 Ga0068860_100027949 3300005843 Bacteria 5432
157 Ga0068860_100031366 3300005843 Bacteria 5108
158 Ga0068860_100161926 3300005843 Bacteria 2158
159 Ga0068860_100409985 3300005843 Unclassified 1342
160 Ga0068862_100125972 3300005844 Bacteria 2261
161 Ga0068862_100150637 3300005844 Bacteria 2070
162 Ga0081540_1006450 3300005983 Bacteria 8540
163 Ga0081539_10033535 3300005985 Bacteria 3124
164 Ga0075366_10078426 3300006195 Bacteria 1971
165 Ga0097621_100010257 3300006237 Bacteria 6844
166 Ga0097621_100059914 3300006237 Bacteria 3118
167 Ga0097621_100075408 3300006237 Unclassified 2796
168 Ga0097621_100101113 3300006237 Bacteria 2426
169 Ga0097621_100225131 3300006237 Bacteria 1635
170 Ga0097621_100232522 3300006237 Bacteria 1610
171 Ga0075370_10061243 3300006353 Bacteria 2144
172 Ga0068871_100015533 3300006358 Bacteria 5703
173 Ga0068871_100056393 3300006358 Bacteria 3194
174 Ga0068871_100176318 3300006358 Bacteria 1835
175 Ga0068871_100263895 3300006358 Bacteria 1503
176 Ga0068871_100275702 3300006358 Unclassified 1470
177 Ga0068871_100303091 3300006358 Bacteria 1403
178 Ga0075428_100000528 3300006844 Bacteria 38898
179 Ga0075428_100202156 3300006844 Bacteria 2147
180 Ga0068865_100010251 3300006881 Bacteria 5828
181 Ga0068865_100032955 3300006881 Bacteria 3466
182 Ga0068865_100212409 3300006881 Unclassified 1509
183 Ga0097620_100000003 3300006931 Bacteria 479218
184 Ga0097620_100001878 3300006931 Bacteria 21383
185 Ga0097620_100016964 3300006931 Bacteria 7309
186 Ga0097620_100049547 3300006931 Bacteria 4218
187 Ga0097620_100262781 3300006931 Bacteria 1817
188 Ga0097620_100400405 3300006931 Bacteria 1469
189 Ga0105240_10000106 3300009093 Bacteria 171825
190 Ga0105240_10000895 3300009093 Bacteria 53295
191 Ga0105240_10002904 3300009093 Bacteria 27043
192 Ga0105240_10004054 3300009093 Bacteria 22536
193 Ga0105240_10006297 3300009093 Bacteria 17467
194 Ga0105240_10006529 3300009093 Bacteria 17125
195 Ga0105240_10042709 3300009093 Bacteria 5775
196 Ga0105240_10059025 3300009093 Bacteria 4789
197 Ga0105240_10167903 3300009093 Bacteria 2601
198 Ga0111539_10034712 3300009094 Bacteria 6111
199 Ga0111539_10455718 3300009094 Bacteria 1489
200 Ga0105247_10005675 3300009101 Bacteria 7821
201 Ga0114129_10001087 3300009147 Bacteria 35667
202 Ga0105243_10244684 3300009148 Bacteria 1598
203 Ga0105241_10000333 3300009174 Bacteria 35848
204 Ga0105241_10006665 3300009174 Bacteria 8498
205 Ga0105242_10046108 3300009176 Bacteria 3536
206 Ga0105237_10000561 3300009545 Bacteria 51951
207 Ga0105237_10001918 3300009545 Bacteria 26563
208 Ga0105237_10002430 3300009545 Bacteria 23126
209 Ga0105237_10008942 3300009545 Bacteria 10785
210 Ga0105237_10014100 3300009545 Bacteria 8362
211 Ga0105237_10018452 3300009545 Bacteria 7219
212 Ga0105237_10098083 3300009545 Bacteria 2921
213 Ga0105237_10099104 3300009545 Bacteria 2906
214 Ga0105237_10156915 3300009545 Bacteria 2273
215 Ga0105238_10001211 3300009551 Bacteria 25984
216 Ga0105238_10036147 3300009551 Bacteria 5020
217 Ga0105238_10135965 3300009551 Bacteria 2435
218 Ga0105249_10006125 3300009553 Bacteria 10434
219 Ga0105249_10007649 3300009553 Bacteria 9420
220 Ga0105249_10041123 3300009553 Bacteria 4201
221 Ga0105249_10054386 3300009553 Bacteria 3661
222 Ga0105249_10056662 3300009553 Bacteria 3588
223 Ga0105249_10175988 3300009553 Bacteria 2078
224 Ga0105249_10217021 3300009553 Bacteria 1880
225 Ga0105239_10000580 3300010375 Bacteria 52245
226 Ga0105239_10003763 3300010375 Bacteria 18449
227 Ga0105239_10015245 3300010375 Bacteria 8516
228 Ga0105239_10031587 3300010375 Bacteria 5822
229 Ga0105239_10069729 3300010375 Bacteria 3862
230 Ga0105239_10150909 3300010375 Bacteria 2593
231 Ga0105239_10182175 3300010375 Bacteria 2350
232 Ga0105246_10017063 3300011119 Bacteria 4610
233 Ga0105246_10049725 3300011119 Bacteria 2872
234 Ga0157373_10027854 3300013100 Bacteria 4076
235 Ga0157373_10036914 3300013100 Bacteria 3505
236 Ga0157371_10019638 3300013102 Bacteria 4978
237 Ga0157371_10169602 3300013102 Unclassified 1559
238 Ga0157370_10004404 3300013104 Bacteria 16158
239 Ga0157369_10047185 3300013105 Bacteria 4678
240 Ga0157374_10000011 3300013296 Bacteria 466749
241 Ga0157374_10004638 3300013296 Bacteria 11530
242 Ga0157374_10033206 3300013296 Bacteria 4707
243 Ga0157374_10070119 3300013296 Unclassified 3302
244 Ga0157374_10157436 3300013296 Bacteria 2211
245 Ga0157374_10285030 3300013296 Bacteria 1631
246 Ga0157378_10007622 3300013297 Bacteria 9448
247 Ga0157378_10012126 3300013297 Bacteria 7549
248 Ga0157378_10030079 3300013297 Bacteria 4798
249 Ga0157378_10038433 3300013297 Unclassified 4242
250 Ga0157378_10069590 3300013297 Bacteria 3157
251 Ga0157378_10134653 3300013297 Bacteria 2290
252 Ga0163162_10000612 3300013306 Bacteria 33144
253 Ga0163162_10007231 3300013306 Bacteria 10776
254 Ga0163162_10009116 3300013306 Bacteria 9647
255 Ga0163162_10027673 3300013306 Bacteria 5608
256 Ga0163162_10063273 3300013306 Bacteria 3742
257 Ga0163162_10082776 3300013306 Bacteria 3281
258 Ga0163162_10104804 3300013306 Bacteria 2922
259 Ga0163162_10266747 3300013306 Bacteria 1843
260 Ga0157372_10000171 3300013307 Bacteria 71956
261 Ga0157372_10004704 3300013307 Bacteria 14497
262 Ga0157372_10046427 3300013307 Bacteria 4822
263 Ga0157372_10094322 3300013307 Bacteria 3408
264 Ga0157372_10345234 3300013307 Bacteria 1734
265 Ga0157372_10417014 3300013307 Bacteria 1564
266 Ga0157372_10506995 3300013307 Unclassified 1407
267 Ga0157375_10054957 3300013308 Bacteria 3924
268 Ga0157375_10067613 3300013308 Bacteria 3571
269 Ga0157375_10076477 3300013308 Bacteria 3374
270 Ga0157375_10090619 3300013308 Bacteria 3117
271 Ga0157375_10109548 3300013308 Bacteria 2858
272 Ga0157375_10302491 3300013308 Bacteria 1763
273 Ga0163163_10068512 3300014325 Unclassified 3531
274 Ga0163163_10130029 3300014325 Bacteria 2558
275 Ga0157380_10001258 3300014326 Bacteria 16460
276 Ga0157380_10011994 3300014326 Bacteria 6272
277 Ga0157380_10048233 3300014326 Bacteria 3353
278 Ga0157380_10058664 3300014326 Bacteria 3069
279 Ga0157380_10203437 3300014326 Bacteria 1758
280 Ga0157380_10286114 3300014326 Unclassified 1511
281 Ga0157377_10033210 3300014745 Unclassified 2815
282 Ga0157377_10061691 3300014745 Bacteria 2143
283 Ga0157377_10074208 3300014745 Bacteria 1973
284 Ga0157379_10066239 3300014968 Bacteria 3229
285 Ga0157379_10127216 3300014968 Bacteria 2293
286 Ga0157379_10199350 3300014968 Bacteria 1810
287 Ga0157376_10020146 3300014969 Bacteria 5154
288 Ga0157376_10031329 3300014969 Bacteria 4256
289 Ga0157376_10033480 3300014969 Bacteria 4138
290 Ga0157376_10065020 3300014969 Bacteria 3078
