F463131

General Info

Members Datasets Scaffolds Average Seq Length
555 285 1110 185

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2902750|Ga0451853_2902750_1971_2618
Length 215
Sequence VGVPPARRVQRLDRLEAARDDGEAAALGATKLSTETSDAQLVARCRTGDEDAWRELVDRFSRYVYAICVQAFRLPEHDAEDVYQEVFARVYEKLETLRDDDAFRPWIAQLTRRLCIDRKRSGSREEPADEVPETAADDVLGELEEAFDVHEALAALPDNCQEILDRFFARDESYRTIGDALELPAGTIASRISRCLTKLREHWEETAPSPRPESR

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.49
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2902750 3300041512 Bacteria 4361
2 JGI24739J22299_10009553 3300001989 Bacteria 3611
3 JGI24743J22301_10002604 3300001991 Bacteria 2749
4 JGI24745J21846_1011268 3300002073 Bacteria 1021
5 JGI24738J21930_10004220 3300002075 Bacteria 3542
6 JGI25406J46586_10023942 3300003203 Bacteria 2403
7 Ga0070658_10009957 3300005327 Bacteria 7636
8 Ga0070658_10012775 3300005327 Bacteria 6737
9 Ga0070676_10062189 3300005328 Unclassified 2221
10 Ga0070683_100011807 3300005329 Bacteria 7565
11 Ga0070683_100039355 3300005329 Bacteria 4340
12 Ga0070683_100070516 3300005329 Bacteria 3260
13 Ga0070683_100309423 3300005329 Bacteria 1503
14 Ga0070683_100633800 3300005329 Bacteria 1023
15 Ga0070683_100754193 3300005329 Bacteria 932
16 Ga0068869_100406909 3300005334 Bacteria 1120
17 Ga0070680_100007722 3300005336 Bacteria 8203
18 Ga0070680_100196034 3300005336 Bacteria 1703
19 Ga0070680_100210469 3300005336 Bacteria 1640
20 Ga0070682_100005802 3300005337 Bacteria 6895
21 Ga0070682_100028835 3300005337 Bacteria 3340
22 Ga0068868_100015810 3300005338 Bacteria 5591
23 Ga0068868_100018685 3300005338 Bacteria 5186
24 Ga0068868_100388133 3300005338 Bacteria 1202
25 Ga0068868_100449595 3300005338 Unclassified 1120
26 Ga0070660_100003768 3300005339 Bacteria 10475
27 Ga0070660_100106331 3300005339 Bacteria 2228
28 Ga0070660_100163619 3300005339 Bacteria 1794
29 Ga0070689_100045964 3300005340 Bacteria 3363
30 Ga0070691_10001260 3300005341 Bacteria 10685
31 Ga0070691_10166618 3300005341 Bacteria 1139
32 Ga0070687_100109657 3300005343 Unclassified 1560
33 Ga0070687_100261223 3300005343 Bacteria 1081
34 Ga0070661_100023428 3300005344 Bacteria 4424
35 Ga0070661_100089486 3300005344 Bacteria 2279
36 Ga0070692_10008454 3300005345 Bacteria 4593
37 Ga0070668_100149837 3300005347 Bacteria 1885
38 Ga0070668_100185881 3300005347 Unclassified 1699
39 Ga0070669_100659777 3300005353 Bacteria 881
40 Ga0070675_100056165 3300005354 Bacteria 3243
41 Ga0070675_100062601 3300005354 Bacteria 3074
42 Ga0070674_100033123 3300005356 Bacteria 3437
43 Ga0070674_100070013 3300005356 Bacteria 2477
44 Ga0070673_100016083 3300005364 Bacteria 5279
45 Ga0070688_100060142 3300005365 Bacteria 2398
46 Ga0070659_100016025 3300005366 Bacteria 5622
47 Ga0070659_100150837 3300005366 Bacteria 1896
48 Ga0070659_100221856 3300005366 Unclassified 1560
49 Ga0070659_100496272 3300005366 Bacteria 1040
50 Ga0070709_10136392 3300005434 Bacteria 1681
51 Ga0070714_100000534 3300005435 Bacteria 27486
52 Ga0070714_100206801 3300005435 Bacteria 1798
53 Ga0070713_100295169 3300005436 Bacteria 1491
54 Ga0070710_10643259 3300005437 Archaea 743
55 Ga0070711_100169280 3300005439 Bacteria 1664
56 Ga0070711_100324616 3300005439 Bacteria 1231
57 Ga0070711_101035909 3300005439 Unclassified 705
58 Ga0070705_100028253 3300005440 Bacteria 3070
59 Ga0070700_100295367 3300005441 Unclassified 1180
60 Ga0070708_100400761 3300005445 Unclassified 1294
61 Ga0070663_100066145 3300005455 Bacteria 2619
62 Ga0070663_100509805 3300005455 Bacteria 1000
63 Ga0070678_100048072 3300005456 Bacteria 3070
64 Ga0070662_100057127 3300005457 Bacteria 2835
65 Ga0070662_100060725 3300005457 Bacteria 2757
66 Ga0070681_10014088 3300005458 Bacteria 7958
67 Ga0070681_10106575 3300005458 Bacteria 2744
68 Ga0070681_10353187 3300005458 Bacteria 1380
69 Ga0070681_10443775 3300005458 Bacteria 1210
70 Ga0068867_100098330 3300005459 Unclassified 2231
71 Ga0070685_10000906 3300005466 Bacteria 15926
72 Ga0070685_10643337 3300005466 Bacteria 767
73 Ga0070706_100391421 3300005467 Unclassified 1294
74 Ga0070707_100000564 3300005468 Bacteria 37210
75 Ga0070707_100182539 3300005468 Bacteria 2046
76 Ga0070698_100163405 3300005471 Bacteria 2170
77 Ga0070698_100269645 3300005471 Bacteria 1634
78 Ga0070698_100365909 3300005471 Unclassified 1374
79 Ga0070679_100016904 3300005530 Bacteria 7052
80 Ga0070684_100003823 3300005535 Bacteria 11385
81 Ga0070684_100030633 3300005535 Bacteria 4572
82 Ga0070684_100131786 3300005535 Bacteria 2255
83 Ga0070684_100224711 3300005535 Bacteria 1713
84 Ga0070684_101089597 3300005535 Bacteria 750
85 Ga0068853_100019416 3300005539 Bacteria 5634
86 Ga0070672_100009681 3300005543 Bacteria 6653
87 Ga0070672_100092763 3300005543 Bacteria 2438
88 Ga0070686_100047567 3300005544 Bacteria 2713
89 Ga0070686_100153334 3300005544 Unclassified 1616
90 Ga0070696_100150709 3300005546 Bacteria 1707
91 Ga0070693_100258657 3300005547 Bacteria 1157
92 Ga0070704_100031797 3300005549 Bacteria 3553
93 Ga0068855_100019417 3300005563 Bacteria 8167
