F463108

General Info

Members Datasets Scaffolds Average Seq Length
555 294 533 167

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10062564|Ga0163161_100625644
Length 186
Sequence VTPASDGAHAPGIRVLLMSDTHLPLRARDLPAALWAEVDRADVVVHAGDWVDLATLDRLQARSRSLLACWGNNDGPALRTRLPEVARATLGGVRIAVVHETGSKERREERMRAAYPDTDLLIFGHSHIPWDTTYSGLRLLNPGSPTDRRRQPYCTWMTCRLAEGAVHDVVVHRLPRPQAGASANRR

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
3 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
4 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
9 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
10 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
11 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
12 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
13 2858868258 Micromonospora sp. MH33 Isolate Unclassified
14 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
15 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
16 2920879853 Kocuria salina CV6 Isolate Unclassified
17 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
18 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
278 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
291 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
292 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
293 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
294 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 1.08
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.58
Nodule 0
Rhizoplane 9.73
Rhizosphere 61.98
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002611 3300001991 Bacteria 2747
2 JGI25153J46596_10051829 3300003215 Bacteria 1172
3 Ga0055525_1007857 3300003759 Bacteria 902
4 Ga0055540_1000127 3300003792 Bacteria 77764
5 Ga0070658_10316090 3300005327 Bacteria 1333
6 Ga0070676_10162077 3300005328 Bacteria 1440
7 Ga0070683_100889455 3300005329 Bacteria 854
8 Ga0068869_100006363 3300005334 Bacteria 7484
9 Ga0070666_10061187 3300005335 Bacteria 2549
10 Ga0070680_100005883 3300005336 Bacteria 9312
11 Ga0070680_100852244 3300005336 Bacteria 786
12 Ga0070682_100093334 3300005337 Bacteria 1973
13 Ga0068868_100087892 3300005338 Bacteria 2500
14 Ga0070660_100349021 3300005339 Bacteria 1218
15 Ga0070692_10107159 3300005345 Bacteria 1540
16 Ga0070668_100073296 3300005347 Bacteria 2669
17 Ga0070669_100002791 3300005353 Bacteria 12605
18 Ga0070674_100814145 3300005356 Bacteria 807
19 Ga0070659_100030591 3300005366 Bacteria 4167
20 Ga0070659_100323441 3300005366 Bacteria 1289
21 Ga0070667_100000364 3300005367 Bacteria 49361
22 Ga0070667_100001901 3300005367 Bacteria 18532
23 Ga0070667_101845076 3300005367 Bacteria 569
24 Ga0070709_10193937 3300005434 Bacteria 1435
25 Ga0070714_100399979 3300005435 Bacteria 1298
26 Ga0070714_100406296 3300005435 Bacteria 1288
27 Ga0070663_100018581 3300005455 Bacteria 4562
28 Ga0070663_100893777 3300005455 Bacteria 767
29 Ga0070678_100877200 3300005456 Bacteria 819
30 Ga0070681_10009384 3300005458 Bacteria 9629
31 Ga0070681_10513529 3300005458 Bacteria 1111
32 Ga0070685_10045651 3300005466 Bacteria 2513
33 Ga0070679_100013375 3300005530 Bacteria 7858
34 Ga0070679_100079601 3300005530 Bacteria 3266
35 Ga0070679_100950450 3300005530 Bacteria 803
36 Ga0070679_101217368 3300005530 Bacteria 698
37 Ga0068853_100153234 3300005539 Bacteria 2075
38 Ga0070695_100370220 3300005545 Bacteria 1078
39 Ga0070665_100020835 3300005548 Bacteria 6589
40 Ga0070665_100045322 3300005548 Bacteria 4416
41 Ga0070665_101795769 3300005548 Bacteria 620
42 Ga0068855_100585358 3300005563 Bacteria 1205
43 Ga0068855_101185049 3300005563 Bacteria 795
44 Ga0068857_100815334 3300005577 Bacteria 892
45 Ga0068854_100116238 3300005578 Bacteria 2024
46 Ga0068856_100186009 3300005614 Bacteria 2091
47 Ga0070702_100125596 3300005615 Bacteria 1612
48 Ga0070702_100777737 3300005615 Bacteria 738
49 Ga0068852_100597323 3300005616 Bacteria 1108
50 Ga0068864_100096874 3300005618 Bacteria 2611
51 Ga0068864_100480925 3300005618 Bacteria 1192
52 Ga0068861_100049108 3300005719 Bacteria 3193
53 Ga0068870_10793135 3300005840 Bacteria 661
54 Ga0068863_100209411 3300005841 Bacteria 1877
55 Ga0068863_100340882 3300005841 Bacteria 1458
56 Ga0068858_100098954 3300005842 Bacteria 2719
57 Ga0068860_100000480 3300005843 Bacteria 49553
58 Ga0068860_100497693 3300005843 Bacteria 1216
59 Ga0068862_100000771 3300005844 Bacteria 31887
60 Ga0068862_101344841 3300005844 Bacteria 716
61 Ga0070717_11401025 3300006028 Bacteria 635
62 Ga0075365_10003210 3300006038 Bacteria 8360
63 Ga0075365_10007484 3300006038 Bacteria 6120
64 Ga0075365_10035551 3300006038 Bacteria 3224
65 Ga0075365_10076528 3300006038 Bacteria 2259
66 Ga0075365_10153288 3300006038 Bacteria 1604
67 Ga0075365_10494211 3300006038 Bacteria 865
68 Ga0075365_10599231 3300006038 Bacteria 779
69 Ga0075363_100001643 3300006048 Bacteria 8632
70 Ga0075363_100013323 3300006048 Bacteria 3981
71 Ga0075363_100061513 3300006048 Bacteria 2024
72 Ga0075363_100423611 3300006048 Bacteria 784
73 Ga0075364_10007628 3300006051 Bacteria 6433
74 Ga0075364_10016390 3300006051 Bacteria 4610
75 Ga0075364_10024996 3300006051 Bacteria 3799
76 Ga0075364_10037445 3300006051 Bacteria 3141
77 Ga0075364_10037843 3300006051 Bacteria 3126
78 Ga0075364_10098415 3300006051 Bacteria 1946
79 Ga0075364_10608004 3300006051 Bacteria 747
80 Ga0075364_10797677 3300006051 Bacteria 644