291 Ga0163161_10012726 3300017792 Bacteria 5844
292 Ga0163161_10063450 3300017792 Bacteria 2693
293 Ga0209673_1000258 3300025273 Bacteria 100207
294 Ga0209564_1008584 3300025295 Bacteria 5017
295 Ga0209564_1035408 3300025295 Bacteria 1446
296 Ga0209758_1010462 3300025297 Bacteria 5546
297 Ga0209758_1016212 3300025297 Bacteria 3799
298 Ga0209050_1001018 3300025298 Bacteria 34976
299 Ga0207426_1000040 3300025302 Bacteria 433920
300 Ga0207426_1000916 3300025302 Bacteria 29477
301 Ga0207697_10055171 3300025315 Unclassified 1647
302 Ga0207710_10017508 3300025900 Bacteria 3040
303 Ga0207688_10020363 3300025901 Bacteria 3621
304 Ga0207680_10001322 3300025903 Bacteria 11693
305 Ga0207680_10005910 3300025903 Bacteria 5878
306 Ga0207680_10078072 3300025903 Unclassified 2073
307 Ga0207647_10009941 3300025904 Bacteria 6738
308 Ga0207647_10085150 3300025904 Bacteria 1891
309 Ga0207645_10000193 3300025907 Bacteria 49552
310 Ga0207645_10003937 3300025907 Bacteria 11090
311 Ga0207643_10090611 3300025908 Unclassified 1782
312 Ga0207705_10034144 3300025909 Bacteria 3636
313 Ga0207654_10000560 3300025911 Bacteria 21041
314 Ga0207654_10090306 3300025911 Bacteria 1866
315 Ga0207707_10261963 3300025912 Unclassified 1500
316 Ga0207695_10000087 3300025913 Bacteria 276412
317 Ga0207695_10000522 3300025913 Bacteria 81461
318 Ga0207695_10000582 3300025913 Bacteria 74405
319 Ga0207695_10000909 3300025913 Bacteria 53303
320 Ga0207695_10106289 3300025913 Unclassified 2793
321 Ga0207695_10179338 3300025913 Unclassified 2039
322 Ga0207671_10002341 3300025914 Bacteria 20437
323 Ga0207671_10004140 3300025914 Bacteria 14026
324 Ga0207671_10024076 3300025914 Bacteria 4582
325 Ga0207671_10030798 3300025914 Bacteria 3999
326 Ga0207671_10046649 3300025914 Bacteria 3206
327 Ga0207671_10059635 3300025914 Bacteria 2830
328 Ga0207671_10125927 3300025914 Bacteria 1962
329 Ga0207660_10143611 3300025917 Unclassified 1827
330 Ga0207662_10006841 3300025918 Bacteria 6173
331 Ga0207657_10002165 3300025919 Bacteria 21284
332 Ga0207646_10336890 3300025922 Unclassified 1363
333 Ga0207681_10035003 3300025923 Bacteria 3307
334 Ga0207694_10094427 3300025924 Bacteria 2363
335 Ga0207650_10245861 3300025925 Bacteria 1447
336 Ga0207659_10110056 3300025926 Unclassified 2093
337 Ga0207644_10076344 3300025931 Bacteria 2465
338 Ga0207644_10088369 3300025931 Unclassified 2305
339 Ga0207644_10095299 3300025931 Unclassified 2225
340 Ga0207706_10003305 3300025933 Bacteria 15441
341 Ga0207706_10005451 3300025933 Bacteria 11857
342 Ga0207686_10000977 3300025934 Bacteria 17010
343 Ga0207686_10026282 3300025934 Bacteria 3395
344 Ga0207670_10007292 3300025936 Bacteria 6157
345 Ga0207669_10002991 3300025937 Bacteria 7272
346 Ga0207669_10110551 3300025937 Bacteria 1841
347 Ga0207704_10046554 3300025938 Bacteria 2586
348 Ga0207704_10168099 3300025938 Bacteria 1569
349 Ga0207691_10001141 3300025940 Bacteria 26346
350 Ga0207691_10016933 3300025940 Bacteria 6916
351 Ga0207691_10068462 3300025940 Bacteria 3207
352 Ga0207691_10133767 3300025940 Unclassified 2189
353 Ga0207689_10004338 3300025942 Bacteria 12918
354 Ga0207689_10008230 3300025942 Bacteria 9087
355 Ga0207689_10009258 3300025942 Bacteria 8517
356 Ga0207689_10009429 3300025942 Bacteria 8430
357 Ga0207689_10039783 3300025942 Bacteria 3892
358 Ga0207689_10096102 3300025942 Bacteria 2434
359 Ga0207661_10007387 3300025944 Bacteria 7819
360 Ga0207679_10014606 3300025945 Bacteria 5166
361 Ga0207667_10000584 3300025949 Bacteria 47412
362 Ga0207667_10003743 3300025949 Bacteria 18757
363 Ga0207651_10003386 3300025960 Bacteria 7828
364 Ga0207651_10247192 3300025960 Unclassified 1457
365 Ga0207651_10274514 3300025960 Bacteria 1390
366 Ga0207712_10001111 3300025961 Bacteria 18799
367 Ga0207712_10003616 3300025961 Bacteria 9750
368 Ga0207712_10020217 3300025961 Bacteria 4358
369 Ga0207668_10000514 3300025972 Bacteria 24251
370 Ga0207668_10090546 3300025972 Unclassified 2246
371 Ga0207640_10083103 3300025981 Unclassified 2195
372 Ga0207640_10091877 3300025981 Bacteria 2104
373 Ga0207640_10191236 3300025981 Bacteria 1543
374 Ga0207658_10007630 3300025986 Bacteria 7367
375 Ga0207658_10083641 3300025986 Unclassified 2454
376 Ga0207658_10167609 3300025986 Bacteria 1806
377 Ga0207658_10217215 3300025986 Bacteria 1606
378 Ga0207658_10432471 3300025986 Bacteria 1162
379 Ga0207677_10057237 3300026023 Bacteria 2676
380 Ga0207677_10062503 3300026023 Bacteria 2583
381 Ga0207677_10068700 3300026023 Unclassified 2488
382 Ga0207677_10080875 3300026023 Unclassified 2329
383 Ga0207703_10004431 3300026035 Bacteria 11534
384 Ga0207703_10006541 3300026035 Bacteria 9294
385 Ga0207703_10201342 3300026035 Bacteria 1769
386 Ga0207639_10040260 3300026041 Bacteria 3487
387 Ga0207639_10150323 3300026041 Unclassified 1950
388 Ga0207639_10246398 3300026041 Bacteria 1556
389 Ga0207639_10369630 3300026041 Bacteria 1285
390 Ga0207708_10071529 3300026075 Bacteria 2657
391 Ga0207708_10271935 3300026075 Unclassified 1371
392 Ga0207708_10385751 3300026075 Unclassified 1156
393 Ga0207702_10064704 3300026078 Bacteria 3130
394 Ga0207641_10000026 3300026088 Bacteria 245091
395 Ga0207641_10000318 3300026088 Bacteria 59432
396 Ga0207641_10012887 3300026088 Bacteria 6859
397 Ga0207641_10017491 3300026088 Bacteria 5869
398 Ga0207641_10035371 3300026088 Bacteria 4161
399 Ga0207641_10231771 3300026088 Bacteria 1716
400 Ga0207641_10436344 3300026088 Bacteria 1263
401 Ga0207648_10000914 3300026089 Bacteria 33242
402 Ga0207648_10032681 3300026089 Bacteria 4592
403 Ga0207648_10062843 3300026089 Bacteria 3237
404 Ga0207648_10190090 3300026089 Unclassified 1819
405 Ga0207648_10237059 3300026089 Bacteria 1624
406 Ga0207648_10387667 3300026089 Bacteria 1264
407 Ga0207676_10024459 3300026095 Bacteria 4468
408 Ga0207676_10030721 3300026095 Bacteria 4035
409 Ga0207676_10043230 3300026095 Unclassified 3468
410 Ga0207676_10170169 3300026095 Bacteria 1897
411 Ga0207674_10009967 3300026116 Bacteria 10811
412 Ga0207674_10047052 3300026116 Bacteria 4425
413 Ga0207675_100018920 3300026118 Bacteria 6429
414 Ga0207675_100019544 3300026118 Bacteria 6323
415 Ga0207675_100040792 3300026118 Bacteria 4335
416 Ga0207675_100063356 3300026118 Bacteria 3454
417 Ga0207675_100100592 3300026118 Bacteria 2723
418 Ga0207683_10015050 3300026121 Bacteria 6584
419 Ga0207683_10231661 3300026121 Unclassified 1685
420 Ga0207698_10002724 3300026142 Bacteria 10521
421 Ga0207698_10051408 3300026142 Bacteria 3151
422 Ga0207698_10056007 3300026142 Unclassified 3042
423 Ga0207698_10056268 3300026142 Bacteria 3036
424 Ga0268266_10000048 3300028379 Bacteria 310336
425 Ga0268266_10008503 3300028379 Bacteria 9122