94 Ga0068855_100045021 3300005563 Bacteria 5220
95 Ga0068855_100108374 3300005563 Bacteria 3190
96 Ga0068855_100348342 3300005563 Bacteria 1632
97 Ga0070664_100019090 3300005564 Bacteria 5637
98 Ga0070664_100139430 3300005564 Unclassified 2134
99 Ga0070664_100557835 3300005564 Bacteria 1059
100 Ga0068857_100129121 3300005577 Bacteria 2279
101 Ga0068854_100009658 3300005578 Bacteria 6231
102 Ga0068854_100031774 3300005578 Bacteria 3671
103 Ga0068856_100182478 3300005614 Bacteria 2112
104 Ga0068856_100197369 3300005614 Bacteria 2027
105 Ga0068856_100281164 3300005614 Bacteria 1681
106 Ga0068856_100307142 3300005614 Bacteria 1604
107 Ga0070702_100029216 3300005615 Unclassified 2995
108 Ga0068852_100180797 3300005616 Bacteria 1983
109 Ga0068852_100303344 3300005616 Bacteria 1546
110 Ga0068859_100070692 3300005617 Bacteria 3526
111 Ga0068864_100010882 3300005618 Bacteria 7520
112 Ga0068866_10111581 3300005718 Bacteria 1527
113 Ga0068861_100021349 3300005719 Bacteria 4654
114 Ga0068861_100070230 3300005719 Unclassified 2711
115 Ga0068851_10067900 3300005834 Bacteria 1839
116 Ga0068870_10137223 3300005840 Bacteria 1427
117 Ga0068858_100201243 3300005842 Bacteria 1883
118 Ga0068858_100856962 3300005842 Unclassified 887
119 Ga0068862_100478801 3300005844 Bacteria 1178
120 Ga0081455_10011076 3300005937 Bacteria 9079
121 Ga0081455_10029480 3300005937 Bacteria 5003
122 Ga0081455_10132703 3300005937 Bacteria 1945
123 Ga0081455_10137007 3300005937 Bacteria 1906
124 Ga0081538_10001049 3300005981 Bacteria 29454
125 Ga0081538_10002782 3300005981 Bacteria 16758
126 Ga0081538_10066434 3300005981 Bacteria 2022
127 Ga0081538_10120513 3300005981 Bacteria 1262
128 Ga0081539_10000171 3300005985 Bacteria 152572
129 Ga0081539_10002275 3300005985 Bacteria 27826
130 Ga0070717_10440295 3300006028 Bacteria 1174
131 Ga0075432_10080716 3300006058 Bacteria 1179
132 Ga0070712_100109403 3300006175 Unclassified 2059
133 Ga0070712_100298518 3300006175 Bacteria 1303
134 Ga0097621_100075643 3300006237 Bacteria 2792
135 Ga0097621_100456439 3300006237 Bacteria 1152
136 Ga0068871_100285138 3300006358 Unclassified 1446
137 Ga0075428_100065366 3300006844 Bacteria 3983
138 Ga0075428_100088055 3300006844 Bacteria 3387
139 Ga0075428_100250869 3300006844 Bacteria 1907
140 Ga0075430_100004202 3300006846 Bacteria 12148
141 Ga0075430_100155590 3300006846 Bacteria 1903
142 Ga0075430_100217403 3300006846 Bacteria 1586
143 Ga0075431_100009438 3300006847 Bacteria 9795
144 Ga0075431_100090689 3300006847 Bacteria 3155
145 Ga0075431_100745030 3300006847 Bacteria 955
146 Ga0075429_100014659 3300006880 Bacteria 6796
147 Ga0075429_100244787 3300006880 Unclassified 1570
148 Ga0068865_100014242 3300006881 Bacteria 5049
149 Ga0068865_100021761 3300006881 Bacteria 4174
150 Ga0097620_100070694 3300006931 Bacteria 3526
151 Ga0105244_10089755 3300009036 Unclassified 1512
152 Ga0105240_10023055 3300009093 Bacteria 8243
153 Ga0111539_10027803 3300009094 Bacteria 6907
154 Ga0111539_10105413 3300009094 Bacteria 3307
155 Ga0111539_10360477 3300009094 Bacteria 1692
156 Ga0111539_10637502 3300009094 Unclassified 1241
157 Ga0105245_10015399 3300009098 Bacteria 6666
158 Ga0105245_10030240 3300009098 Bacteria 4789
159 Ga0105245_10071050 3300009098 Bacteria 3160
160 Ga0105245_10719780 3300009098 Bacteria 1032
161 Ga0105245_10875241 3300009098 Unclassified 939
162 Ga0105245_11302914 3300009098 Unclassified 775
163 Ga0114129_10086527 3300009147 Bacteria 4347
164 Ga0114129_10207023 3300009147 Unclassified 2654
165 Ga0114129_10222726 3300009147 Bacteria 2544
166 Ga0114129_10230261 3300009147 Bacteria 2496
167 Ga0114129_11584047 3300009147 Bacteria 802
168 Ga0105243_10020968 3300009148 Bacteria 4958
169 Ga0105243_10176472 3300009148 Bacteria 1855
170 Ga0105243_10235190 3300009148 Bacteria 1627
171 Ga0105242_10104634 3300009176 Unclassified 2403
172 Ga0105242_10349689 3300009176 Bacteria 1365
173 Ga0105242_10655356 3300009176 Unclassified 1021
174 Ga0105248_10087928 3300009177 Bacteria 3497
175 Ga0105238_10045194 3300009551 Bacteria 4449
176 Ga0105249_10160033 3300009553 Unclassified 2175
177 Ga0105249_10401909 3300009553 Bacteria 1400
178 Ga0105249_11350425 3300009553 Bacteria 784
179 Ga0105239_10009930 3300010375 Bacteria 10687
180 Ga0105239_10086223 3300010375 Bacteria 3461
181 Ga0105239_10361890 3300010375 Bacteria 1638
182 Ga0105239_11385656 3300010375 Bacteria 812
183 Ga0105246_10565618 3300011119 Bacteria 977
184 Ga0105246_10647911 3300011119 Bacteria 919
185 Ga0157338_1010995 3300012515 Bacteria 924
186 Ga0157373_10497949 3300013100 Bacteria 880
187 Ga0157371_10024786 3300013102 Bacteria 4377
188 Ga0157371_10392631 3300013102 Bacteria 1014
189 Ga0157370_10004172 3300013104 Bacteria 16719
190 Ga0157369_10286377 3300013105 Unclassified 1716
191 Ga0157378_10125432 3300013297 Bacteria 2371
192 Ga0163162_10131259 3300013306 Bacteria 2614
193 Ga0163162_10709188 3300013306 Bacteria 1127
194 Ga0163162_11399641 3300013306 Bacteria 796
195 Ga0157372_10066896 3300013307 Bacteria 4037
196 Ga0157372_10269601 3300013307 Bacteria 1978