81 Ga0070712_100680841 3300006175 Bacteria 876
82 Ga0070712_101352653 3300006175 Bacteria 621
83 Ga0075362_10112222 3300006177 Bacteria 1284
84 Ga0075362_10356164 3300006177 Bacteria 733
85 Ga0075367_10033485 3300006178 Bacteria 2962
86 Ga0075367_10772034 3300006178 Bacteria 612
87 Ga0075369_10049508 3300006186 Bacteria 1815
88 Ga0075369_10060673 3300006186 Bacteria 1650
89 Ga0075369_10105696 3300006186 Bacteria 1266
90 Ga0075369_10126551 3300006186 Bacteria 1159
91 Ga0075369_10140222 3300006186 Bacteria 1102
92 Ga0075369_10157113 3300006186 Bacteria 1041
93 Ga0075369_10318935 3300006186 Bacteria 727
94 Ga0075366_10064863 3300006195 Bacteria 2172
95 Ga0097621_100733153 3300006237 Bacteria 912
96 Ga0075370_10049821 3300006353 Bacteria 2375
97 Ga0075370_10069470 3300006353 Bacteria 2013
98 Ga0075370_10081269 3300006353 Bacteria 1863
99 Ga0105250_10083487 3300009092 Bacteria 1296
100 Ga0111539_12084851 3300009094 Bacteria 658
101 Ga0105245_10395164 3300009098 Bacteria 1380
102 Ga0105247_10000089 3300009101 Bacteria 98925
103 Ga0105247_10085510 3300009101 Bacteria 1994
104 Ga0105243_10098025 3300009148 Bacteria 2427
105 Ga0105243_10317308 3300009148 Bacteria 1419
106 Ga0105243_10736064 3300009148 Bacteria 965
107 Ga0105242_10104281 3300009176 Bacteria 2407
108 Ga0105242_11446592 3300009176 Bacteria 716
109 Ga0105248_10057821 3300009177 Bacteria 4354
110 Ga0105248_11625480 3300009177 Bacteria 732
111 Ga0105237_10017251 3300009545 Bacteria 7487
112 Ga0105249_10000282 3300009553 Bacteria 53256
113 Ga0105249_10116411 3300009553 Bacteria 2534
114 Ga0105249_10817287 3300009553 Bacteria 996
115 Ga0105239_10008621 3300010375 Bacteria 11558
116 Ga0105246_10014095 3300011119 Bacteria 5022
117 Ga0157369_10009016 3300013105 Bacteria 11426
118 Ga0157369_10096694 3300013105 Bacteria 3150
119 Ga0157369_10159256 3300013105 Bacteria 2383
120 Ga0157369_10222558 3300013105 Bacteria 1975
121 Ga0157369_11146324 3300013105 Bacteria 794
122 Ga0157374_10005379 3300013296 Bacteria 10755
123 Ga0163162_10125840 3300013306 Bacteria 2669
124 Ga0163162_10354389 3300013306 Bacteria 1600
125 Ga0163162_10559037 3300013306 Bacteria 1272
126 Ga0157372_10776666 3300013307 Bacteria 1114
127 Ga0157375_10434818 3300013308 Bacteria 1478
128 Ga0163163_10044222 3300014325 Bacteria 4368
129 Ga0157380_10027628 3300014326 Bacteria 4316
130 Ga0157377_10664298 3300014745 Bacteria 752
131 Ga0157377_11262865 3300014745 Bacteria 575
132 Ga0157379_10030442 3300014968 Bacteria 4805
133 Ga0157379_10146249 3300014968 Bacteria 2131
134 Ga0163161_10062564 3300017792 Bacteria 2711
135 Ga0206356_11520211 3300020070 Bacteria 1034
136 Ga0206354_10793280 3300020081 Bacteria 3491
137 Ga0206353_10617536 3300020082 Bacteria 8478
138 Ga0206353_11385569 3300020082 Bacteria 1730
139 Ga0206353_11715273 3300020082 Bacteria 2936
140 Ga0213876_10004195 3300021384 Bacteria 8082
141 Ga0213876_10007576 3300021384 Bacteria 5895
142 Ga0213875_10058963 3300021388 Bacteria 1797
143 Ga0213875_10084961 3300021388 Bacteria 1477
144 Ga0224712_10148268 3300022467 Bacteria 1038
145 Ga0209563_100201 3300025230 Bacteria 32234
146 Ga0209677_101445 3300025253 Bacteria 10272
147 Ga0209758_1014772 3300025297 Bacteria 4118
148 Ga0209051_1000014 3300025303 Bacteria 552732
149 Ga0209051_1000292 3300025303 Bacteria 80255
150 Ga0209051_1001885 3300025303 Bacteria 16400
151 Ga0209051_1026717 3300025303 Bacteria 2319
152 Ga0207710_10000117 3300025900 Bacteria 98934
153 Ga0207688_10007861 3300025901 Bacteria 5803
154 Ga0207680_10011645 3300025903 Bacteria 4452
155 Ga0207647_10145372 3300025904 Bacteria 1388
156 Ga0207699_10149320 3300025906 Bacteria 1544
157 Ga0207643_10267317 3300025908 Bacteria 1057
158 Ga0207705_10005019 3300025909 Bacteria 9925
159 Ga0207705_10029804 3300025909 Bacteria 3890
160 Ga0207707_10003813 3300025912 Bacteria 13358
161 Ga0207707_10130057 3300025912 Bacteria 2202
162 Ga0207693_10406353 3300025915 Bacteria 1064
163 Ga0207660_10000404 3300025917 Bacteria 28485
164 Ga0207660_10085697 3300025917 Bacteria 2324
165 Ga0207652_10003286 3300025921 Bacteria 13389
166 Ga0207652_10030107 3300025921 Bacteria 4543
167 Ga0207652_10384423 3300025921 Bacteria 1267
168 Ga0207652_10440310 3300025921 Bacteria 1175
169 Ga0207681_10001770 3300025923 Bacteria 13872
170 Ga0207687_10259600 3300025927 Bacteria 1385
171 Ga0207687_10381978 3300025927 Bacteria 1154
172 Ga0207700_10184199 3300025928 Bacteria 1750
173 Ga0207664_10274824 3300025929 Bacteria 1477
174 Ga0207664_10601362 3300025929 Bacteria 988
175 Ga0207686_10666852 3300025934 Bacteria 824
176 Ga0207709_10993245 3300025935 Bacteria 686
177 Ga0207669_10896503 3300025937 Bacteria 740
178 Ga0207711_10036412 3300025941 Bacteria 4176
179 Ga0207711_10129481 3300025941 Bacteria 2261
180 Ga0207689_10004281 3300025942 Bacteria 12989
181 Ga0207661_10296271 3300025944 Bacteria 1449
182 Ga0207661_10729050 3300025944 Bacteria 912
183 Ga0207679_10161025 3300025945 Bacteria 1837
184 Ga0207667_11022116 3300025949 Bacteria 813
185 Ga0207667_11381883 3300025949 Bacteria 678
186 Ga0207712_10000243 3300025961 Bacteria 53408
187 Ga0207668_10376066 3300025972 Bacteria 1194
188 Ga0207640_10395892 3300025981 Bacteria 1123
189 Ga0207658_10000680 3300025986 Bacteria 29606
190 Ga0207658_10005620 3300025986 Bacteria 8578
191 Ga0207677_10168382 3300026023 Bacteria 1710
192 Ga0207703_10166073 3300026035 Bacteria 1937