426 Ga0268266_10104142 3300028379 Bacteria 2505
427 Ga0268265_10037171 3300028380 Bacteria 3572
428 Ga0268265_10303811 3300028380 Bacteria 1438
429 Ga0268264_10000028 3300028381 Bacteria 426662
430 Ga0268264_10000558 3300028381 Bacteria 45913
431 Ga0268264_10007750 3300028381 Bacteria 8939
432 Ga0268264_10014547 3300028381 Bacteria 6464
433 Ga0268264_10022172 3300028381 Bacteria 5184
434 Ga0268264_10312312 3300028381 Bacteria 1483
435 Ga0307517_10123252 3300028786 Bacteria 1905
436 Ga0307515_10000001 3300028794 Bacteria 4259510
437 Ga0307515_10001257 3300028794 Bacteria 57814
438 Ga0307511_10000076 3300030521 Bacteria 82520
439 Ga0265327_10000013 3300031251 Bacteria 519549
440 Ga0265327_10000115 3300031251 Bacteria 173854
441 Ga0307513_10046889 3300031456 Bacteria 4706
442 Ga0307509_10029821 3300031507 Bacteria 6047
443 Ga0307508_10000111 3300031616 Bacteria 96733
444 Ga0307516_10000159 3300031730 Bacteria 84553
445 Ga0307414_10076775 3300032004 Bacteria 2429
446 Ga0307507_10113778 3300033179 Unclassified 2197
447 Ga0307510_10000949 3300033180 Bacteria 30604
448 Ga0373927_0020503 3300035695 Bacteria 4336
449 Ga0373937_0211741 3300036401 Bacteria 1824
450 Ga0373937_0214647 3300036401 Bacteria 1811
451 Ga0373937_0260314 3300036401 Bacteria 1636
452 Ga0436363_0220785 3300039450 Bacteria 1324
453 Ga0439436_0001213 3300041404 Bacteria 7335
454 Ga0439436_0026910 3300041404 Bacteria 1684
455 Ga0439439_0002695 3300041406 Bacteria 3810
456 Ga0451802_1059356 3300041460 Bacteria 1926
457 Ga0451841_1359142 3300041498 Bacteria 1198
458 Ga0451853_0782917 3300041512 Bacteria 1550
459 Ga0439445_0019312 3300042004 Bacteria 1698
460 Ga0439449_0007699 3300042007 Bacteria 4089
461 Ga0439449_0009577 3300042007 Bacteria 3668
462 Ga0439457_001516 3300042014 Bacteria 6969
463 Ga0439457_012653 3300042014 Bacteria 1900
464 Ga0451577_0104217 3300042876 Unclassified 2535
465 Ga0466972_0000049 3300044658 Bacteria 118829
466 Ga0466972_0000057 3300044658 Bacteria 110775
467 Ga0466972_0000901 3300044658 Bacteria 14287
468 Ga0466972_0017565 3300044658 Bacteria 3581
469 Ga0466965_0029525 3300044683 Bacteria 2669
470 Ga0466965_0036341 3300044683 Unclassified 2417
471 Ga0466965_0060052 3300044683 Bacteria 1899
472 Ga0453684_0049686 3300044712 Bacteria 5527
473 Ga0453684_0140637 3300044712 Bacteria 2883
474 Ga0466968_0132032 3300044735 Bacteria 1137
475 Ga0466970_0000465 3300044765 Bacteria 20048
476 Ga0466957_0000101 3300044842 Bacteria 34646
477 Ga0466957_0246763 3300044842 Bacteria 1186
478 Ga0466959_0005634 3300045049 Bacteria 8614
479 Ga0466958_0034594 3300045836 Bacteria 3015
480 Ga0466967_0261141 3300045976 Bacteria 1657
481 Ga0495627_037979 3300046453 Unclassified 1491
482 Ga0495651_0206470 3300046462 Bacteria 1371
483 Ga0495650_0006071 3300046471 Bacteria 7626
484 Ga0495630_0074091 3300046517 Bacteria 2564
485 Ga0495630_0122687 3300046517 Bacteria 1971
486 Ga0495621_0005864 3300046539 Bacteria 3558
487 Ga0495633_0000089 3300046558 Bacteria 123616
488 Ga0495668_0000023 3300046616 Bacteria 363848
489 Ga0495668_0002514 3300046616 Bacteria 14989
490 Ga0495611_0000669 3300046648 Bacteria 19528
491 Ga0495611_0087910 3300046648 Bacteria 1434
492 Ga0495625_0046749 3300046660 Bacteria 3122
493 Ga0495647_0085545 3300046681 Bacteria 1285
494 Ga0495658_0066493 3300046683 Bacteria 2082
495 Ga0495649_0024726 3300046694 Bacteria 3349
496 Ga0495672_0119624 3300047320 Unclassified 1402
497 Ga0495672_0147009 3300047320 Bacteria 1225
498 Ga0495687_000429 3300047443 Bacteria 51940
499 Ga0495686_0000005 3300047472 Bacteria 827143
500 Ga0495686_0071517 3300047472 Bacteria 2135
501 Ga0496109_0220929 3300048912 Unclassified 1782
502 Ga0496115_0109968 3300048918 Bacteria 2264
503 Ga0501031_0002497 3300049568 Bacteria 11722
504 Ga0501034_0019990 3300049571 Bacteria 6838
505 Ga0501036_0002439 3300049572 Bacteria 14561
506 Ga0501036_0008374 3300049572 Bacteria 8475
507 Ga0501037_0003269 3300049573 Bacteria 11765
508 Ga0501037_0037210 3300049573 Bacteria 3587
509 Ga0501038_0009021 3300049574 Bacteria 9152
510 Ga0501039_0010018 3300049575 Bacteria 7228
511 Ga0501042_0113170 3300049578 Unclassified 1954
512 Ga0501043_0026166 3300049579 Bacteria 4577
513 Ga0501043_0307318 3300049579 Bacteria 1211
514 Ga0501046_0022150 3300049580 Bacteria 5236
515 Ga0501047_0007060 3300049581 Bacteria 10547
516 Ga0501047_0051111 3300049581 Bacteria 3992
517 Ga0501048_0046772 3300049582 Unclassified 3089
518 Ga0501068_0085057 3300049584 Unclassified 1946
519 Ga0501070_0008420 3300049586 Bacteria 8711
520 Ga0501073_0004719 3300049589 Bacteria 10240
521 Ga0501073_0174416 3300049589 Bacteria 1488
522 Ga0501074_0002102 3300049590 Bacteria 13745
523 Ga0501219_000115 3300049703 Bacteria 14190
524 Ga0501225_0002813 3300049705 Bacteria 5346
525 Ga0501079_0060691 3300049741 Unclassified 2917
526 Ga0501080_0047276 3300049742 Unclassified 4005
527 Ga0501083_0097795 3300049744 Unclassified 1936
528 Ga0501241_011459 3300049758 Bacteria 1609
529 Ga0501263_001008 3300049760 Bacteria 2483
530 Ga0501266_000698 3300049763 Bacteria 4372
531 Ga0501035_0048280 3300049822 Bacteria 3818
532 Ga0501044_0014267 3300049823 Bacteria 8579
533 Ga0501044_0157063 3300049823 Unclassified 2253
534 Ga0501044_0202424 3300049823 Bacteria 1943
535 Ga0501284_00002 3300050005 Bacteria 220402
536 nmdc:mga05p37_3043_c1 3300050507 Bacteria 19467
537 nmdc:mga09592_144679_c1 3300050508 Bacteria 2050
538 nmdc:mga08y16_168668_c1 3300050511 Bacteria 2274
539 nmdc:mga08y16_493862_c1 3300050511 Bacteria 1244
540 Ga0500578_0000605 3300053086 Bacteria 43458
541 Ga0500644_0027933 3300053088 Bacteria 1760
542 Ga0500583_0000055 3300053092 Bacteria 72367
543 Ga0500583_0031014 3300053092 Bacteria 2345
544 Ga0500562_000148 3300053108 Bacteria 20782
545 Ga0500594_0041296 3300053118 Bacteria 1263
546 Ga0500642_0002303 3300053130 Bacteria 5582
547 Ga0500568_0000080 3300053139 Bacteria 92694
548 Ga0500588_0001975 3300053146 Bacteria 4055
549 Ga0500622_0001787 3300053156 Bacteria 16424
550 Ga0500622_0005886 3300053156 Bacteria 7244
551 Ga0500611_000003 3300053727 Bacteria 333431
552 Ga0501082_0204392 3300060353 Unclassified 1718
553 Ga0466962_0019364 3300061719 Bacteria 3271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_1359142 Ga0451841_1359142_59_1009 288
2 3300041512 Ga0451853_0782917 Ga0451853_0782917_44_994 288
3 3300044842 Ga0466957_0246763 Ga0466957_0246763_14_934 288
4 3300046462 Ga0495651_0206470 Ga0495651_0206470_415_1344 290
5 3300046681 Ga0495647_0085545 Ga0495647_0085545_329_1258 290
6 3300048918 Ga0496115_0109968 Ga0496115_0109968_1291_2220 290
7 3300053092 Ga0500583_0031014 Ga0500583_0031014_1276_2226 290