197 Ga0157375_10060332 3300013308 Bacteria 3761
198 Ga0157377_10654420 3300014745 Bacteria 757
199 Ga0157379_10014155 3300014968 Bacteria 6995
200 Ga0157376_11182319 3300014969 Bacteria 792
201 Ga0163161_10058119 3300017792 Bacteria 2811
202 Ga0206356_10164098 3300020070 Bacteria 3502
203 Ga0206353_10804376 3300020082 Bacteria 1512
204 Ga0207656_10008395 3300025321 Bacteria 3800
205 Ga0207653_10075709 3300025885 Unclassified 1157
206 Ga0207710_10045174 3300025900 Bacteria 1964
207 Ga0207688_10007834 3300025901 Bacteria 5813
208 Ga0207688_10055373 3300025901 Bacteria 2226
209 Ga0207688_10093892 3300025901 Unclassified 1726
210 Ga0207680_10557495 3300025903 Bacteria 818
211 Ga0207645_10276291 3300025907 Bacteria 1115
212 Ga0207643_10033728 3300025908 Bacteria 2865
213 Ga0207705_10010385 3300025909 Bacteria 6770
214 Ga0207705_10020084 3300025909 Bacteria 4778
215 Ga0207705_10055721 3300025909 Bacteria 2850
216 Ga0207654_10214472 3300025911 Bacteria 1274
217 Ga0207707_10056785 3300025912 Bacteria 3406
218 Ga0207707_10060132 3300025912 Bacteria 3306
219 Ga0207707_10402264 3300025912 Bacteria 1175
220 Ga0207707_10447500 3300025912 Bacteria 1105
221 Ga0207695_10061514 3300025913 Bacteria 3880
222 Ga0207693_10183911 3300025915 Bacteria 1645
223 Ga0207663_10339764 3300025916 Bacteria 1134
224 Ga0207660_10013696 3300025917 Bacteria 5321
225 Ga0207660_10065235 3300025917 Bacteria 2630
226 Ga0207662_10103282 3300025918 Unclassified 1768
227 Ga0207657_10002820 3300025919 Bacteria 18682
228 Ga0207657_10013681 3300025919 Bacteria 7948
229 Ga0207657_10033147 3300025919 Bacteria 4659
230 Ga0207657_10053457 3300025919 Bacteria 3499
231 Ga0207657_10086426 3300025919 Bacteria 2625
232 Ga0207649_10068319 3300025920 Unclassified 2259
233 Ga0207652_10007201 3300025921 Bacteria 8974
234 Ga0207652_10070488 3300025921 Bacteria 3036
235 Ga0207646_10001221 3300025922 Bacteria 32278
236 Ga0207646_10133026 3300025922 Bacteria 2239
237 Ga0207694_10228689 3300025924 Bacteria 1518
238 Ga0207659_10141128 3300025926 Bacteria 1870
239 Ga0207659_10284818 3300025926 Unclassified 1352
240 Ga0207687_10015563 3300025927 Bacteria 4989
241 Ga0207687_10103199 3300025927 Bacteria 2102
242 Ga0207687_10137947 3300025927 Bacteria 1847
243 Ga0207700_10205186 3300025928 Bacteria 1663
244 Ga0207664_10008194 3300025929 Bacteria 7275
245 Ga0207664_10075187 3300025929 Unclassified 2730
246 Ga0207664_10453976 3300025929 Archaea 1144
247 Ga0207664_10581684 3300025929 Bacteria 1005
248 Ga0207690_10169773 3300025932 Bacteria 1633
249 Ga0207690_10495514 3300025932 Bacteria 988
250 Ga0207706_10038313 3300025933 Bacteria 4253
251 Ga0207709_10012716 3300025935 Bacteria 4639
252 Ga0207670_10089686 3300025936 Bacteria 2170
253 Ga0207669_10017721 3300025937 Bacteria 3661
254 Ga0207704_10021890 3300025938 Bacteria 3414
255 Ga0207665_10409246 3300025939 Bacteria 1034
256 Ga0207691_10044492 3300025940 Bacteria 4086
257 Ga0207711_10054608 3300025941 Bacteria 3429
258 Ga0207711_10137590 3300025941 Bacteria 2195
259 Ga0207689_10039458 3300025942 Bacteria 3909
260 Ga0207661_10021240 3300025944 Bacteria 4863
261 Ga0207661_10027499 3300025944 Bacteria 4345
262 Ga0207661_10227487 3300025944 Bacteria 1650
263 Ga0207667_10019259 3300025949 Bacteria 7628
264 Ga0207667_10036844 3300025949 Bacteria 5237
265 Ga0207667_10107248 3300025949 Bacteria 2881
266 Ga0207667_10381405 3300025949 Bacteria 1436
267 Ga0207651_10009397 3300025960 Bacteria 5350
268 Ga0207712_11224694 3300025961 Unclassified 670
269 Ga0207640_10016163 3300025981 Bacteria 4335
270 Ga0207640_10016720 3300025981 Bacteria 4275
271 Ga0207658_10165815 3300025986 Bacteria 1815
272 Ga0207677_10072671 3300026023 Bacteria 2432
273 Ga0207677_10543632 3300026023 Bacteria 1011
274 Ga0207639_10168971 3300026041 Bacteria 1850
275 Ga0207678_10021354 3300026067 Bacteria 5677
276 Ga0207708_10119195 3300026075 Bacteria 2056
277 Ga0207708_10251895 3300026075 Unclassified 1423
278 Ga0207708_10280783 3300026075 Bacteria 1349
279 Ga0207702_10154033 3300026078 Bacteria 2093
280 Ga0207702_10306969 3300026078 Unclassified 1507
281 Ga0207702_10559335 3300026078 Bacteria 1119
282 Ga0207641_10066803 3300026088 Unclassified 3079
283 Ga0207648_10042238 3300026089 Bacteria 4003
284 Ga0207674_10024468 3300026116 Bacteria 6453
285 Ga0207674_10168750 3300026116 Bacteria 2142
286 Ga0207675_100797673 3300026118 Bacteria 957
287 Ga0207683_10066608 3300026121 Bacteria 3176
288 Ga0207698_10030013 3300026142 Bacteria 3903
289 Ga0207698_10239988 3300026142 Bacteria 1651
290 Ga0207428_10010536 3300027907 Bacteria 8254
291 Ga0207428_10022706 3300027907 Bacteria 5289
292 Ga0207428_10128674 3300027907 Bacteria 1938
293 Ga0307409_100416757 3300031995 Bacteria 1287
294 Ga0307416_101212142 3300032002 Unclassified 860
295 Ga0307415_100091250 3300032126 Bacteria 2206
296 Ga0307415_100103255 3300032126 Bacteria 2097
297 Ga0373928_0007892 3300035084 Unclassified 2061
298 Ga0373940_0070864 3300035088 Unclassified 1015
299 Ga0373953_0030942 3300035117 Bacteria 2079
300 Ga0373954_0023214 3300035118 Unclassified 2819