193 Ga0207639_10558926 3300026041 Bacteria 1051
194 Ga0207678_10017782 3300026067 Bacteria 6242
195 Ga0207708_10051750 3300026075 Bacteria 3127
196 Ga0207648_10100389 3300026089 Bacteria 2535
197 Ga0207676_10439393 3300026095 Bacteria 1228
198 Ga0207675_100022653 3300026118 Bacteria 5846
199 Ga0207683_11190219 3300026121 Bacteria 706
200 Ga0268266_10005906 3300028379 Bacteria 11324
201 Ga0268266_10020222 3300028379 Bacteria 5676
202 Ga0268266_10446266 3300028379 Bacteria 1229
203 Ga0268265_10000738 3300028380 Bacteria 31894
204 Ga0268265_11096142 3300028380 Bacteria 790
205 Ga0268264_10000503 3300028381 Bacteria 50726
206 Ga0268264_10484671 3300028381 Bacteria 1203
207 Ga0268264_12225096 3300028381 Bacteria 556
208 Ga0265327_10001010 3300031251 Bacteria 39881
209 Ga0307408_100049858 3300031548 Bacteria 3008
210 Ga0307408_100275538 3300031548 Bacteria 1399
211 Ga0307405_10076998 3300031731 Bacteria 2166
212 Ga0307413_10033079 3300031824 Bacteria 2939
213 Ga0307413_10628750 3300031824 Bacteria 882
214 Ga0307410_10002907 3300031852 Bacteria 8436
215 Ga0307410_10049129 3300031852 Bacteria 2830
216 Ga0307406_10233622 3300031901 Bacteria 1375
217 Ga0307407_10201849 3300031903 Bacteria 1333
218 Ga0307407_10394023 3300031903 Bacteria 992
219 Ga0307412_10091909 3300031911 Bacteria 2125
220 Ga0307412_10456829 3300031911 Bacteria 1054
221 Ga0307409_100012864 3300031995 Bacteria 5354
222 Ga0307409_100117576 3300031995 Bacteria 2244
223 Ga0307409_100158977 3300031995 Bacteria 1973
224 Ga0307409_101217170 3300031995 Bacteria 777
225 Ga0307409_101645118 3300031995 Bacteria 670
226 Ga0307409_101945960 3300031995 Bacteria 617
227 Ga0307416_100014453 3300032002 Bacteria 5414
228 Ga0307416_100134888 3300032002 Bacteria 2231
229 Ga0307416_100199112 3300032002 Bacteria 1898
230 Ga0307416_100230662 3300032002 Bacteria 1784
231 Ga0307416_100876953 3300032002 Bacteria 996
232 Ga0307416_100981043 3300032002 Bacteria 947
233 Ga0307414_10049869 3300032004 Bacteria 2897
234 Ga0307414_10309540 3300032004 Bacteria 1340
235 Ga0307414_11302327 3300032004 Bacteria 674
236 Ga0307411_10084568 3300032005 Bacteria 2195
237 Ga0307415_100010253 3300032126 Bacteria 5298
238 Ga0307415_100077749 3300032126 Bacteria 2357
239 Ga0307507_10557385 3300033179 Bacteria 602
240 Ga0307510_10044663 3300033180 Bacteria 4795
241 Ga0395898_0057861 3300037466 Bacteria 3776
242 Ga0436364_0207134 3300037853 Bacteria 4157
243 Ga0436364_1471767 3300037853 Bacteria 2328
244 Ga0395901_0071040 3300038443 Bacteria 3627
245 Ga0395901_0090767 3300038443 Bacteria 3198
246 Ga0395901_0205985 3300038443 Bacteria 2060
247 Ga0395901_0352865 3300038443 Bacteria 1518
248 Ga0436365_0217155 3300039437 Bacteria 41866
249 Ga0436365_0869447 3300039437 Bacteria 29465
250 Ga0436363_0784449 3300039450 Bacteria 4282
251 Ga0436363_1192164 3300039450 Bacteria 724
252 Ga0439465_0278332 3300041413 Bacteria 623
253 Ga0451791_0678676 3300041451 Bacteria 731
254 Ga0451793_0372464 3300041452 Bacteria 772
255 Ga0451793_0893773 3300041452 Bacteria 1069
256 Ga0451806_007012 3300041462 Bacteria 1221
257 Ga0451806_524758 3300041462 Bacteria 1190
258 Ga0451833_0866363 3300041491 Bacteria 891
259 Ga0451843_0046335 3300041509 Bacteria 1318
260 Ga0451843_0676841 3300041509 Bacteria 805
261 Ga0451853_3155658 3300041512 Bacteria 6493
262 Ga0439448_0018951 3300042005 Bacteria 2114
263 Ga0466969_0162751 3300044656 Bacteria 1025
264 Ga0466972_0013086 3300044658 Bacteria 4167
265 Ga0466972_0028744 3300044658 Bacteria 2740
266 Ga0466972_0114574 3300044658 Bacteria 1273
267 Ga0466965_0001959 3300044683 Bacteria 8611
268 Ga0466965_0033832 3300044683 Bacteria 2499
269 Ga0466965_0055085 3300044683 Bacteria 1978
270 Ga0466965_0065906 3300044683 Bacteria 1815
271 Ga0466965_0134422 3300044683 Bacteria 1284
272 Ga0466966_0009879 3300044684 Bacteria 6325
273 Ga0466966_0054544 3300044684 Bacteria 2533
274 Ga0466961_0003461 3300044693 Bacteria 9838
275 Ga0466961_0064892 3300044693 Bacteria 2320
276 Ga0466961_0168132 3300044693 Bacteria 1364
277 Ga0466961_0867527 3300044693 Bacteria 538
278 Ga0466963_0350852 3300044694 Bacteria 1039
279 Ga0466971_0004869 3300044719 Bacteria 5808
280 Ga0466971_0026389 3300044719 Bacteria 2596
281 Ga0466971_0073803 3300044719 Bacteria 1550
282 Ga0466968_0018298 3300044735 Bacteria 2810
283 Ga0466968_0136434 3300044735 Bacteria 1119
284 Ga0466970_0010714 3300044765 Bacteria 4660
285 Ga0466970_0031797 3300044765 Bacteria 2787
286 Ga0466970_0047698 3300044765 Bacteria 2283
287 Ga0466970_0048224 3300044765 Bacteria 2271
288 Ga0466970_0182746 3300044765 Bacteria 1164
289 Ga0466970_0406536 3300044765 Bacteria 777
290 Ga0466957_0002759 3300044842 Bacteria 9504
291 Ga0466957_0015721 3300044842 Bacteria 4421
292 Ga0466957_0022614 3300044842 Bacteria 3711
293 Ga0466957_0054291 3300044842 Bacteria 2445
294 Ga0466960_0008545 3300044901 Bacteria 4195
295 Ga0466960_0011781 3300044901 Bacteria 3672
296 Ga0466960_0129705 3300044901 Bacteria 1329
297 Ga0466960_0194625 3300044901 Bacteria 1105
298 Ga0466959_0003428 3300045049 Bacteria 10370
299 Ga0466959_0302337 3300045049 Bacteria 1095
300 Ga0466959_0353027 3300045049 Bacteria 1002
301 Ga0466958_0000426 3300045836 Bacteria 17386
302 Ga0466958_0032539 3300045836 Bacteria 3103
303 Ga0466958_0058732 3300045836 Bacteria 2339
304 Ga0466958_0145612 3300045836 Bacteria 1493