8 3300013296 Ga0157374_10004638 Ga0157374_100046385 296
9 3300031251 Ga0265327_10000115 Ga0265327_10000115137 300
10 3300044683 Ga0466965_0060052 Ga0466965_0060052_149_1153 301
11 3300005353 Ga0070669_100043278 Ga0070669_1000432782 302
12 3300005841 Ga0068863_100392044 Ga0068863_1003920442 302
13 3300005844 Ga0068862_100150637 Ga0068862_1001506372 302
14 3300025923 Ga0207681_10035003 Ga0207681_100350033 302
15 3300026041 Ga0207639_10246398 Ga0207639_102463982 303
16 3300025901 Ga0207688_10020363 Ga0207688_100203632 310
17 3300005539 Ga0068853_100070809 Ga0068853_1000708094 311
18 3300025315 Ga0207697_10055171 Ga0207697_100551711 311
19 3300026041 Ga0207639_10150323 Ga0207639_101503232 311
20 3300005459 Ga0068867_100021654 Ga0068867_1000216544 313
21 3300005719 Ga0068861_100112292 Ga0068861_1001122922 313
22 3300025938 Ga0207704_10046554 Ga0207704_100465542 313
23 3300026089 Ga0207648_10032681 Ga0207648_100326814 313
24 3300026142 Ga0207698_10051408 Ga0207698_100514084 313
25 3300044735 Ga0466968_0132032 Ga0466968_0132032_25_1038 314
26 3300025942 Ga0207689_10004338 Ga0207689_100043381 315
27 3300026118 Ga0207675_100019544 Ga0207675_1000195441 315
28 3300026041 Ga0207639_10040260 Ga0207639_100402602 316
29 3300036401 Ga0373937_0211741 Ga0373937_0211741_199_1209 317
30 3300046683 Ga0495658_0066493 Ga0495658_0066493_72_1082 317
31 3300013296 Ga0157374_10000011 Ga0157374_10000011419 320
32 3300014969 Ga0157376_10031329 Ga0157376_100313292 320
33 3300031730 Ga0307516_10000159 Ga0307516_1000015910 320
34 3300005329 Ga0070683_100010607 Ga0070683_1000106077 322
35 3300005367 Ga0070667_100135444 Ga0070667_1001354442 322
36 3300005563 Ga0068855_100009267 Ga0068855_10000926712 322
37 3300006237 Ga0097621_100059914 Ga0097621_1000599142 322
38 3300009093 Ga0105240_10006529 Ga0105240_1000652918 322
39 3300010375 Ga0105239_10003763 Ga0105239_1000376313 322
40 3300013100 Ga0157373_10036914 Ga0157373_100369142 322
41 3300025913 Ga0207695_10000087 Ga0207695_10000087142 322
42 3300025944 Ga0207661_10007387 Ga0207661_100073873 322
43 3300025949 Ga0207667_10000584 Ga0207667_1000058432 322
44 3300046453 Ga0495627_037979 Ga0495627_037979_382_1446 322
45 3300046558 Ga0495633_0000089 Ga0495633_0000089_63576_64640 322
46 3300005539 Ga0068853_100089270 Ga0068853_1000892703 323
47 3300005563 Ga0068855_100190250 Ga0068855_1001902501 323
48 3300005577 Ga0068857_100037368 Ga0068857_1000373683 323
49 3300005578 Ga0068854_100157071 Ga0068854_1001570712 323
50 3300005616 Ga0068852_100003929 Ga0068852_1000039297 323
51 3300005843 Ga0068860_100010599 Ga0068860_1000105992 323
52 3300009093 Ga0105240_10004054 Ga0105240_100040543 323
53 3300009093 Ga0105240_10006297 Ga0105240_1000629713 323
54 3300009545 Ga0105237_10001918 Ga0105237_1000191829 323
55 3300009545 Ga0105237_10008942 Ga0105237_1000894211 323
56 3300009545 Ga0105237_10099104 Ga0105237_100991043 323
57 3300009551 Ga0105238_10135965 Ga0105238_101359651 323
58 3300010375 Ga0105239_10069729 Ga0105239_100697292 323
59 3300013104 Ga0157370_10004404 Ga0157370_100044042 323
60 3300013307 Ga0157372_10004704 Ga0157372_1000470410 323
61 3300025904 Ga0207647_10009941 Ga0207647_100099411 323
62 3300025913 Ga0207695_10106289 Ga0207695_101062892 323
63 3300025913 Ga0207695_10179338 Ga0207695_101793382 323
64 3300025914 Ga0207671_10024076 Ga0207671_100240762 323
65 3300025914 Ga0207671_10030798 Ga0207671_100307983 323
66 3300025914 Ga0207671_10046649 Ga0207671_100466493 323
67 3300025924 Ga0207694_10094427 Ga0207694_100944271 323
68 3300025949 Ga0207667_10003743 Ga0207667_1000374311 323
69 3300025981 Ga0207640_10083103 Ga0207640_100831032 323
70 3300026116 Ga0207674_10009967 Ga0207674_100099677 323
71 3300026142 Ga0207698_10002724 Ga0207698_100027248 323
72 3300028381 Ga0268264_10022172 Ga0268264_100221721 323
73 3300046616 Ga0495668_0002514 Ga0495668_0002514_2300_3370 323
74 3300046648 Ga0495611_0000669 Ga0495611_0000669_18435_19499 323
75 3300005539 Ga0068853_100235583 Ga0068853_1002355832 324
76 3300026095 Ga0207676_10043230 Ga0207676_100432302 324
77 3300046694 Ga0495649_0024726 Ga0495649_0024726_1435_2496 324
78 3300061719 Ga0466962_0019364 Ga0466962_0019364_1839_2897 324
79 3300003320 rootH2_10153927 rootH2_101539272 325
80 3300009093 Ga0105240_10002904 Ga0105240_1000290411 325
81 3300009093 Ga0105240_10042709 Ga0105240_100427092 325
82 3300009545 Ga0105237_10156915 Ga0105237_101569152 325
83 3300025913 Ga0207695_10000582 Ga0207695_1000058259 325
84 3300025914 Ga0207671_10125927 Ga0207671_101259272 325
85 3300033180 Ga0307510_10000949 Ga0307510_100009492 325
86 3300047320 Ga0495672_0147009 Ga0495672_0147009_131_1201 325
87 3300003354 JGI25160J50197_1011008 JGI25160J50197_10110084 327
88 3300005577 Ga0068857_100093965 Ga0068857_1000939653 327
89 3300009553 Ga0105249_10006125 Ga0105249_100061255 327
90 3300009553 Ga0105249_10217021 Ga0105249_102170212 327
91 3300025302 Ga0207426_1000040 Ga0207426_100004051 327
92 3300025986 Ga0207658_10217215 Ga0207658_102172152 327
93 3300026116 Ga0207674_10047052 Ga0207674_100470525 327
94 3300047472 Ga0495686_0000005 Ga0495686_0000005_609957_611015 327
95 iso_pu_bacteria 2818991444 2819585694 327
96 3300005539 Ga0068853_100000595 Ga0068853_1000005952 328
97 3300005843 Ga0068860_100027949 Ga0068860_1000279495 328
98 3300009093 Ga0105240_10000895 Ga0105240_100008952 328
99 3300009093 Ga0105240_10167903 Ga0105240_101679032 328
100 3300009551 Ga0105238_10036147 Ga0105238_100361473 328
101 3300010375 Ga0105239_10182175 Ga0105239_101821751 328
102 3300025913 Ga0207695_10000909 Ga0207695_1000090943 328
103 3300005841 Ga0068863_100156181 Ga0068863_1001561813 329
104 3300009553 Ga0105249_10041123 Ga0105249_100411233 329
105 3300025934 Ga0207686_10000977 Ga0207686_1000097717 329
106 3300049703 Ga0501219_000115 Ga0501219_000115_13036_14106 329
107 3300049758 Ga0501241_011459 Ga0501241_011459_80_1150 329
108 3300050005 Ga0501284_00002 Ga0501284_00002_115329_116399 329
109 3300005356 Ga0070674_100008425 Ga0070674_1000084256 330
110 3300005548 Ga0070665_100000014 Ga0070665_100000014106 330
111 3300005843 Ga0068860_100000024 Ga0068860_100000024155 330
112 3300006237 Ga0097621_100232522 Ga0097621_1002325222 330
113 3300009093 Ga0105240_10000106 Ga0105240_1000010680 330
114 3300009174 Ga0105241_10006665 Ga0105241_100066655 330
115 3300009545 Ga0105237_10014100 Ga0105237_100141005 330
116 3300009551 Ga0105238_10001211 Ga0105238_100012115 330
117 3300013306 Ga0163162_10007231 Ga0163162_100072318 330
118 3300013307 Ga0157372_10046427 Ga0157372_100464276 330
119 3300025911 Ga0207654_10090306 Ga0207654_100903061 330