301 Ga0373956_0030302 3300035119 Unclassified 2364
302 Ga0373955_0004204 3300035172 Bacteria 6354
303 Ga0373961_0018028 3300035241 Bacteria 1839
304 Ga0373924_0243078 3300035410 Unclassified 796
305 Ga0373933_0013361 3300035724 Bacteria 4550
306 Ga0373937_0005203 3300036401 Bacteria 11104
307 Ga0373937_0112371 3300036401 Bacteria 2534
308 Ga0395899_0004765 3300037312 Bacteria 10579
309 Ga0395899_0025797 3300037312 Bacteria 4436
310 Ga0395899_0209689 3300037312 Bacteria 1354
311 Ga0395900_0002716 3300037418 Bacteria 19341
312 Ga0395900_0088113 3300037418 Archaea 3190
313 Ga0395900_0201041 3300037418 Bacteria 2016
314 Ga0395900_0233976 3300037418 Bacteria 1846
315 Ga0395900_0279414 3300037418 Bacteria 1662
316 Ga0395900_0508657 3300037418 Bacteria 1154
317 Ga0395898_0001463 3300037466 Bacteria 33319
318 Ga0395898_0594102 3300037466 Bacteria 1049
319 Ga0395898_1001882 3300037466 Unclassified 771
320 Ga0395905_0000561 3300037471 Bacteria 50535
321 Ga0395905_0058389 3300037471 Archaea 3607
322 Ga0395905_0111667 3300037471 Archaea 2566
323 Ga0395905_0188172 3300037471 Bacteria 1937
324 Ga0395905_0269162 3300037471 Unclassified 1590
325 Ga0395905_0322718 3300037471 Bacteria 1434
326 Ga0395905_0330874 3300037471 Bacteria 1414
327 Ga0395901_0004765 3300038443 Bacteria 13687
328 Ga0395901_0034169 3300038443 Bacteria 5250
329 Ga0395901_0087740 3300038443 Bacteria 3253
330 Ga0395901_0140930 3300038443 Bacteria 2534
331 Ga0395901_0163976 3300038443 Bacteria 2333
332 Ga0395901_0716381 3300038443 Bacteria 997
333 Ga0242420_055525 3300038996 Bacteria 782
334 Ga0451807_1659434 3300041486 Bacteria 1278
335 Ga0451835_0303934 3300041492 Bacteria 835
336 Ga0451843_1444616 3300041509 Bacteria 758
337 Ga0439455_0081366 3300042012 Bacteria 880
338 Ga0439456_016093 3300042013 Bacteria 1564
339 Ga0439463_057515 3300042016 Unclassified 994
340 Ga0450920_009428 3300042122 Unclassified 1796
341 Ga0450907_009803 3300042146 Unclassified 1589
342 Ga0439460_0053281 3300042461 Bacteria 1218
343 Ga0466969_0071765 3300044656 Bacteria 1664
344 Ga0466965_0046352 3300044683 Bacteria 2152
345 Ga0466961_0030475 3300044693 Bacteria 3467
346 Ga0466961_0065511 3300044693 Bacteria 2309
347 Ga0466961_0139632 3300044693 Bacteria 1517
348 Ga0466963_0017760 3300044694 Bacteria 4437
349 Ga0466963_0019392 3300044694 Bacteria 4264
350 Ga0466963_0025776 3300044694 Bacteria 3753
351 Ga0466963_0030236 3300044694 Bacteria 3493
352 Ga0466963_0068767 3300044694 Bacteria 2379
353 Ga0466963_0078221 3300044694 Bacteria 2235
354 Ga0466964_0009780 3300044706 Bacteria 3613
355 Ga0466964_0011185 3300044706 Bacteria 3389
356 Ga0466964_0174466 3300044706 Bacteria 1015
357 Ga0466971_0015737 3300044719 Bacteria 3331
358 Ga0466968_0038226 3300044735 Bacteria 2016
359 Ga0466968_0038662 3300044735 Bacteria 2006
360 Ga0466970_0179604 3300044765 Unclassified 1174
361 Ga0466970_0367031 3300044765 Unclassified 818
362 Ga0466957_0000400 3300044842 Bacteria 21152
363 Ga0466957_0013055 3300044842 Bacteria 4813
364 Ga0466957_0063471 3300044842 Bacteria 2270
365 Ga0466960_0671648 3300044901 Bacteria 620
366 Ga0466959_0051468 3300045049 Bacteria 3020
367 Ga0466959_0058425 3300045049 Bacteria 2809
368 Ga0466959_0140246 3300045049 Bacteria 1709
369 Ga0451576_0104924 3300045051 Bacteria 2940
370 Ga0466958_0077333 3300045836 Unclassified 2043
371 Ga0466958_0231643 3300045836 Bacteria 1179
372 Ga0466967_0016442 3300045976 Bacteria 5834
373 Ga0466967_0024523 3300045976 Bacteria 4960
374 Ga0466967_0032891 3300045976 Bacteria 4384
375 Ga0466967_0168645 3300045976 Bacteria 2058
376 Ga0466967_0168981 3300045976 Bacteria 2056
377 Ga0466967_0208201 3300045976 Bacteria 1854
378 Ga0466967_0366727 3300045976 Bacteria 1396
379 Ga0466967_0367349 3300045976 Bacteria 1395
380 Ga0466967_0475584 3300045976 Bacteria 1223
381 Ga0466967_0899530 3300045976 Unclassified 880
382 Ga0495592_0091924 3300046454 Bacteria 2175
383 Ga0495592_0201707 3300046454 Bacteria 1342
384 Ga0495651_0025658 3300046462 Bacteria 4590
385 Ga0495651_0077992 3300046462 Bacteria 2506
386 Ga0495651_0675510 3300046462 Unclassified 645
387 Ga0495653_0012989 3300046463 Bacteria 6796
388 Ga0495653_0102481 3300046463 Bacteria 2071
389 Ga0495653_0214022 3300046463 Bacteria 1300
390 Ga0495653_0373441 3300046463 Bacteria 912
391 Ga0495653_0502174 3300046463 Unclassified 756
392 Ga0495584_0062557 3300046491 Unclassified 1871
393 Ga0495585_0185354 3300046492 Bacteria 1068
394 Ga0495608_0005504 3300046511 Bacteria 9045
395 Ga0495608_0015667 3300046511 Bacteria 5250
396 Ga0495608_0102576 3300046511 Bacteria 1844
397 Ga0495628_0091035 3300046516 Bacteria 2361
398 Ga0495630_0031879 3300046517 Unclassified 3925
399 Ga0495630_0119203 3300046517 Bacteria 2001
400 Ga0495652_0081258 3300046529 Unclassified 2673
401 Ga0495640_0127095 3300046533 Bacteria 1652
402 Ga0495640_0247919 3300046533 Bacteria 1116
403 Ga0495587_0013622 3300046536 Bacteria 5109
404 Ga0495587_0209433 3300046536 Bacteria 1101
405 Ga0495645_0112154 3300046543 Bacteria 1928
406 Ga0495645_0390052 3300046543 Bacteria 889