305 Ga0466958_0364804 3300045836 Bacteria 931
306 Ga0466967_0013591 3300045976 Bacteria 6299
307 Ga0466967_0034872 3300045976 Bacteria 4276
308 Ga0466967_0065039 3300045976 Bacteria 3245
309 Ga0466967_0101111 3300045976 Bacteria 2634
310 Ga0466967_0109739 3300045976 Bacteria 2533
311 Ga0466967_0240765 3300045976 Bacteria 1726
312 Ga0466967_0379037 3300045976 Bacteria 1373
313 Ga0466967_0728291 3300045976 Bacteria 983
314 Ga0466967_0757366 3300045976 Bacteria 963
315 Ga0466967_2125925 3300045976 Bacteria 558
316 Ga0495617_065732 3300046452 Bacteria 1195
317 Ga0495603_0024982 3300046455 Bacteria 3613
318 Ga0495629_0126247 3300046459 Bacteria 1782
319 Ga0495638_0023724 3300046460 Bacteria 4007
320 Ga0495605_0005089 3300046474 Bacteria 7668
321 Ga0495662_0172370 3300046476 Bacteria 1066
322 Ga0495584_0110497 3300046491 Bacteria 1391
323 Ga0495585_0082322 3300046492 Bacteria 1742
324 Ga0495594_0040929 3300046499 Bacteria 2537
325 Ga0495594_0182883 3300046499 Bacteria 1193
326 Ga0495606_0044622 3300046507 Bacteria 2946
327 Ga0495616_0018316 3300046513 Bacteria 3846
328 Ga0495620_0006239 3300046515 Bacteria 6565
329 Ga0495631_0006066 3300046518 Bacteria 6277
330 Ga0495648_0105307 3300046524 Bacteria 1547
331 Ga0495654_0113939 3300046530 Bacteria 1231
332 Ga0495609_0068006 3300046538 Bacteria 1568
333 Ga0495597_0098151 3300046542 Bacteria 1237
334 Ga0495622_0024221 3300046557 Bacteria 2834
335 Ga0495633_0105190 3300046558 Bacteria 1309
336 Ga0495668_0005978 3300046616 Bacteria 8084
337 Ga0495634_0042728 3300046642 Bacteria 3074
338 Ga0495611_0217813 3300046648 Bacteria 888
339 Ga0495611_0334735 3300046648 Bacteria 696
340 Ga0495625_0049196 3300046660 Bacteria 3031
341 Ga0495613_0168537 3300046689 Bacteria 1555
342 Ga0495671_0257936 3300046692 Bacteria 841
343 Ga0495649_0206956 3300046694 Bacteria 1017
344 Ga0495589_0018777 3300046794 Bacteria 3544
345 Ga0495589_0079957 3300046794 Bacteria 1590
346 Ga0495672_0127815 3300047320 Bacteria 1341
347 Ga0495676_0002513 3300047321 Bacteria 16325
348 Ga0495680_0269024 3300047322 Bacteria 1204
349 Ga0495683_0044051 3300047323 Bacteria 2244
350 Ga0495687_072412 3300047443 Bacteria 1377
351 Ga0495687_115433 3300047443 Bacteria 978
352 Ga0495685_007529 3300047447 Bacteria 3597
353 Ga0495686_0129850 3300047472 Bacteria 1495
354 Ga0496100_0000043 3300048903 Bacteria 89692
355 Ga0496100_0032952 3300048903 Bacteria 3237
356 Ga0496101_0000374 3300048904 Bacteria 29694
357 Ga0496101_0146367 3300048904 Bacteria 1804
358 Ga0496101_0686727 3300048904 Bacteria 808
359 Ga0496101_0725386 3300048904 Bacteria 785
360 Ga0496102_0000399 3300048905 Bacteria 50723
361 Ga0496102_0058916 3300048905 Bacteria 3510
362 Ga0496102_0061645 3300048905 Bacteria 3433
363 Ga0496102_0088114 3300048905 Bacteria 2869
364 Ga0496102_0247308 3300048905 Bacteria 1681
365 Ga0496103_0000810 3300048906 Bacteria 22943
366 Ga0496103_0000860 3300048906 Bacteria 22092
367 Ga0496103_0276427 3300048906 Bacteria 1080
368 Ga0496103_0552345 3300048906 Bacteria 735
369 Ga0496104_0236020 3300048907 Bacteria 1741
370 Ga0496106_0014461 3300048909 Bacteria 5831
371 Ga0496106_0080351 3300048909 Bacteria 2504
372 Ga0496106_0155709 3300048909 Bacteria 1804
373 Ga0496107_0002846 3300048910 Bacteria 11435
374 Ga0496107_0017384 3300048910 Bacteria 5059
375 Ga0496107_0113054 3300048910 Bacteria 1997
376 Ga0496107_1061785 3300048910 Bacteria 586
377 Ga0496108_0003142 3300048911 Bacteria 13282
378 Ga0496108_0029447 3300048911 Bacteria 4547
379 Ga0496108_0063889 3300048911 Bacteria 3100
380 Ga0496108_0122967 3300048911 Bacteria 2227
381 Ga0496108_0132426 3300048911 Bacteria 2143
382 Ga0496109_0000616 3300048912 Bacteria 29646
383 Ga0496109_0025185 3300048912 Bacteria 5299
384 Ga0496109_0103544 3300048912 Bacteria 2642
385 Ga0496110_0003741 3300048913 Bacteria 11718
386 Ga0496110_0024693 3300048913 Bacteria 5126
387 Ga0496110_0092155 3300048913 Bacteria 2711
388 Ga0496110_0554651 3300048913 Bacteria 1044
389 Ga0496110_0859347 3300048913 Bacteria 813
390 Ga0496111_0040070 3300048914 Bacteria 3360
391 Ga0496112_0031365 3300048915 Bacteria 5154
392 Ga0496112_0412071 3300048915 Bacteria 1290
393 Ga0496112_0962588 3300048915 Bacteria 774
394 Ga0496113_0041891 3300048916 Bacteria 3381
395 Ga0496113_0439319 3300048916 Bacteria 1048
396 Ga0496113_0753246 3300048916 Bacteria 775
397 Ga0496114_0000465 3300048917 Bacteria 29699
398 Ga0496114_0408910 3300048917 Bacteria 1202
399 Ga0496114_0442862 3300048917 Bacteria 1150
400 Ga0496114_1064591 3300048917 Bacteria 693
401 Ga0496115_0204919 3300048918 Bacteria 1629
402 Ga0496116_0002643 3300048919 Bacteria 18559
403 Ga0496116_0038917 3300048919 Bacteria 3294
404 Ga0496117_0000949 3300048920 Bacteria 44310
405 Ga0496117_0001306 3300048920 Bacteria 36677
406 Ga0496118_0000029 3300048921 Bacteria 340978
407 Ga0496118_0002246 3300048921 Bacteria 26541
408 Ga0496118_0020547 3300048921 Bacteria 5851
409 Ga0496119_0010434 3300048922 Bacteria 7818
410 Ga0496119_0012671 3300048922 Bacteria 6822
411 Ga0496120_0029229 3300048923 Bacteria 3366
412 Ga0496120_0090807 3300048923 Bacteria 1632
413 Ga0496120_0091279 3300048923 Bacteria 1626
414 Ga0496121_0000048 3300048924 Bacteria 330242
415 Ga0496121_0003592 3300048924 Bacteria 21894
416 Ga0496121_0128752 3300048924 Bacteria 1899
417 Ga0496122_0000301 3300048925 Bacteria 109636