120 3300025913 Ga0207695_10000522 Ga0207695_1000052211 330
121 3300025914 Ga0207671_10004140 Ga0207671_100041405 330
122 3300025937 Ga0207669_10002991 Ga0207669_100029913 330
123 3300028379 Ga0268266_10000048 Ga0268266_10000048184 330
124 3300028380 Ga0268265_10303811 Ga0268265_103038112 330
125 3300028381 Ga0268264_10000028 Ga0268264_10000028336 330
126 3300028786 Ga0307517_10123252 Ga0307517_101232522 330
127 3300031456 Ga0307513_10046889 Ga0307513_100468892 330
128 3300044658 Ga0466972_0000901 Ga0466972_0000901_11780_12871 330
129 3300047443 Ga0495687_000429 Ga0495687_000429_8482_9573 330
130 3300005330 Ga0070690_100003099 Ga0070690_1000030995 331
131 3300005338 Ga0068868_100168668 Ga0068868_1001686682 331
132 3300005340 Ga0070689_100081008 Ga0070689_1000810082 331
133 3300005343 Ga0070687_100003360 Ga0070687_1000033603 331
134 3300005356 Ga0070674_100134857 Ga0070674_1001348572 331
135 3300005365 Ga0070688_100076382 Ga0070688_1000763821 331
136 3300005367 Ga0070667_100117229 Ga0070667_1001172293 331
137 3300005466 Ga0070685_10003458 Ga0070685_100034589 331
138 3300005543 Ga0070672_100040962 Ga0070672_1000409622 331
139 3300005543 Ga0070672_100268351 Ga0070672_1002683512 331
140 3300005544 Ga0070686_100012522 Ga0070686_1000125224 331
141 3300005840 Ga0068870_10054329 Ga0068870_100543292 331
142 3300005842 Ga0068858_100058456 Ga0068858_1000584565 331
143 3300009094 Ga0111539_10034712 Ga0111539_100347126 331
144 3300009094 Ga0111539_10455718 Ga0111539_104557182 331
145 3300009553 Ga0105249_10056662 Ga0105249_100566622 331
146 3300013297 Ga0157378_10007622 Ga0157378_100076227 331
147 3300013306 Ga0163162_10104804 Ga0163162_101048042 331
148 3300013308 Ga0157375_10109548 Ga0157375_101095482 331
149 3300014326 Ga0157380_10011994 Ga0157380_100119942 331
150 3300014326 Ga0157380_10048233 Ga0157380_100482332 331
151 3300014745 Ga0157377_10033210 Ga0157377_100332104 331
152 3300025918 Ga0207662_10006841 Ga0207662_100068413 331
153 3300025931 Ga0207644_10095299 Ga0207644_100952993 331
154 3300025936 Ga0207670_10007292 Ga0207670_100072925 331
155 3300025940 Ga0207691_10133767 Ga0207691_101337672 331
156 3300025942 Ga0207689_10039783 Ga0207689_100397832 331
157 3300025945 Ga0207679_10014606 Ga0207679_100146063 331
158 3300025961 Ga0207712_10001111 Ga0207712_1000111113 331
159 3300025986 Ga0207658_10083641 Ga0207658_100836412 331
160 3300026023 Ga0207677_10080875 Ga0207677_100808751 331
161 3300026075 Ga0207708_10271935 Ga0207708_102719351 331
162 3300026088 Ga0207641_10000318 Ga0207641_1000031836 331
163 3300026089 Ga0207648_10190090 Ga0207648_101900902 331
164 3300026095 Ga0207676_10170169 Ga0207676_101701692 331
165 3300030521 Ga0307511_10000076 Ga0307511_1000007620 331
166 3300044683 Ga0466965_0036341 Ga0466965_0036341_1116_2204 331
167 3300050511 nmdc:mga08y16_493862_c1 nmdc:mga08y16_493862_c1_117_1190 331
168 3300005327 Ga0070658_10030524 Ga0070658_100305242 332
169 3300005328 Ga0070676_10059953 Ga0070676_100599532 332
170 3300005335 Ga0070666_10004569 Ga0070666_100045692 332
171 3300005347 Ga0070668_100128667 Ga0070668_1001286672 332
172 3300005364 Ga0070673_100026010 Ga0070673_1000260104 332
173 3300005367 Ga0070667_100019186 Ga0070667_1000191866 332
174 3300005457 Ga0070662_100012145 Ga0070662_1000121452 332
175 3300005459 Ga0068867_100017424 Ga0068867_1000174242 332
176 3300005539 Ga0068853_100010504 Ga0068853_1000105042 332
177 3300005543 Ga0070672_100043080 Ga0070672_1000430801 332
178 3300005548 Ga0070665_100019007 Ga0070665_1000190071 332
179 3300005563 Ga0068855_100034302 Ga0068855_1000343026 332
180 3300005563 Ga0068855_100087415 Ga0068855_1000874152 332
181 3300005614 Ga0068856_100047645 Ga0068856_1000476452 332
182 3300005616 Ga0068852_100144813 Ga0068852_1001448131 332
183 3300005618 Ga0068864_100005880 Ga0068864_1000058807 332
184 3300005834 Ga0068851_10004654 Ga0068851_100046543 332
185 3300005841 Ga0068863_100006876 Ga0068863_1000068767 332
186 3300005842 Ga0068858_100032938 Ga0068858_1000329384 332
187 3300005843 Ga0068860_100031366 Ga0068860_1000313665 332
188 3300006237 Ga0097621_100101113 Ga0097621_1001011132 332
189 3300006358 Ga0068871_100015533 Ga0068871_1000155333 332
190 3300006358 Ga0068871_100176318 Ga0068871_1001763182 332
191 3300009545 Ga0105237_10018452 Ga0105237_100184522 332
192 3300010375 Ga0105239_10000580 Ga0105239_1000058043 332
193 3300013307 Ga0157372_10000171 Ga0157372_1000017154 332
194 3300017792 Ga0163161_10012726 Ga0163161_100127265 332
195 3300025903 Ga0207680_10005910 Ga0207680_100059104 332
196 3300025904 Ga0207647_10085150 Ga0207647_100851502 332
197 3300025907 Ga0207645_10003937 Ga0207645_100039372 332
198 3300025909 Ga0207705_10034144 Ga0207705_100341444 332
199 3300025933 Ga0207706_10003305 Ga0207706_100033052 332
200 3300025940 Ga0207691_10001141 Ga0207691_100011412 332
201 3300025961 Ga0207712_10020217 Ga0207712_100202172 332
202 3300025972 Ga0207668_10000514 Ga0207668_1000051420 332
203 3300025986 Ga0207658_10007630 Ga0207658_100076303 332
204 3300026023 Ga0207677_10062503 Ga0207677_100625032 332
205 3300026035 Ga0207703_10004431 Ga0207703_100044316 332
206 3300026041 Ga0207639_10369630 Ga0207639_103696302 332
207 3300026078 Ga0207702_10064704 Ga0207702_100647042 332
208 3300026088 Ga0207641_10017491 Ga0207641_100174916 332
209 3300026089 Ga0207648_10062843 Ga0207648_100628432 332
210 3300026095 Ga0207676_10030721 Ga0207676_100307213 332
211 3300026118 Ga0207675_100018920 Ga0207675_1000189204 332
212 3300026118 Ga0207675_100040792 Ga0207675_1000407927 332
213 3300028379 Ga0268266_10008503 Ga0268266_100085037 332
214 3300045976 Ga0466967_0261141 Ga0466967_0261141_63_1148 332
215 3300053118 Ga0500594_0041296 Ga0500594_0041296_51_1148 332
216 3300005328 Ga0070676_10048550 Ga0070676_100485504 333
217 3300006237 Ga0097621_100225131 Ga0097621_1002251312 333
218 3300006844 Ga0075428_100000528 Ga0075428_1000005284 333
219 3300006844 Ga0075428_100202156 Ga0075428_1002021562 333
220 3300009148 Ga0105243_10244684 Ga0105243_102446842 333
221 3300026088 Ga0207641_10436344 Ga0207641_104363441 333
222 3300046539 Ga0495621_0005864 Ga0495621_0005864_379_1458 333
223 3300050508 nmdc:mga09592_144679_c1 nmdc:mga09592_144679_c1_823_1902 333
224 3300003322 rootL2_10250360 rootL2_102503603 334
225 3300003322 rootL2_10260837 rootL2_102608372 334
226 3300005331 Ga0070670_100152846 Ga0070670_1001528462 334
227 3300005333 Ga0070677_10024295 Ga0070677_100242953 334
228 3300005471 Ga0070698_100012587 Ga0070698_1000125878 334
229 3300005471 Ga0070698_100016585 Ga0070698_1000165853 334
230 3300005617 Ga0068859_100400415 Ga0068859_1004004152 334