407 Ga0495667_0025320 3300046559 Bacteria 3998
408 Ga0495667_0067653 3300046559 Unclassified 2333
409 Ga0495635_0009794 3300046663 Bacteria 6700
410 Ga0495635_0037422 3300046663 Bacteria 3359
411 Ga0495657_0011476 3300046675 Bacteria 6622
412 Ga0495657_0022128 3300046675 Bacteria 4558
413 Ga0495599_0013250 3300046678 Bacteria 5094
414 Ga0495599_0093620 3300046678 Bacteria 1874
415 Ga0495599_0237500 3300046678 Bacteria 1112
416 Ga0495623_0005560 3300046679 Bacteria 8229
417 Ga0495646_0034601 3300046680 Bacteria 3137
418 Ga0495646_0208013 3300046680 Bacteria 1063
419 Ga0495613_0036581 3300046689 Unclassified 3641
420 Ga0495624_0258397 3300046690 Bacteria 1053
421 Ga0495600_0012898 3300046809 Bacteria 5237
422 Ga0495600_0286603 3300046809 Bacteria 1041
423 Ga0495604_0003081 3300047317 Bacteria 13331
424 Ga0495674_0053283 3300047319 Bacteria 3557
425 Ga0495674_0068225 3300047319 Unclassified 3078
426 Ga0495680_0007607 3300047322 Bacteria 9903
427 Ga0495680_0211468 3300047322 Bacteria 1388
428 Ga0495675_0055085 3300047444 Bacteria 2522
429 Ga0495675_0204951 3300047444 Bacteria 1199
430 Ga0495684_0035209 3300047471 Unclassified 3840
431 Ga0495684_0254181 3300047471 Bacteria 1277
432 Ga0495602_0068981 3300048088 Bacteria 3034
433 Ga0495602_0085312 3300048088 Unclassified 2639
434 Ga0496100_0171235 3300048903 Unclassified 1564
435 Ga0496100_0599395 3300048903 Bacteria 855
436 Ga0496101_0052998 3300048904 Bacteria 2926
437 Ga0496101_0145771 3300048904 Bacteria 1808
438 Ga0496101_0233083 3300048904 Unclassified 1431
439 Ga0496102_0329209 3300048905 Bacteria 1439
440 Ga0496103_0150970 3300048906 Bacteria 1488
441 Ga0496104_0320909 3300048907 Bacteria 1462
442 Ga0496104_1251145 3300048907 Bacteria 645
443 Ga0496105_0304174 3300048908 Bacteria 1281
444 Ga0496106_0014802 3300048909 Bacteria 5768
445 Ga0496106_0239221 3300048909 Unclassified 1451
446 Ga0496106_0606837 3300048909 Bacteria 876
447 Ga0496107_0022049 3300048910 Bacteria 4499
448 Ga0496108_0669129 3300048911 Bacteria 902
449 Ga0496109_0079319 3300048912 Bacteria 3024
450 Ga0496109_0108427 3300048912 Bacteria 2581
451 Ga0496109_0266446 3300048912 Unclassified 1614
452 Ga0496109_0386274 3300048912 Bacteria 1323
453 Ga0496109_0627385 3300048912 Bacteria 1011
454 Ga0496110_0236632 3300048913 Bacteria 1662
455 Ga0496111_0731958 3300048914 Unclassified 718
456 Ga0496111_0733454 3300048914 Bacteria 717
457 Ga0496112_0017312 3300048915 Bacteria 6769
458 Ga0496112_0106335 3300048915 Bacteria 2776
459 Ga0496113_0485914 3300048916 Unclassified 992
460 Ga0496113_0587320 3300048916 Bacteria 892
461 Ga0496114_0203376 3300048917 Bacteria 1735
462 Ga0496114_0243283 3300048917 Unclassified 1582
463 Ga0496114_0261810 3300048917 Bacteria 1523
464 Ga0496114_0599777 3300048917 Bacteria 971
465 Ga0496114_0763647 3300048917 Bacteria 844
466 Ga0496115_0033994 3300048918 Bacteria 4029
467 Ga0496115_0060278 3300048918 Bacteria 3057
468 Ga0496115_0490140 3300048918 Unclassified 989
469 Ga0501031_0131606 3300049568 Bacteria 1634
470 Ga0501033_0036566 3300049570 Bacteria 3679
471 Ga0501033_0078980 3300049570 Bacteria 2415
472 Ga0501036_0078109 3300049572 Bacteria 2800
473 Ga0501036_0229935 3300049572 Bacteria 1556
474 Ga0501038_0059585 3300049574 Bacteria 3270
475 Ga0501038_0423454 3300049574 Bacteria 1027
476 Ga0501039_0049196 3300049575 Bacteria 3259
477 Ga0501039_0061164 3300049575 Bacteria 2916
478 Ga0501039_0503184 3300049575 Bacteria 951
479 Ga0501040_0002792 3300049576 Bacteria 11256
480 Ga0501040_0013812 3300049576 Bacteria 5315
481 Ga0501040_0207220 3300049576 Bacteria 1393
482 Ga0501041_0003126 3300049577 Bacteria 9523
483 Ga0501041_0272442 3300049577 Bacteria 1065
484 Ga0501041_0450166 3300049577 Bacteria 817
485 Ga0501042_0035218 3300049578 Bacteria 3551
486 Ga0501042_0049583 3300049578 Bacteria 2995
487 Ga0501043_0081489 3300049579 Bacteria 2543
488 Ga0501046_0023832 3300049580 Bacteria 5029
489 Ga0501046_0647535 3300049580 Unclassified 747
490 Ga0501048_0018043 3300049582 Bacteria 5193
491 Ga0501048_0094689 3300049582 Bacteria 2106
492 Ga0501067_0287195 3300049583 Bacteria 916
493 Ga0501068_0236466 3300049584 Bacteria 1162
494 Ga0501069_0072974 3300049585 Bacteria 1924
495 Ga0501070_0152982 3300049586 Bacteria 1903
496 Ga0501071_0018260 3300049587 Bacteria 4853
497 Ga0501071_0087653 3300049587 Bacteria 2283
498 Ga0501071_0807780 3300049587 Bacteria 723
499 Ga0501072_0043467 3300049588 Bacteria 3530
500 Ga0501072_0131280 3300049588 Bacteria 1996
501 Ga0501072_0405890 3300049588 Bacteria 1081
502 Ga0501074_0034413 3300049590 Bacteria 3672
503 Ga0501075_0032656 3300049591 Bacteria 3868
504 Ga0501075_0268668 3300049591 Bacteria 1300
505 Ga0501076_0009190 3300049592 Bacteria 7287
506 Ga0501076_0022672 3300049592 Bacteria 4827
507 Ga0501076_0603355 3300049592 Bacteria 906
508 Ga0501077_0004431 3300049593 Bacteria 8527
509 Ga0501077_0063721 3300049593 Bacteria 2339
510 Ga0501077_0111771 3300049593 Bacteria 1732
511 Ga0501079_0000542 3300049741 Bacteria 24598
512 Ga0501079_0020080 3300049741 Bacteria 5104
513 Ga0501080_0238963 3300049742 Unclassified 1658