418 Ga0496122_0014377 3300048925 Bacteria 7658
419 Ga0496122_0031811 3300048925 Bacteria 4379
420 Ga0496122_0073770 3300048925 Bacteria 2417
421 Ga0496123_0009937 3300048926 Bacteria 8487
422 Ga0496123_0050229 3300048926 Bacteria 2788
423 Ga0496124_0001160 3300048927 Bacteria 41305
424 Ga0496124_0406866 3300048927 Bacteria 942
425 Ga0496125_0000037 3300048928 Bacteria 330242
426 Ga0496125_0003079 3300048928 Bacteria 20827
427 Ga0496125_0092973 3300048928 Bacteria 2252
428 Ga0496126_0000046 3300048929 Bacteria 330242
429 Ga0496126_0005459 3300048929 Bacteria 14506
430 Ga0496126_0007292 3300048929 Bacteria 12148
431 Ga0496126_0017865 3300048929 Bacteria 7058
432 Ga0496126_0020029 3300048929 Bacteria 6571
433 Ga0496126_0027481 3300048929 Bacteria 5432
434 Ga0496126_0107507 3300048929 Bacteria 2433
435 Ga0496126_0140708 3300048929 Bacteria 2077
436 Ga0496126_0637948 3300048929 Bacteria 835
437 Ga0495678_044493 3300049459 Bacteria 1755
438 Ga0495682_0202669 3300049460 Bacteria 703
439 Ga0501031_0026273 3300049568 Bacteria 3796
440 Ga0501032_0035746 3300049569 Bacteria 3395
441 Ga0501033_0164245 3300049570 Bacteria 1597
442 Ga0501033_0167090 3300049570 Bacteria 1581
443 Ga0501033_0184881 3300049570 Bacteria 1493
444 Ga0501033_0419679 3300049570 Bacteria 932
445 Ga0501034_0001916 3300049571 Bacteria 26328
446 Ga0501034_0028500 3300049571 Bacteria 5683
447 Ga0501034_0078208 3300049571 Bacteria 3313
448 Ga0501034_0149343 3300049571 Bacteria 2313
449 Ga0501034_0187144 3300049571 Bacteria 2033
450 Ga0501034_0244894 3300049571 Bacteria 1738
451 Ga0501034_0590391 3300049571 Bacteria 1017
452 Ga0501036_0065640 3300049572 Bacteria 3071
453 Ga0501036_0125486 3300049572 Bacteria 2168
454 Ga0501038_0320546 3300049574 Bacteria 1212
455 Ga0501040_0548867 3300049576 Bacteria 834
456 Ga0501042_0066013 3300049578 Bacteria 2586
457 Ga0501046_0001059 3300049580 Bacteria 26939
458 Ga0501047_0003220 3300049581 Bacteria 15473
459 Ga0501047_0065743 3300049581 Bacteria 3495
460 Ga0501048_0001266 3300049582 Bacteria 19121
461 Ga0501048_0267413 3300049582 Bacteria 1215
462 Ga0501070_0003494 3300049586 Bacteria 13621
463 Ga0501070_0063092 3300049586 Bacteria 3069
464 Ga0501070_0356448 3300049586 Bacteria 1187
465 Ga0501071_0028270 3300049587 Bacteria 3951
466 Ga0501072_0029632 3300049588 Bacteria 4276
467 Ga0501073_0022574 3300049589 Bacteria 4529
468 Ga0501076_0105860 3300049592 Bacteria 2270
469 Ga0501080_0185499 3300049742 Bacteria 1913
470 Ga0501080_0904480 3300049742 Bacteria 769
471 Ga0501035_0000542 3300049822 Bacteria 41925
472 Ga0501035_0010624 3300049822 Bacteria 8525
473 Ga0501035_0379890 3300049822 Bacteria 1178
474 Ga0501044_0000153 3300049823 Bacteria 85673
475 Ga0501044_0003155 3300049823 Bacteria 18643
476 Ga0501044_0018602 3300049823 Bacteria 7444
477 Ga0501044_0312160 3300049823 Bacteria 1499
478 nmdc:mga03683_172238_c1 3300050489 Bacteria 984
479 nmdc:mga03683_289524_c1 3300050489 Bacteria 766
480 nmdc:mga03n38_29300_c1 3300050490 Bacteria 2302
481 nmdc:mga03n38_40813_c1 3300050490 Bacteria 2018
482 nmdc:mga03n38_45327_c1 3300050490 Bacteria 1936
483 nmdc:mga03n38_5392_c1 3300050490 Bacteria 4349
484 nmdc:mga03n38_79072_c1 3300050490 Bacteria 1541
485 nmdc:mga00v17_13259_c1 3300050491 Bacteria 4570
486 nmdc:mga00v17_21287_c1 3300050491 Bacteria 3726
487 nmdc:mga00v17_219588_c1 3300050491 Bacteria 1230
488 nmdc:mga00v17_377810_c1 3300050491 Bacteria 921
489 nmdc:mga00v17_40525_c1 3300050491 Bacteria 2794
490 nmdc:mga00v17_4090_c1 3300050491 Bacteria 7547
491 nmdc:mga00v17_508752_c1 3300050491 Bacteria 780
492 nmdc:mga0yw44_18555_c1 3300050492 Bacteria 3814
493 nmdc:mga0yw44_25132_c1 3300050492 Bacteria 3381
494 nmdc:mga0yw44_371884_c1 3300050492 Bacteria 964
495 nmdc:mga0yw44_408631_c1 3300050492 Bacteria 918
496 nmdc:mga0yw44_409051_c1 3300050492 Bacteria 918
497 nmdc:mga0yw44_4734_c2 3300050492 Bacteria 4900
498 nmdc:mga0yw44_82326_c1 3300050492 Bacteria 2019
499 nmdc:mga0k408_192506_c1 3300050493 Bacteria 1217
500 nmdc:mga06z11_284150_c1 3300050494 Bacteria 981
501 nmdc:mga04h51_13643_c1 3300050495 Bacteria 2304
502 nmdc:mga04h51_471057_c1 3300050495 Bacteria 533
503 nmdc:mga07m45_208081_c1 3300050496 Bacteria 1138
504 nmdc:mga07m45_2264_c1 3300050496 Bacteria 8988
505 nmdc:mga07m45_90879_c1 3300050496 Bacteria 1749
506 nmdc:mga0n895_1180186_c1 3300050512 Bacteria 740
507 nmdc:mga0sz30_117165_c1 3300050516 Bacteria 1169
508 nmdc:mga0sz30_175738_c1 3300050516 Bacteria 949
509 nmdc:mga0sz30_32052_c2 3300050516 Bacteria 1500
510 nmdc:mga0sz30_38169_c1 3300050516 Bacteria 2012
511 nmdc:mga0sz30_54738_c1 3300050516 Bacteria 1697
512 nmdc:mga0sz30_66079_c1 3300050516 Bacteria 1551
513 nmdc:mga0sz30_7720_c1 3300050516 Bacteria 4040
514 Ga0495655_0101393 3300053083 Bacteria 853
515 Ga0500643_008471 3300053087 Bacteria 4038
516 Ga0500641_0150700 3300053096 Bacteria 1004
517 Ga0500553_080701 3300053101 Bacteria 1464
518 Ga0500560_154273 3300053107 Bacteria 762
519 Ga0500595_083512 3300053119 Bacteria 932
520 Ga0500614_075166 3300053123 Bacteria 935
521 Ga0500559_0167449 3300053136 Bacteria 1033
522 Ga0500573_0000483 3300053140 Bacteria 17183
523 Ga0500573_0048527 3300053140 Bacteria 2443
524 Ga0500616_0000427 3300053153 Bacteria 56111
525 Ga0500616_0082860 3300053153 Bacteria 1608
526 Ga0500627_0018290 3300053158 Bacteria 2772
527 Ga0500645_000039 3300053730 Bacteria 111509