231 3300005841 Ga0068863_100188510 Ga0068863_1001885102 334
232 3300006931 Ga0097620_100400405 Ga0097620_1004004052 334
233 3300009176 Ga0105242_10046108 Ga0105242_100461082 334
234 3300009553 Ga0105249_10175988 Ga0105249_101759882 334
235 3300014326 Ga0157380_10001258 Ga0157380_100012585 334
236 3300025934 Ga0207686_10026282 Ga0207686_100262822 334
237 3300025937 Ga0207669_10110551 Ga0207669_101105512 334
238 3300026088 Ga0207641_10035371 Ga0207641_100353712 334
239 3300026121 Ga0207683_10231661 Ga0207683_102316612 334
240 3300028794 Ga0307515_10000001 Ga0307515_100000012527 334
241 3300031616 Ga0307508_10000111 Ga0307508_1000011118 334
242 3300045049 Ga0466959_0005634 Ga0466959_0005634_3772_4881 334
243 3300045836 Ga0466958_0034594 Ga0466958_0034594_676_1785 334
244 3300050511 nmdc:mga08y16_168668_c1 nmdc:mga08y16_168668_c1_16_1095 334
245 3300005328 Ga0070676_10006487 Ga0070676_100064873 335
246 3300005328 Ga0070676_10010162 Ga0070676_100101624 335
247 3300005329 Ga0070683_100026609 Ga0070683_1000266093 335
248 3300005331 Ga0070670_100023427 Ga0070670_1000234272 335
249 3300005331 Ga0070670_100131175 Ga0070670_1001311753 335
250 3300005334 Ga0068869_100003697 Ga0068869_1000036978 335
251 3300005335 Ga0070666_10085168 Ga0070666_100851682 335
252 3300005336 Ga0070680_100129435 Ga0070680_1001294353 335
253 3300005337 Ga0070682_100048406 Ga0070682_1000484063 335
254 3300005338 Ga0068868_100015969 Ga0068868_1000159694 335
255 3300005338 Ga0068868_100159761 Ga0068868_1001597612 335
256 3300005339 Ga0070660_100025464 Ga0070660_1000254642 335
257 3300005344 Ga0070661_100030797 Ga0070661_1000307972 335
258 3300005354 Ga0070675_100224150 Ga0070675_1002241501 335
259 3300005356 Ga0070674_100088627 Ga0070674_1000886272 335
260 3300005364 Ga0070673_100027929 Ga0070673_1000279294 335
261 3300005364 Ga0070673_100031933 Ga0070673_1000319334 335
262 3300005364 Ga0070673_100092688 Ga0070673_1000926882 335
263 3300005364 Ga0070673_100128902 Ga0070673_1001289022 335
264 3300005366 Ga0070659_100243248 Ga0070659_1002432482 335
265 3300005367 Ga0070667_100013370 Ga0070667_1000133706 335
266 3300005456 Ga0070678_100035659 Ga0070678_1000356592 335
267 3300005457 Ga0070662_100038343 Ga0070662_1000383433 335
268 3300005458 Ga0070681_10040676 Ga0070681_100406763 335
269 3300005471 Ga0070698_100005877 Ga0070698_10000587713 335
270 3300005471 Ga0070698_100093247 Ga0070698_1000932473 335
271 3300005530 Ga0070679_100037839 Ga0070679_1000378395 335
272 3300005535 Ga0070684_100027800 Ga0070684_1000278003 335
273 3300005539 Ga0068853_100040345 Ga0068853_1000403452 335
274 3300005539 Ga0068853_100132520 Ga0068853_1001325203 335
275 3300005539 Ga0068853_100138667 Ga0068853_1001386672 335
276 3300005543 Ga0070672_100082040 Ga0070672_1000820402 335
277 3300005563 Ga0068855_100074195 Ga0068855_1000741952 335
278 3300005564 Ga0070664_100009648 Ga0070664_1000096486 335
279 3300005564 Ga0070664_100213544 Ga0070664_1002135442 335
280 3300005577 Ga0068857_100038645 Ga0068857_1000386453 335
281 3300005578 Ga0068854_100016725 Ga0068854_1000167252 335
282 3300005614 Ga0068856_100029902 Ga0068856_1000299024 335
283 3300005616 Ga0068852_100004742 Ga0068852_1000047425 335
284 3300005617 Ga0068859_100001878 Ga0068859_1000018786 335
285 3300005617 Ga0068859_100262777 Ga0068859_1002627771 335
286 3300005618 Ga0068864_100457911 Ga0068864_1004579111 335
287 3300005718 Ga0068866_10012497 Ga0068866_100124973 335
288 3300005843 Ga0068860_100161926 Ga0068860_1001619262 335
289 3300005843 Ga0068860_100409985 Ga0068860_1004099851 335
290 3300005983 Ga0081540_1006450 Ga0081540_10064505 335
291 3300006237 Ga0097621_100075408 Ga0097621_1000754083 335
292 3300006358 Ga0068871_100303091 Ga0068871_1003030911 335
293 3300006881 Ga0068865_100010251 Ga0068865_1000102512 335
294 3300006931 Ga0097620_100001878 Ga0097620_10000187814 335
295 3300006931 Ga0097620_100262781 Ga0097620_1002627812 335
296 3300009147 Ga0114129_10001087 Ga0114129_100010877 335
297 3300013100 Ga0157373_10027854 Ga0157373_100278542 335
298 3300013102 Ga0157371_10169602 Ga0157371_101696021 335
299 3300013105 Ga0157369_10047185 Ga0157369_100471851 335
300 3300013296 Ga0157374_10070119 Ga0157374_100701192 335
301 3300013297 Ga0157378_10038433 Ga0157378_100384332 335
302 3300013306 Ga0163162_10009116 Ga0163162_100091165 335
303 3300013307 Ga0157372_10506995 Ga0157372_105069951 335
304 3300013308 Ga0157375_10302491 Ga0157375_103024912 335
305 3300014326 Ga0157380_10058664 Ga0157380_100586643 335
306 3300014326 Ga0157380_10203437 Ga0157380_102034372 335
307 3300014745 Ga0157377_10061691 Ga0157377_100616912 335
308 3300017792 Ga0163161_10063450 Ga0163161_100634504 335
309 3300025903 Ga0207680_10078072 Ga0207680_100780722 335
310 3300025907 Ga0207645_10000193 Ga0207645_1000019346 335
311 3300025912 Ga0207707_10261963 Ga0207707_102619631 335
312 3300025917 Ga0207660_10143611 Ga0207660_101436111 335
313 3300025919 Ga0207657_10002165 Ga0207657_1000216516 335
314 3300025926 Ga0207659_10110056 Ga0207659_101100562 335
315 3300025938 Ga0207704_10168099 Ga0207704_101680992 335
316 3300025940 Ga0207691_10068462 Ga0207691_100684622 335
317 3300025942 Ga0207689_10009429 Ga0207689_100094297 335
318 3300025960 Ga0207651_10247192 Ga0207651_102471921 335
319 3300025981 Ga0207640_10091877 Ga0207640_100918772 335
320 3300025986 Ga0207658_10167609 Ga0207658_101676092 335
321 3300026035 Ga0207703_10201342 Ga0207703_102013423 335
322 3300026088 Ga0207641_10231771 Ga0207641_102317712 335
323 3300026089 Ga0207648_10000914 Ga0207648_1000091428 335
324 3300026118 Ga0207675_100100592 Ga0207675_1001005922 335
325 3300026121 Ga0207683_10015050 Ga0207683_100150504 335
326 3300026142 Ga0207698_10056007 Ga0207698_100560072 335
327 3300028379 Ga0268266_10104142 Ga0268266_101041422 335
328 3300028381 Ga0268264_10312312 Ga0268264_103123122 335
329 3300031251 Ga0265327_10000013 Ga0265327_10000013386 335
330 3300033179 Ga0307507_10113778 Ga0307507_101137782 335
331 3300044658 Ga0466972_0000049 Ga0466972_0000049_107128_108225 335
332 3300044658 Ga0466972_0017565 Ga0466972_0017565_1043_2140 335
333 3300044712 Ga0453684_0140637 Ga0453684_0140637_151_1233 335
334 3300044842 Ga0466957_0000101 Ga0466957_0000101_25101_26198 335
335 3300049581 Ga0501047_0051111 Ga0501047_0051111_1659_2756 335
336 3300049760 Ga0501263_001008 Ga0501263_001008_260_1390 335
337 3300050507 nmdc:mga05p37_3043_c1 nmdc:mga05p37_3043_c1_4430_5527 335
338 iso_pu_bacteria 2929154850 2929159498 335
339 3300005441 Ga0070700_100083413 Ga0070700_1000834132 336
340 3300005539 Ga0068853_100112970 Ga0068853_1001129702 336
341 3300005549 Ga0070704_100202317 Ga0070704_1002023172 336