514 Ga0501080_1005617 3300049742 Bacteria 723
515 Ga0501081_0015257 3300049743 Bacteria 5067
516 Ga0501081_0030112 3300049743 Bacteria 3672
517 Ga0501035_0391655 3300049822 Bacteria 1157
518 Ga0501045_0003881 3300049824 Bacteria 10283
519 Ga0501045_0068317 3300049824 Bacteria 2610
520 nmdc:mga05p37_195689_c1 3300050507 Bacteria 2451
521 nmdc:mga05p37_262396_c1 3300050507 Bacteria 2067
522 nmdc:mga05p37_283408_c1 3300050507 Unclassified 1975
523 nmdc:mga05p37_324629_c1 3300050507 Bacteria 1821
524 nmdc:mga09592_13915_c1 3300050508 Bacteria 6573
525 nmdc:mga09592_44321_c1 3300050508 Bacteria 3744
526 nmdc:mga0qj67_4853_c1 3300050509 Bacteria 9780
527 nmdc:mga0qj67_899295_c1 3300050509 Bacteria 698
528 nmdc:mga0qj67_97276_c1 3300050509 Bacteria 2370
529 nmdc:mga06r32_157628_c1 3300050510 Bacteria 2252
530 nmdc:mga06r32_6385_c1 3300050510 Bacteria 10593
531 nmdc:mga08y16_18007_c1 3300050511 Bacteria 7441
532 nmdc:mga08y16_197077_c1 3300050511 Bacteria 2087
533 nmdc:mga08y16_492948_c1 3300050511 Unclassified 1246
534 nmdc:mga08y16_66100_c1 3300050511 Bacteria 3774
535 nmdc:mga0n895_1659885_c1 3300050512 Bacteria 602
536 nmdc:mga0n895_384742_c1 3300050512 Unclassified 1419
537 nmdc:mga0a205_777171_c1 3300050515 Unclassified 806
538 Ga0495601_0007839 3300053077 Bacteria 6284
539 Ga0495601_0046086 3300053077 Unclassified 2744
540 Ga0495612_0027843 3300053078 Bacteria 2274
541 Ga0495612_0040458 3300053078 Unclassified 1899
542 Ga0495595_0008205 3300053084 Bacteria 4287
543 Ga0495595_0015949 3300053084 Unclassified 3208
544 Ga0495619_0119476 3300053085 Bacteria 1806
545 Ga0495619_0139717 3300053085 Bacteria 1667
546 Ga0495619_0550539 3300053085 Unclassified 791
547 Ga0501084_0027832 3300054114 Bacteria 4723
548 Ga0501084_0056216 3300054114 Bacteria 3292
549 Ga0501084_0506622 3300054114 Bacteria 1020
550 Ga0501082_0043916 3300060353 Bacteria 3855
551 Ga0501082_0086639 3300060353 Bacteria 2701
552 Ga0466962_0000930 3300061719 Bacteria 13260
553 Ga0466962_0006560 3300061719 Bacteria 5585
554 Ga0530510_0005145 3300061734 Bacteria 9021
555 Ga0530510_0027916 3300061734 Bacteria 4045
556 Ga0451853_2902750
557 JGI24739J22299_10009553
558 JGI24743J22301_10002604
559 JGI24745J21846_1011268
560 JGI24738J21930_10004220
561 JGI25406J46586_10023942
562 Ga0070658_10009957
563 Ga0070658_10012775
564 Ga0070676_10062189
565 Ga0070683_100011807
566 Ga0070683_100039355
567 Ga0070683_100070516
568 Ga0070683_100309423
569 Ga0070683_100633800
570 Ga0070683_100754193
571 Ga0068869_100406909
572 Ga0070680_100007722
573 Ga0070680_100196034
574 Ga0070680_100210469
575 Ga0070682_100005802
576 Ga0070682_100028835
577 Ga0068868_100015810
578 Ga0068868_100018685
579 Ga0068868_100388133
580 Ga0068868_100449595
581 Ga0070660_100003768
582 Ga0070660_100106331
583 Ga0070660_100163619
584 Ga0070689_100045964
585 Ga0070691_10001260
586 Ga0070691_10166618
587 Ga0070687_100109657
588 Ga0070687_100261223
589 Ga0070661_100023428
590 Ga0070661_100089486
591 Ga0070692_10008454
592 Ga0070668_100149837
593 Ga0070668_100185881
594 Ga0070669_100659777
595 Ga0070675_100056165
596 Ga0070675_100062601
597 Ga0070674_100033123
598 Ga0070674_100070013
599 Ga0070673_100016083
600 Ga0070688_100060142
601 Ga0070659_100016025
602 Ga0070659_100150837
603 Ga0070659_100221856
604 Ga0070659_100496272
605 Ga0070709_10136392
606 Ga0070714_100000534
607 Ga0070714_100206801
608 Ga0070713_100295169
609 Ga0070710_10643259
610 Ga0070711_100169280
611 Ga0070711_100324616
612 Ga0070711_101035909
613 Ga0070705_100028253
614 Ga0070700_100295367
615 Ga0070708_100400761
616 Ga0070663_100066145
617 Ga0070663_100509805
618 Ga0070678_100048072
619 Ga0070662_100057127
620 Ga0070662_100060725
621 Ga0070681_10014088
622 Ga0070681_10106575
623 Ga0070681_10353187
624 Ga0070681_10443775
625 Ga0068867_100098330
626 Ga0070685_10000906
627 Ga0070685_10643337
628 Ga0070706_100391421
629 Ga0070707_100000564
630 Ga0070707_100182539
631 Ga0070698_100163405
632 Ga0070698_100269645
633 Ga0070698_100365909
634 Ga0070679_100016904
635 Ga0070684_100003823
636 Ga0070684_100030633
637 Ga0070684_100131786
638 Ga0070684_100224711
639 Ga0070684_101089597
640 Ga0068853_100019416
641 Ga0070672_100009681
642 Ga0070672_100092763
643 Ga0070686_100047567
644 Ga0070686_100153334
645 Ga0070696_100150709
646 Ga0070693_100258657
647 Ga0070704_100031797
648 Ga0068855_100019417
649 Ga0068855_100045021
650 Ga0068855_100108374
651 Ga0068855_100348342
652 Ga0070664_100019090
653 Ga0070664_100139430
654 Ga0070664_100557835
655 Ga0068857_100129121
656 Ga0068854_100009658
657 Ga0068854_100031774
658 Ga0068856_100182478
659 Ga0068856_100197369
660 Ga0068856_100281164
661 Ga0068856_100307142
662 Ga0070702_100029216
663 Ga0068852_100180797
664 Ga0068852_100303344
665 Ga0068859_100070692
666 Ga0068864_100010882
667 Ga0068866_10111581
668 Ga0068861_100021349
669 Ga0068861_100070230
670 Ga0068851_10067900
671 Ga0068870_10137223
672 Ga0068858_100201243
673 Ga0068858_100856962
674 Ga0068862_100478801
675 Ga0081455_10011076
676 Ga0081455_10029480
677 Ga0081455_10132703