528 Ga0501084_0233599 3300054114 Bacteria 1552
529 Ga0501082_0882272 3300060353 Bacteria 782
530 Ga0466962_0011686 3300061719 Bacteria 4227
531 Ga0466962_0043677 3300061719 Bacteria 2144
532 Ga0466962_0069962 3300061719 Bacteria 1676
533 Ga0530510_0016337 3300061734 Bacteria 5251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2791355406 2793979636 156
2 3300046452 Ga0495617_065732 Ga0495617_065732_236_721 159
3 3300046455 Ga0495603_0024982 Ga0495603_0024982_930_1415 159
4 3300046459 Ga0495629_0126247 Ga0495629_0126247_843_1328 159
5 3300046474 Ga0495605_0005089 Ga0495605_0005089_4804_5289 159
6 3300046476 Ga0495662_0172370 Ga0495662_0172370_398_883 159
7 3300046491 Ga0495584_0110497 Ga0495584_0110497_574_1059 159
8 3300046492 Ga0495585_0082322 Ga0495585_0082322_319_804 159
9 3300046499 Ga0495594_0040929 Ga0495594_0040929_1123_1608 159
10 3300046507 Ga0495606_0044622 Ga0495606_0044622_991_1476 159
11 3300046513 Ga0495616_0018316 Ga0495616_0018316_1562_2047 159
12 3300046515 Ga0495620_0006239 Ga0495620_0006239_4148_4633 159
13 3300046518 Ga0495631_0006066 Ga0495631_0006066_1079_1564 159
14 3300046524 Ga0495648_0105307 Ga0495648_0105307_363_848 159
15 3300046530 Ga0495654_0113939 Ga0495654_0113939_415_900 159
16 3300046538 Ga0495609_0068006 Ga0495609_0068006_779_1264 159
17 3300046542 Ga0495597_0098151 Ga0495597_0098151_310_795 159
18 3300046557 Ga0495622_0024221 Ga0495622_0024221_305_790 159
19 3300046558 Ga0495633_0105190 Ga0495633_0105190_415_900 159
20 3300046616 Ga0495668_0005978 Ga0495668_0005978_7539_8024 159
21 3300046642 Ga0495634_0042728 Ga0495634_0042728_2265_2750 159
22 3300046648 Ga0495611_0217813 Ga0495611_0217813_322_807 159
23 3300046660 Ga0495625_0049196 Ga0495625_0049196_1761_2246 159
24 3300046692 Ga0495671_0257936 Ga0495671_0257936_130_615 159
25 3300046694 Ga0495649_0206956 Ga0495649_0206956_166_651 159
26 3300046794 Ga0495589_0079957 Ga0495589_0079957_731_1216 159
27 3300047321 Ga0495676_0002513 Ga0495676_0002513_8671_9156 159
28 3300047323 Ga0495683_0044051 Ga0495683_0044051_509_994 159
29 3300047443 Ga0495687_072412 Ga0495687_072412_473_958 159
30 3300049459 Ga0495678_044493 Ga0495678_044493_911_1396 159
31 3300049460 Ga0495682_0202669 Ga0495682_0202669_195_680 159
32 iso_pu_bacteria 2744054611 2744954990 159
33 iso_pu_bacteria 2902837492 2902842879 159
34 3300005367 Ga0070667_101845076 Ga0070667_1018450761 160
35 3300031995 Ga0307409_101945960 Ga0307409_1019459601 160
36 3300046794 Ga0495589_0018777 Ga0495589_0018777_2308_2799 160
37 3300047447 Ga0495685_007529 Ga0495685_007529_436_927 160
38 3300021384 Ga0213876_10004195 Ga0213876_100041955 161
39 3300021388 Ga0213875_10058963 Ga0213875_100589633 161
40 iso_pu_bacteria 2643221635 2644198232 161
41 iso_pu_bacteria 2738541274 2738708081 161
42 iso_pu_bacteria 2738543028 2739334333 161
43 iso_pu_bacteria 2858868258 2858870261 161
44 iso_pu_bacteria 2902799365 2902802399 161
45 iso_pu_bacteria 2928142448 2928146458 161
46 iso_pu_bacteria 8047893842 8047893914 161
47 iso_pu_bacteria 8048127548 8048135106 161
48 iso_pu_bacteria 8048356638 8048364931 161
49 iso_pu_bacteria 8048369669 8048370931 161
50 iso_pu_bacteria 8048379754 8048388491 161
51 3300044693 Ga0466961_0867527 Ga0466961_0867527_22_525 162
52 3300044719 Ga0466971_0026389 Ga0466971_0026389_1598_2101 162
53 3300045836 Ga0466958_0145612 Ga0466958_0145612_529_1032 162
54 3300045976 Ga0466967_0109739 Ga0466967_0109739_1215_1703 162
55 iso_pu_bacteria 2751185725 2753035791 162
56 iso_pu_bacteria 2751185792 2753326184 162
57 iso_pu_bacteria 2857723135 2857727002 162
58 iso_pu_bacteria 2920879853 2920881519 162
59 3300003792 Ga0055540_1000127 Ga0055540_100012746 163
60 3300005335 Ga0070666_10061187 Ga0070666_100611872 163
61 3300005336 Ga0070680_100005883 Ga0070680_1000058839 163
62 3300005353 Ga0070669_100002791 Ga0070669_10000279112 163
63 3300005367 Ga0070667_100000364 Ga0070667_10000036426 163
64 3300005367 Ga0070667_100001901 Ga0070667_1000019019 163
65 3300005455 Ga0070663_100893777 Ga0070663_1008937771 163
66 3300005458 Ga0070681_10009384 Ga0070681_100093845 163
67 3300005530 Ga0070679_100013375 Ga0070679_1000133755 163
68 3300005530 Ga0070679_100950450 Ga0070679_1009504502 163
69 3300005548 Ga0070665_100020835 Ga0070665_1000208355 163
70 3300005563 Ga0068855_101185049 Ga0068855_1011850492 163
71 3300005618 Ga0068864_100096874 Ga0068864_1000968742 163
72 3300005842 Ga0068858_100098954 Ga0068858_1000989543 163
73 3300005843 Ga0068860_100000480 Ga0068860_10000048029 163
74 3300005844 Ga0068862_100000771 Ga0068862_10000077114 163
75 3300006051 Ga0075364_10024996 Ga0075364_100249965 163
76 3300006186 Ga0075369_10060673 Ga0075369_100606733 163
77 3300009101 Ga0105247_10000089 Ga0105247_100000895 163
78 3300009148 Ga0105243_10736064 Ga0105243_107360642 163
79 3300009177 Ga0105248_10057821 Ga0105248_100578213 163
80 3300009545 Ga0105237_10017251 Ga0105237_100172515 163
81 3300009553 Ga0105249_10000282 Ga0105249_1000028223 163
82 3300010375 Ga0105239_10008621 Ga0105239_100086217 163
83 3300014325 Ga0163163_10044222 Ga0163163_100442224 163
84 3300014968 Ga0157379_10146249 Ga0157379_101462493 163
85 3300020070 Ga0206356_11520211 Ga0206356_115202112 163
86 3300020081 Ga0206354_10793280 Ga0206354_107932805 163
87 3300020082 Ga0206353_10617536 Ga0206353_1061753610 163