342 3300005617 Ga0068859_100016964 Ga0068859_1000169648 336
343 3300005840 Ga0068870_10134867 Ga0068870_101348672 336
344 3300005841 Ga0068863_100205976 Ga0068863_1002059762 336
345 3300005844 Ga0068862_100125972 Ga0068862_1001259722 336
346 3300006881 Ga0068865_100212409 Ga0068865_1002124092 336
347 3300006931 Ga0097620_100016964 Ga0097620_1000169642 336
348 3300009545 Ga0105237_10000561 Ga0105237_1000056139 336
349 3300013296 Ga0157374_10285030 Ga0157374_102850301 336
350 3300013308 Ga0157375_10076477 Ga0157375_100764773 336
351 3300014325 Ga0163163_10068512 Ga0163163_100685123 336
352 3300014745 Ga0157377_10074208 Ga0157377_100742082 336
353 3300025908 Ga0207643_10090611 Ga0207643_100906112 336
354 3300025914 Ga0207671_10002341 Ga0207671_1000234113 336
355 3300025922 Ga0207646_10336890 Ga0207646_103368901 336
356 3300025925 Ga0207650_10245861 Ga0207650_102458611 336
357 3300025960 Ga0207651_10003386 Ga0207651_100033861 336
358 3300026023 Ga0207677_10057237 Ga0207677_100572372 336
359 3300026075 Ga0207708_10071529 Ga0207708_100715293 336
360 3300026075 Ga0207708_10385751 Ga0207708_103857511 336
361 3300028380 Ga0268265_10037171 Ga0268265_100371713 336
362 3300031507 Ga0307509_10029821 Ga0307509_100298215 336
363 3300035695 Ga0373927_0020503 Ga0373927_0020503_51_1148 336
364 3300036401 Ga0373937_0214647 Ga0373937_0214647_513_1595 336
365 3300041404 Ga0439436_0001213 Ga0439436_0001213_5645_6742 336
366 3300042014 Ga0439457_001516 Ga0439457_001516_2913_4010 336
367 3300044658 Ga0466972_0000057 Ga0466972_0000057_7353_8435 336
368 3300044765 Ga0466970_0000465 Ga0466970_0000465_5236_6318 336
369 3300053086 Ga0500578_0000605 Ga0500578_0000605_40975_42072 336
370 3300005337 Ga0070682_100000041 Ga0070682_10000004195 337
371 3300005546 Ga0070696_100306107 Ga0070696_1003061071 337
372 3300006195 Ga0075366_10078426 Ga0075366_100784262 337
373 3300006353 Ga0075370_10061243 Ga0075370_100612432 337
374 3300013102 Ga0157371_10019638 Ga0157371_100196383 337
375 3300025295 Ga0209564_1035408 Ga0209564_10354082 337
376 3300025297 Ga0209758_1016212 Ga0209758_10162123 337
377 3300025961 Ga0207712_10003616 Ga0207712_1000361613 337
378 3300039450 Ga0436363_0220785 Ga0436363_0220785_97_1179 337
379 3300046648 Ga0495611_0087910 Ga0495611_0087910_197_1285 337
380 3300049568 Ga0501031_0002497 Ga0501031_0002497_1092_2180 337
381 3300049572 Ga0501036_0002439 Ga0501036_0002439_459_1547 337
382 3300049573 Ga0501037_0037210 Ga0501037_0037210_2423_3511 337
383 3300049574 Ga0501038_0009021 Ga0501038_0009021_3687_4775 337
384 3300049579 Ga0501043_0307318 Ga0501043_0307318_67_1158 337
385 3300049589 Ga0501073_0174416 Ga0501073_0174416_353_1441 337
386 3300049822 Ga0501035_0048280 Ga0501035_0048280_332_1420 337
387 3300049823 Ga0501044_0157063 Ga0501044_0157063_600_1688 337
388 3300003322 rootL2_10088716 rootL2_100887165 338
389 3300004625 Ga0055543_1004307 Ga0055543_10043071 338
390 3300005334 Ga0068869_100055233 Ga0068869_1000552333 338
391 3300005466 Ga0070685_10010448 Ga0070685_100104484 338
392 3300005578 Ga0068854_100212374 Ga0068854_1002123742 338
393 3300009093 Ga0105240_10059025 Ga0105240_100590252 338
394 3300009553 Ga0105249_10007649 Ga0105249_100076492 338
395 3300010375 Ga0105239_10150909 Ga0105239_101509092 338
396 3300011119 Ga0105246_10049725 Ga0105246_100497252 338
397 3300013296 Ga0157374_10033206 Ga0157374_100332066 338
398 3300013306 Ga0163162_10082776 Ga0163162_100827764 338
399 3300013307 Ga0157372_10094322 Ga0157372_100943224 338
400 3300014325 Ga0163163_10130029 Ga0163163_101300292 338
401 3300014968 Ga0157379_10127216 Ga0157379_101272162 338
402 3300014969 Ga0157376_10065020 Ga0157376_100650201 338
403 3300025942 Ga0207689_10096102 Ga0207689_100961023 338
404 3300025981 Ga0207640_10191236 Ga0207640_101912361 338
405 3300046660 Ga0495625_0046749 Ga0495625_0046749_673_1824 338
406 3300047320 Ga0495672_0119624 Ga0495672_0119624_78_1160 338
407 3300053130 Ga0500642_0002303 Ga0500642_0002303_1875_2990 338
408 3300053146 Ga0500588_0001975 Ga0500588_0001975_2633_3784 338
409 3300053156 Ga0500622_0005886 Ga0500622_0005886_4896_6011 338
410 3300001989 JGI24739J22299_10005191 JGI24739J22299_100051913 339
411 3300003354 JGI25160J50197_1005658 JGI25160J50197_10056582 339
412 3300003771 Ga0055526_1032041 Ga0055526_10320412 339
413 3300003790 Ga0055528_1000060 Ga0055528_100006046 339
414 3300003791 Ga0055530_10000378 Ga0055530_100003782 339
415 3300005328 Ga0070676_10033667 Ga0070676_100336672 339
416 3300005364 Ga0070673_100043636 Ga0070673_1000436365 339
417 3300005367 Ga0070667_100005019 Ga0070667_1000050193 339
418 3300005459 Ga0068867_100025016 Ga0068867_1000250162 339
419 3300005459 Ga0068867_100209978 Ga0068867_1002099781 339
420 3300005466 Ga0070685_10019950 Ga0070685_100199503 339
421 3300005617 Ga0068859_100049549 Ga0068859_1000495495 339
422 3300005841 Ga0068863_100079031 Ga0068863_1000790312 339
423 3300005843 Ga0068860_100010971 Ga0068860_10001097114 339
424 3300006358 Ga0068871_100275702 Ga0068871_1002757022 339
425 3300006931 Ga0097620_100049547 Ga0097620_1000495475 339
426 3300013297 Ga0157378_10030079 Ga0157378_100300793 339
427 3300013297 Ga0157378_10134653 Ga0157378_101346532 339
428 3300013308 Ga0157375_10054957 Ga0157375_100549573 339
429 3300014326 Ga0157380_10286114 Ga0157380_102861141 339
430 3300025273 Ga0209673_1000258 Ga0209673_100025869 339
431 3300025295 Ga0209564_1008584 Ga0209564_10085845 339
432 3300025298 Ga0209050_1001018 Ga0209050_10010183 339
433 3300025302 Ga0207426_1000916 Ga0207426_100091611 339
434 3300025931 Ga0207644_10088369 Ga0207644_100883692 339
435 3300025942 Ga0207689_10009258 Ga0207689_100092587 339
436 3300026023 Ga0207677_10068700 Ga0207677_100687002 339
437 3300026088 Ga0207641_10012887 Ga0207641_100128873 339
438 3300028381 Ga0268264_10007750 Ga0268264_1000775014 339
439 3300041460 Ga0451802_1059356 Ga0451802_1059356_633_1730 339
440 3300044683 Ga0466965_0029525 Ga0466965_0029525_860_2011 339
441 3300046471 Ga0495650_0006071 Ga0495650_0006071_3126_4211 339
442 3300047472 Ga0495686_0071517 Ga0495686_0071517_529_1611 339
443 3300053088 Ga0500644_0027933 Ga0500644_0027933_104_1186 339
444 3300053092 Ga0500583_0000055 Ga0500583_0000055_6177_7274 339
445 3300053108 Ga0500562_000148 Ga0500562_000148_13002_14084 339
446 3300053139 Ga0500568_0000080 Ga0500568_0000080_13807_14892 339
447 3300053156 Ga0500622_0001787 Ga0500622_0001787_775_1857 339
448 3300005334 Ga0068869_100020688 Ga0068869_1000206881 340
449 3300005335 Ga0070666_10000055 Ga0070666_10000055103 340
450 3300005355 Ga0070671_100092547 Ga0070671_1000925471 340