678 Ga0081455_10137007
679 Ga0081538_10001049
680 Ga0081538_10002782
681 Ga0081538_10066434
682 Ga0081538_10120513
683 Ga0081539_10000171
684 Ga0081539_10002275
685 Ga0070717_10440295
686 Ga0075432_10080716
687 Ga0070712_100109403
688 Ga0070712_100298518
689 Ga0097621_100075643
690 Ga0097621_100456439
691 Ga0068871_100285138
692 Ga0075428_100065366
693 Ga0075428_100088055
694 Ga0075428_100250869
695 Ga0075430_100004202
696 Ga0075430_100155590
697 Ga0075430_100217403
698 Ga0075431_100009438
699 Ga0075431_100090689
700 Ga0075431_100745030
701 Ga0075429_100014659
702 Ga0075429_100244787
703 Ga0068865_100014242
704 Ga0068865_100021761
705 Ga0097620_100070694
706 Ga0105244_10089755
707 Ga0105240_10023055
708 Ga0111539_10027803
709 Ga0111539_10105413
710 Ga0111539_10360477
711 Ga0111539_10637502
712 Ga0105245_10015399
713 Ga0105245_10030240
714 Ga0105245_10071050
715 Ga0105245_10719780
716 Ga0105245_10875241
717 Ga0105245_11302914
718 Ga0114129_10086527
719 Ga0114129_10207023
720 Ga0114129_10222726
721 Ga0114129_10230261
722 Ga0114129_11584047
723 Ga0105243_10020968
724 Ga0105243_10176472
725 Ga0105243_10235190
726 Ga0105242_10104634
727 Ga0105242_10349689
728 Ga0105242_10655356
729 Ga0105248_10087928
730 Ga0105238_10045194
731 Ga0105249_10160033
732 Ga0105249_10401909
733 Ga0105249_11350425
734 Ga0105239_10009930
735 Ga0105239_10086223
736 Ga0105239_10361890
737 Ga0105239_11385656
738 Ga0105246_10565618
739 Ga0105246_10647911
740 Ga0157338_1010995
741 Ga0157373_10497949
742 Ga0157371_10024786
743 Ga0157371_10392631
744 Ga0157370_10004172
745 Ga0157369_10286377
746 Ga0157378_10125432
747 Ga0163162_10131259
748 Ga0163162_10709188
749 Ga0163162_11399641
750 Ga0157372_10066896
751 Ga0157372_10269601
752 Ga0157375_10060332
753 Ga0157377_10654420
754 Ga0157379_10014155
755 Ga0157376_11182319
756 Ga0163161_10058119
757 Ga0206356_10164098
758 Ga0206353_10804376
759 Ga0207656_10008395
760 Ga0207653_10075709
761 Ga0207710_10045174
762 Ga0207688_10007834
763 Ga0207688_10055373
764 Ga0207688_10093892
765 Ga0207680_10557495
766 Ga0207645_10276291
767 Ga0207643_10033728
768 Ga0207705_10010385
769 Ga0207705_10020084
770 Ga0207705_10055721
771 Ga0207654_10214472
772 Ga0207707_10056785
773 Ga0207707_10060132
774 Ga0207707_10402264
775 Ga0207707_10447500
776 Ga0207695_10061514
777 Ga0207693_10183911
778 Ga0207663_10339764
779 Ga0207660_10013696
780 Ga0207660_10065235
781 Ga0207662_10103282
782 Ga0207657_10002820
783 Ga0207657_10013681
784 Ga0207657_10033147
785 Ga0207657_10053457
786 Ga0207657_10086426
787 Ga0207649_10068319
788 Ga0207652_10007201
789 Ga0207652_10070488
790 Ga0207646_10001221
791 Ga0207646_10133026
792 Ga0207694_10228689
793 Ga0207659_10141128
794 Ga0207659_10284818
795 Ga0207687_10015563
796 Ga0207687_10103199
797 Ga0207687_10137947
798 Ga0207700_10205186
799 Ga0207664_10008194
800 Ga0207664_10075187
801 Ga0207664_10453976
802 Ga0207664_10581684
803 Ga0207690_10169773
804 Ga0207690_10495514
805 Ga0207706_10038313
806 Ga0207709_10012716
807 Ga0207670_10089686
808 Ga0207669_10017721
809 Ga0207704_10021890
810 Ga0207665_10409246
811 Ga0207691_10044492
812 Ga0207711_10054608
813 Ga0207711_10137590
814 Ga0207689_10039458
815 Ga0207661_10021240
816 Ga0207661_10027499
817 Ga0207661_10227487
818 Ga0207667_10019259
819 Ga0207667_10036844
820 Ga0207667_10107248
821 Ga0207667_10381405
822 Ga0207651_10009397
823 Ga0207712_11224694
824 Ga0207640_10016163
825 Ga0207640_10016720
826 Ga0207658_10165815
827 Ga0207677_10072671
828 Ga0207677_10543632
829 Ga0207639_10168971
830 Ga0207678_10021354
831 Ga0207708_10119195
832 Ga0207708_10251895
833 Ga0207708_10280783
834 Ga0207702_10154033
835 Ga0207702_10306969
836 Ga0207702_10559335
837 Ga0207641_10066803
838 Ga0207648_10042238
839 Ga0207674_10024468
840 Ga0207674_10168750
841 Ga0207675_100797673
842 Ga0207683_10066608
843 Ga0207698_10030013
844 Ga0207698_10239988
845 Ga0207428_10010536
846 Ga0207428_10022706
847 Ga0207428_10128674
848 Ga0307409_100416757
849 Ga0307416_101212142
850 Ga0307415_100091250
851 Ga0307415_100103255
852 Ga0373928_0007892
853 Ga0373940_0070864
854 Ga0373953_0030942
855 Ga0373954_0023214
856 Ga0373956_0030302
857 Ga0373955_0004204
858 Ga0373961_0018028
859 Ga0373924_0243078
860 Ga0373933_0013361
861 Ga0373937_0005203
862 Ga0373937_0112371
863 Ga0395899_0004765
864 Ga0395899_0025797
865 Ga0395899_0209689
866 Ga0395900_0002716
867 Ga0395900_0088113
868 Ga0395900_0201041
869 Ga0395900_0233976
870 Ga0395900_0279414
871 Ga0395900_0508657
872 Ga0395898_0001463
873 Ga0395898_0594102
874 Ga0395898_1001882
875 Ga0395905_0000561
876 Ga0395905_0058389
877 Ga0395905_0111667
878 Ga0395905_0188172
879 Ga0395905_0269162
880 Ga0395905_0322718
881 Ga0395905_0330874
882 Ga0395901_0004765
883 Ga0395901_0034169
884 Ga0395901_0087740
885 Ga0395901_0140930
886 Ga0395901_0163976
887 Ga0395901_0716381
888 Ga0242420_055525
889 Ga0451807_1659434
890 Ga0451835_0303934
891 Ga0451843_1444616
892 Ga0439455_0081366
893 Ga0439456_016093
894 Ga0439463_057515
895 Ga0450920_009428
896 Ga0450907_009803
897 Ga0439460_0053281