88 3300022467 Ga0224712_10148268 Ga0224712_101482682 163
89 3300025303 Ga0209051_1000014 Ga0209051_1000014110 163
90 3300025303 Ga0209051_1000292 Ga0209051_10002926 163
91 3300025303 Ga0209051_1001885 Ga0209051_10018856 163
92 3300025900 Ga0207710_10000117 Ga0207710_1000011793 163
93 3300025903 Ga0207680_10011645 Ga0207680_100116455 163
94 3300025909 Ga0207705_10005019 Ga0207705_100050197 163
95 3300025912 Ga0207707_10003813 Ga0207707_1000381310 163
96 3300025917 Ga0207660_10000404 Ga0207660_1000040416 163
97 3300025921 Ga0207652_10003286 Ga0207652_100032868 163
98 3300025923 Ga0207681_10001770 Ga0207681_100017708 163
99 3300025935 Ga0207709_10993245 Ga0207709_109932452 163
100 3300025941 Ga0207711_10036412 Ga0207711_100364124 163
101 3300025949 Ga0207667_11022116 Ga0207667_110221162 163
102 3300025961 Ga0207712_10000243 Ga0207712_1000024341 163
103 3300025986 Ga0207658_10000680 Ga0207658_1000068036 163
104 3300025986 Ga0207658_10005620 Ga0207658_100056203 163
105 3300028379 Ga0268266_10005906 Ga0268266_100059068 163
106 3300028380 Ga0268265_10000738 Ga0268265_1000073814 163
107 3300028381 Ga0268264_10000503 Ga0268264_1000050328 163
108 3300031251 Ga0265327_10001010 Ga0265327_1000101032 163
109 3300031852 Ga0307410_10049129 Ga0307410_100491292 163
110 3300032002 Ga0307416_100876953 Ga0307416_1008769532 163
111 3300032004 Ga0307414_10049869 Ga0307414_100498693 163
112 3300037466 Ga0395898_0057861 Ga0395898_0057861_843_1397 163
113 3300038443 Ga0395901_0071040 Ga0395901_0071040_2461_2958 163
114 3300038443 Ga0395901_0090767 Ga0395901_0090767_578_1132 163
115 3300041452 Ga0451793_0372464 Ga0451793_0372464_106_606 163
116 3300041452 Ga0451793_0893773 Ga0451793_0893773_476_973 163
117 3300041462 Ga0451806_007012 Ga0451806_007012_565_1062 163
118 3300041462 Ga0451806_524758 Ga0451806_524758_665_1165 163
119 3300041509 Ga0451843_0676841 Ga0451843_0676841_143_643 163
120 3300042005 Ga0439448_0018951 Ga0439448_0018951_142_633 163
121 3300044683 Ga0466965_0065906 Ga0466965_0065906_192_683 163
122 3300044765 Ga0466970_0182746 Ga0466970_0182746_563_1054 163
123 3300045976 Ga0466967_0240765 Ga0466967_0240765_525_1016 163
124 3300047472 Ga0495686_0129850 Ga0495686_0129850_656_1147 163
125 3300048903 Ga0496100_0000043 Ga0496100_0000043_6778_7269 163
126 3300048903 Ga0496100_0032952 Ga0496100_0032952_2712_3203 163
127 3300048904 Ga0496101_0000374 Ga0496101_0000374_22441_22932 163
128 3300048904 Ga0496101_0725386 Ga0496101_0725386_281_772 163
129 3300048905 Ga0496102_0000399 Ga0496102_0000399_23327_23818 163
130 3300048905 Ga0496102_0058916 Ga0496102_0058916_2349_2840 163
131 3300048906 Ga0496103_0000810 Ga0496103_0000810_21080_21571 163
132 3300048906 Ga0496103_0000860 Ga0496103_0000860_6574_7065 163
133 3300048909 Ga0496106_0014461 Ga0496106_0014461_709_1200 163
134 3300048909 Ga0496106_0155709 Ga0496106_0155709_446_937 163
135 3300048910 Ga0496107_0002846 Ga0496107_0002846_6733_7224 163
136 3300048910 Ga0496107_0017384 Ga0496107_0017384_2571_3062 163
137 3300048911 Ga0496108_0063889 Ga0496108_0063889_2283_2774 163
138 3300048912 Ga0496109_0000616 Ga0496109_0000616_6778_7269 163
139 3300048913 Ga0496110_0003741 Ga0496110_0003741_6748_7239 163
140 3300048913 Ga0496110_0092155 Ga0496110_0092155_1229_1720 163
141 3300048914 Ga0496111_0040070 Ga0496111_0040070_1106_1597 163
142 3300048916 Ga0496113_0041891 Ga0496113_0041891_1058_1549 163
143 3300048917 Ga0496114_0000465 Ga0496114_0000465_6768_7259 163
144 3300048918 Ga0496115_0204919 Ga0496115_0204919_409_900 163
145 3300048919 Ga0496116_0002643 Ga0496116_0002643_5413_5904 163
146 3300048919 Ga0496116_0038917 Ga0496116_0038917_870_1361 163
147 3300048920 Ga0496117_0000949 Ga0496117_0000949_21682_22173 163
148 3300048920 Ga0496117_0001306 Ga0496117_0001306_31484_31975 163
149 3300048921 Ga0496118_0002246 Ga0496118_0002246_11377_11868 163
150 3300048921 Ga0496118_0020547 Ga0496118_0020547_4690_5181 163
151 3300048922 Ga0496119_0010434 Ga0496119_0010434_6632_7123 163
152 3300048922 Ga0496119_0012671 Ga0496119_0012671_4382_4873 163
153 3300048923 Ga0496120_0029229 Ga0496120_0029229_2865_3356 163
154 3300048923 Ga0496120_0090807 Ga0496120_0090807_829_1320 163
155 3300048923 Ga0496120_0091279 Ga0496120_0091279_405_896 163
156 3300048924 Ga0496121_0000048 Ga0496121_0000048_6778_7269 163
157 3300048924 Ga0496121_0003592 Ga0496121_0003592_20068_20559 163
158 3300048925 Ga0496122_0000301 Ga0496122_0000301_26258_26749 163
159 3300048925 Ga0496122_0031811 Ga0496122_0031811_1907_2398 163
160 3300048926 Ga0496123_0009937 Ga0496123_0009937_1360_1851 163
161 3300048926 Ga0496123_0050229 Ga0496123_0050229_878_1369 163
162 3300048927 Ga0496124_0001160 Ga0496124_0001160_34037_34528 163
163 3300048927 Ga0496124_0406866 Ga0496124_0406866_174_665 163
164 3300048928 Ga0496125_0000037 Ga0496125_0000037_6778_7269 163
165 3300048928 Ga0496125_0092973 Ga0496125_0092973_279_770 163
166 3300048929 Ga0496126_0000046 Ga0496126_0000046_6778_7269 163
167 3300048929 Ga0496126_0005459 Ga0496126_0005459_10452_10943 163
168 3300048929 Ga0496126_0020029 Ga0496126_0020029_866_1369 163
169 3300048929 Ga0496126_0027481 Ga0496126_0027481_4906_5397 163
170 3300049571 Ga0501034_0078208 Ga0501034_0078208_1269_1769 163
171 3300049571 Ga0501034_0187144 Ga0501034_0187144_681_1178 163
172 3300049589 Ga0501073_0022574 Ga0501073_0022574_2163_2660 163