451 3300005364 Ga0070673_100415274 Ga0070673_1004152741 340
452 3300005367 Ga0070667_100024969 Ga0070667_1000249696 340
453 3300005367 Ga0070667_100342979 Ga0070667_1003429791 340
454 3300005539 Ga0068853_100116708 Ga0068853_1001167082 340
455 3300005616 Ga0068852_100003367 Ga0068852_10000336715 340
456 3300005617 Ga0068859_100000003 Ga0068859_10000000328 340
457 3300005618 Ga0068864_100033275 Ga0068864_1000332753 340
458 3300005841 Ga0068863_100004065 Ga0068863_1000040656 340
459 3300005842 Ga0068858_100005095 Ga0068858_1000050951 340
460 3300005843 Ga0068860_100000691 Ga0068860_1000006916 340
461 3300005843 Ga0068860_100001083 Ga0068860_10000108326 340
462 3300006237 Ga0097621_100010257 Ga0097621_1000102575 340
463 3300006881 Ga0068865_100032955 Ga0068865_1000329553 340
464 3300006931 Ga0097620_100000003 Ga0097620_10000000328 340
465 3300009101 Ga0105247_10005675 Ga0105247_100056754 340
466 3300009174 Ga0105241_10000333 Ga0105241_1000033323 340
467 3300009545 Ga0105237_10002430 Ga0105237_100024302 340
468 3300009553 Ga0105249_10054386 Ga0105249_100543862 340
469 3300010375 Ga0105239_10015245 Ga0105239_1001524513 340
470 3300011119 Ga0105246_10017063 Ga0105246_100170633 340
471 3300013296 Ga0157374_10157436 Ga0157374_101574363 340
472 3300013297 Ga0157378_10012126 Ga0157378_1001212611 340
473 3300013306 Ga0163162_10000612 Ga0163162_1000061220 340
474 3300013306 Ga0163162_10027673 Ga0163162_100276735 340
475 3300013308 Ga0157375_10090619 Ga0157375_100906192 340
476 3300014968 Ga0157379_10199350 Ga0157379_101993503 340
477 3300014969 Ga0157376_10020146 Ga0157376_100201463 340
478 3300025297 Ga0209758_1010462 Ga0209758_10104623 340
479 3300025900 Ga0207710_10017508 Ga0207710_100175081 340
480 3300025903 Ga0207680_10001322 Ga0207680_1000132217 340
481 3300025911 Ga0207654_10000560 Ga0207654_1000056023 340
482 3300025931 Ga0207644_10076344 Ga0207644_100763443 340
483 3300025942 Ga0207689_10008230 Ga0207689_100082303 340
484 3300025960 Ga0207651_10274514 Ga0207651_102745141 340
485 3300025986 Ga0207658_10432471 Ga0207658_104324711 340
486 3300026035 Ga0207703_10006541 Ga0207703_100065414 340
487 3300026088 Ga0207641_10000026 Ga0207641_1000002620 340
488 3300026095 Ga0207676_10024459 Ga0207676_100244593 340
489 3300026118 Ga0207675_100063356 Ga0207675_1000633562 340
490 3300026142 Ga0207698_10056268 Ga0207698_100562683 340
491 3300028381 Ga0268264_10000558 Ga0268264_1000055837 340
492 3300028381 Ga0268264_10014547 Ga0268264_100145473 340
493 3300042004 Ga0439445_0019312 Ga0439445_0019312_398_1528 340
494 3300042876 Ga0451577_0104217 Ga0451577_0104217_1420_2514 340
495 3300044712 Ga0453684_0049686 Ga0453684_0049686_1486_2580 340
496 3300046616 Ga0495668_0000023 Ga0495668_0000023_171752_172849 340
497 3300049763 Ga0501266_000698 Ga0501266_000698_1401_2531 340
498 3300053727 Ga0500611_000003 Ga0500611_000003_245114_246202 340
499 3300003203 JGI25406J46586_10001107 JGI25406J46586_1000110711 341
500 3300005985 Ga0081539_10033535 Ga0081539_100335353 341
501 3300006358 Ga0068871_100056393 Ga0068871_1000563935 341
502 3300013306 Ga0163162_10063273 Ga0163162_100632731 341
503 3300013308 Ga0157375_10067613 Ga0157375_100676133 341
504 3300014969 Ga0157376_10033480 Ga0157376_100334804 341
505 3300025933 Ga0207706_10005451 Ga0207706_1000545110 341
506 3300046517 Ga0495630_0074091 Ga0495630_0074091_766_1848 341
507 3300049571 Ga0501034_0019990 Ga0501034_0019990_1575_2666 341
508 3300049572 Ga0501036_0008374 Ga0501036_0008374_3816_4907 341
509 3300049573 Ga0501037_0003269 Ga0501037_0003269_10160_11251 341
510 3300049575 Ga0501039_0010018 Ga0501039_0010018_3985_5076 341
511 3300049578 Ga0501042_0113170 Ga0501042_0113170_663_1754 341
512 3300049579 Ga0501043_0026166 Ga0501043_0026166_1023_2114 341
513 3300049580 Ga0501046_0022150 Ga0501046_0022150_843_1934 341
514 3300049581 Ga0501047_0007060 Ga0501047_0007060_6483_7574 341
515 3300049582 Ga0501048_0046772 Ga0501048_0046772_66_1157 341
516 3300049584 Ga0501068_0085057 Ga0501068_0085057_627_1718 341
517 3300049586 Ga0501070_0008420 Ga0501070_0008420_963_2054 341
518 3300049589 Ga0501073_0004719 Ga0501073_0004719_2674_3765 341
519 3300049590 Ga0501074_0002102 Ga0501074_0002102_3122_4213 341
520 3300049741 Ga0501079_0060691 Ga0501079_0060691_958_2049 341
521 3300049742 Ga0501080_0047276 Ga0501080_0047276_843_1934 341
522 3300049744 Ga0501083_0097795 Ga0501083_0097795_55_1146 341
523 3300049823 Ga0501044_0014267 Ga0501044_0014267_3847_4938 341
524 3300060353 Ga0501082_0204392 Ga0501082_0204392_413_1504 341
525 3300005543 Ga0070672_100092260 Ga0070672_1000922602 342
526 3300006358 Ga0068871_100263895 Ga0068871_1002638951 342
527 3300025940 Ga0207691_10016933 Ga0207691_100169336 342
528 3300025972 Ga0207668_10090546 Ga0207668_100905462 342
529 3300026089 Ga0207648_10387667 Ga0207648_103876671 342
530 3300028794 Ga0307515_10001257 Ga0307515_1000125762 342
531 3300032004 Ga0307414_10076775 Ga0307414_100767753 342
532 3300041406 Ga0439439_0002695 Ga0439439_0002695_1577_2698 342
533 3300003323 rootH1_10010306 rootH1_1001030617 343
534 3300042007 Ga0439449_0007699 Ga0439449_0007699_1774_2898 343
535 3300042007 Ga0439449_0009577 Ga0439449_0009577_27_1247 343
536 3300042014 Ga0439457_012653 Ga0439457_012653_383_1603 343
537 3300013297 Ga0157378_10069590 Ga0157378_100695903 344
538 3300014968 Ga0157379_10066239 Ga0157379_100662392 344
539 3300026089 Ga0207648_10237059 Ga0207648_102370592 344
540 3300048912 Ga0496109_0220929 Ga0496109_0220929_528_1640 344
541 3300013306 Ga0163162_10266747 Ga0163162_102667472 346
542 3300013307 Ga0157372_10417014 Ga0157372_104170141 346
543 3300049705 Ga0501225_0002813 Ga0501225_0002813_2535_3659 346
544 3300049823 Ga0501044_0202424 Ga0501044_0202424_261_1595 347
545 3300003320 rootH2_10157843 rootH2_101578436 348
546 3300036401 Ga0373937_0260314 Ga0373937_0260314_44_1156 348
547 3300046517 Ga0495630_0122687 Ga0495630_0122687_315_1427 348
548 3300005841 Ga0068863_100273236 Ga0068863_1002732362 349
549 3300009545 Ga0105237_10098083 Ga0105237_100980832 349
550 3300010375 Ga0105239_10031587 Ga0105239_100315874 349
551 3300013307 Ga0157372_10345234 Ga0157372_103452342 349
552 3300025914 Ga0207671_10059635 Ga0207671_100596353 349
553 3300003323 rootH1_10091716 rootH1_100917163 350
554 3300041404 Ga0439436_0026910 Ga0439436_0026910_213_1358 350
555 3300001979 JGI24740J21852_10007622 JGI24740J21852_100076222 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

217

405

0.95

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

51

100

0.93

Feature Viewer

pLDDT pTM Quality
67.6 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map