898 Ga0466969_0071765
899 Ga0466965_0046352
900 Ga0466961_0030475
901 Ga0466961_0065511
902 Ga0466961_0139632
903 Ga0466963_0017760
904 Ga0466963_0019392
905 Ga0466963_0025776
906 Ga0466963_0030236
907 Ga0466963_0068767
908 Ga0466963_0078221
909 Ga0466964_0009780
910 Ga0466964_0011185
911 Ga0466964_0174466
912 Ga0466971_0015737
913 Ga0466968_0038226
914 Ga0466968_0038662
915 Ga0466970_0179604
916 Ga0466970_0367031
917 Ga0466957_0000400
918 Ga0466957_0013055
919 Ga0466957_0063471
920 Ga0466960_0671648
921 Ga0466959_0051468
922 Ga0466959_0058425
923 Ga0466959_0140246
924 Ga0451576_0104924
925 Ga0466958_0077333
926 Ga0466958_0231643
927 Ga0466967_0016442
928 Ga0466967_0024523
929 Ga0466967_0032891
930 Ga0466967_0168645
931 Ga0466967_0168981
932 Ga0466967_0208201
933 Ga0466967_0366727
934 Ga0466967_0367349
935 Ga0466967_0475584
936 Ga0466967_0899530
937 Ga0495592_0091924
938 Ga0495592_0201707
939 Ga0495651_0025658
940 Ga0495651_0077992
941 Ga0495651_0675510
942 Ga0495653_0012989
943 Ga0495653_0102481
944 Ga0495653_0214022
945 Ga0495653_0373441
946 Ga0495653_0502174
947 Ga0495584_0062557
948 Ga0495585_0185354
949 Ga0495608_0005504
950 Ga0495608_0015667
951 Ga0495608_0102576
952 Ga0495628_0091035
953 Ga0495630_0031879
954 Ga0495630_0119203
955 Ga0495652_0081258
956 Ga0495640_0127095
957 Ga0495640_0247919
958 Ga0495587_0013622
959 Ga0495587_0209433
960 Ga0495645_0112154
961 Ga0495645_0390052
962 Ga0495667_0025320
963 Ga0495667_0067653
964 Ga0495635_0009794
965 Ga0495635_0037422
966 Ga0495657_0011476
967 Ga0495657_0022128
968 Ga0495599_0013250
969 Ga0495599_0093620
970 Ga0495599_0237500
971 Ga0495623_0005560
972 Ga0495646_0034601
973 Ga0495646_0208013
974 Ga0495613_0036581
975 Ga0495624_0258397
976 Ga0495600_0012898
977 Ga0495600_0286603
978 Ga0495604_0003081
979 Ga0495674_0053283
980 Ga0495674_0068225
981 Ga0495680_0007607
982 Ga0495680_0211468
983 Ga0495675_0055085
984 Ga0495675_0204951
985 Ga0495684_0035209
986 Ga0495684_0254181
987 Ga0495602_0068981
988 Ga0495602_0085312
989 Ga0496100_0171235
990 Ga0496100_0599395
991 Ga0496101_0052998
992 Ga0496101_0145771
993 Ga0496101_0233083
994 Ga0496102_0329209
995 Ga0496103_0150970
996 Ga0496104_0320909
997 Ga0496104_1251145
998 Ga0496105_0304174
999 Ga0496106_0014802
1000 Ga0496106_0239221
1001 Ga0496106_0606837
1002 Ga0496107_0022049
1003 Ga0496108_0669129
1004 Ga0496109_0079319
1005 Ga0496109_0108427
1006 Ga0496109_0266446
1007 Ga0496109_0386274
1008 Ga0496109_0627385
1009 Ga0496110_0236632
1010 Ga0496111_0731958
1011 Ga0496111_0733454
1012 Ga0496112_0017312
1013 Ga0496112_0106335
1014 Ga0496113_0485914
1015 Ga0496113_0587320
1016 Ga0496114_0203376
1017 Ga0496114_0243283
1018 Ga0496114_0261810
1019 Ga0496114_0599777
1020 Ga0496114_0763647
1021 Ga0496115_0033994
1022 Ga0496115_0060278
1023 Ga0496115_0490140
1024 Ga0501031_0131606
1025 Ga0501033_0036566
1026 Ga0501033_0078980
1027 Ga0501036_0078109
1028 Ga0501036_0229935
1029 Ga0501038_0059585
1030 Ga0501038_0423454
1031 Ga0501039_0049196
1032 Ga0501039_0061164
1033 Ga0501039_0503184
1034 Ga0501040_0002792
1035 Ga0501040_0013812
1036 Ga0501040_0207220
1037 Ga0501041_0003126
1038 Ga0501041_0272442
1039 Ga0501041_0450166
1040 Ga0501042_0035218
1041 Ga0501042_0049583
1042 Ga0501043_0081489
1043 Ga0501046_0023832
1044 Ga0501046_0647535
1045 Ga0501048_0018043
1046 Ga0501048_0094689
1047 Ga0501067_0287195
1048 Ga0501068_0236466
1049 Ga0501069_0072974
1050 Ga0501070_0152982
1051 Ga0501071_0018260
1052 Ga0501071_0087653
1053 Ga0501071_0807780
1054 Ga0501072_0043467
1055 Ga0501072_0131280
1056 Ga0501072_0405890
1057 Ga0501074_0034413
1058 Ga0501075_0032656
1059 Ga0501075_0268668
1060 Ga0501076_0009190
1061 Ga0501076_0022672
1062 Ga0501076_0603355
1063 Ga0501077_0004431
1064 Ga0501077_0063721
1065 Ga0501077_0111771
1066 Ga0501079_0000542
1067 Ga0501079_0020080
1068 Ga0501080_0238963
1069 Ga0501080_1005617
1070 Ga0501081_0015257
1071 Ga0501081_0030112
1072 Ga0501035_0391655
1073 Ga0501045_0003881
1074 Ga0501045_0068317
1075 nmdc:mga05p37_195689_c1
1076 nmdc:mga05p37_262396_c1
1077 nmdc:mga05p37_283408_c1
1078 nmdc:mga05p37_324629_c1
1079 nmdc:mga09592_13915_c1
1080 nmdc:mga09592_44321_c1
1081 nmdc:mga0qj67_4853_c1
1082 nmdc:mga0qj67_899295_c1
1083 nmdc:mga0qj67_97276_c1
1084 nmdc:mga06r32_157628_c1
1085 nmdc:mga06r32_6385_c1
1086 nmdc:mga08y16_18007_c1
1087 nmdc:mga08y16_197077_c1
1088 nmdc:mga08y16_492948_c1
1089 nmdc:mga08y16_66100_c1
1090 nmdc:mga0n895_1659885_c1
1091 nmdc:mga0n895_384742_c1
1092 nmdc:mga0a205_777171_c1
1093 Ga0495601_0007839
1094 Ga0495601_0046086
1095 Ga0495612_0027843
1096 Ga0495612_0040458
1097 Ga0495595_0008205
1098 Ga0495595_0015949
1099 Ga0495619_0119476
1100 Ga0495619_0139717
1101 Ga0495619_0550539
1102 Ga0501084_0027832
1103 Ga0501084_0056216
1104 Ga0501084_0506622
1105 Ga0501082_0043916
1106 Ga0501082_0086639
1107 Ga0466962_0000930
1108 Ga0466962_0006560
1109 Ga0530510_0005145
1110 Ga0530510_0027916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

152

201

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

56

125

0.9

Map