173 3300050490 nmdc:mga03n38_29300_c1 nmdc:mga03n38_29300_c1_1420_1911 163
174 3300050491 nmdc:mga00v17_4090_c1 nmdc:mga00v17_4090_c1_2513_3004 163
175 3300050516 nmdc:mga0sz30_66079_c1 nmdc:mga0sz30_66079_c1_563_1054 163
176 3300053153 Ga0500616_0082860 Ga0500616_0082860_699_1202 163
177 iso_pu_bacteria 2551306166 2552110901 163
178 iso_pu_bacteria 2738541264 2738663908 163
179 iso_pu_bacteria 2738541356 2739143043 163
180 3300005327 Ga0070658_10316090 Ga0070658_103160903 164
181 3300005336 Ga0070680_100852244 Ga0070680_1008522442 164
182 3300005339 Ga0070660_100349021 Ga0070660_1003490211 164
183 3300005345 Ga0070692_10107159 Ga0070692_101071593 164
184 3300005366 Ga0070659_100030591 Ga0070659_1000305915 164
185 3300005456 Ga0070678_100877200 Ga0070678_1008772002 164
186 3300005530 Ga0070679_100079601 Ga0070679_1000796014 164
187 3300005577 Ga0068857_100815334 Ga0068857_1008153341 164
188 3300005615 Ga0070702_100777737 Ga0070702_1007777372 164
189 3300006175 Ga0070712_101352653 Ga0070712_1013526532 164
190 3300013105 Ga0157369_10009016 Ga0157369_1000901613 164
191 3300013306 Ga0163162_10559037 Ga0163162_105590372 164
192 3300017792 Ga0163161_10062564 Ga0163161_100625644 164
193 3300020082 Ga0206353_11385569 Ga0206353_113855693 164
194 3300025909 Ga0207705_10029804 Ga0207705_100298045 164
195 3300025912 Ga0207707_10130057 Ga0207707_101300573 164
196 3300025917 Ga0207660_10085697 Ga0207660_100856974 164
197 3300025921 Ga0207652_10030107 Ga0207652_100301078 164
198 3300025928 Ga0207700_10184199 Ga0207700_101841992 164
199 3300025945 Ga0207679_10161025 Ga0207679_101610251 164
200 3300031548 Ga0307408_100049858 Ga0307408_1000498584 164
201 3300031731 Ga0307405_10076998 Ga0307405_100769983 164
202 3300031903 Ga0307407_10201849 Ga0307407_102018492 164
203 3300031995 Ga0307409_100158977 Ga0307409_1001589772 164
204 3300032002 Ga0307416_100230662 Ga0307416_1002306621 164
205 3300032004 Ga0307414_11302327 Ga0307414_113023271 164
206 3300038443 Ga0395901_0205985 Ga0395901_0205985_1516_2022 164
207 3300044683 Ga0466965_0134422 Ga0466965_0134422_425_928 164
208 3300044765 Ga0466970_0047698 Ga0466970_0047698_290_793 164
209 3300044765 Ga0466970_0406536 Ga0466970_0406536_227_730 164
210 3300045976 Ga0466967_0379037 Ga0466967_0379037_717_1211 164
211 3300045976 Ga0466967_0757366 Ga0466967_0757366_447_950 164
212 3300047443 Ga0495687_115433 Ga0495687_115433_366_878 164
213 3300048906 Ga0496103_0552345 Ga0496103_0552345_142_636 164
214 3300048907 Ga0496104_0236020 Ga0496104_0236020_1045_1539 164
215 3300048909 Ga0496106_0080351 Ga0496106_0080351_42_536 164
216 3300048910 Ga0496107_0113054 Ga0496107_0113054_78_572 164
217 3300048913 Ga0496110_0554651 Ga0496110_0554651_426_920 164
218 3300048915 Ga0496112_0412071 Ga0496112_0412071_463_960 164
219 3300048917 Ga0496114_0442862 Ga0496114_0442862_24_584 164
220 3300048917 Ga0496114_1064591 Ga0496114_1064591_92_586 164
221 3300048925 Ga0496122_0073770 Ga0496122_0073770_1851_2351 164
222 3300048928 Ga0496125_0003079 Ga0496125_0003079_17632_18132 164
223 3300048929 Ga0496126_0107507 Ga0496126_0107507_115_615 164
224 3300049571 Ga0501034_0028500 Ga0501034_0028500_2240_2743 164
225 3300049574 Ga0501038_0320546 Ga0501038_0320546_317_820 164
226 3300049586 Ga0501070_0356448 Ga0501070_0356448_346_846 164
227 3300053136 Ga0500559_0167449 Ga0500559_0167449_489_983 164
228 3300053140 Ga0500573_0000483 Ga0500573_0000483_1737_2243 164
229 3300053140 Ga0500573_0048527 Ga0500573_0048527_1500_2006 164
230 3300053153 Ga0500616_0000427 Ga0500616_0000427_35344_35847 164
231 3300003759 Ga0055525_1007857 Ga0055525_10078572 165
232 3300005329 Ga0070683_100889455 Ga0070683_1008894552 165
233 3300005337 Ga0070682_100093334 Ga0070682_1000933342 165
234 3300005435 Ga0070714_100399979 Ga0070714_1003999793 165
235 3300005435 Ga0070714_100406296 Ga0070714_1004062962 165
236 3300005530 Ga0070679_101217368 Ga0070679_1012173681 165
237 3300005548 Ga0070665_101795769 Ga0070665_1017957691 165
238 3300005614 Ga0068856_100186009 Ga0068856_1001860092 165
239 3300006028 Ga0070717_11401025 Ga0070717_114010251 165
240 3300006038 Ga0075365_10003210 Ga0075365_100032108 165
241 3300006038 Ga0075365_10007484 Ga0075365_100074844 165
242 3300006038 Ga0075365_10035551 Ga0075365_100355515 165
243 3300006038 Ga0075365_10153288 Ga0075365_101532883 165
244 3300006038 Ga0075365_10494211 Ga0075365_104942112 165
245 3300006038 Ga0075365_10599231 Ga0075365_105992312 165
246 3300006048 Ga0075363_100001643 Ga0075363_1000016434 165
247 3300006048 Ga0075363_100423611 Ga0075363_1004236111 165
248 3300006051 Ga0075364_10007628 Ga0075364_100076286 165
249 3300006051 Ga0075364_10037445 Ga0075364_100374451 165
250 3300006051 Ga0075364_10608004 Ga0075364_106080041 165
251 3300006186 Ga0075369_10049508 Ga0075369_100495083 165
252 3300006186 Ga0075369_10105696 Ga0075369_101056963 165
253 3300006186 Ga0075369_10157113 Ga0075369_101571132 165
254 3300006353 Ga0075370_10049821 Ga0075370_100498212 165
255 3300009148 Ga0105243_10317308 Ga0105243_103173082 165
256 3300013105 Ga0157369_10096694 Ga0157369_100966944 165
257 3300013105 Ga0157369_10159256 Ga0157369_101592563 165
258 3300013105 Ga0157369_10222558 Ga0157369_102225582 165
259 3300013307 Ga0157372_10776666 Ga0157372_107766662 165
260 3300020082 Ga0206353_11715273 Ga0206353_117152732 165
261 3300021384 Ga0213876_10007576 Ga0213876_100075767 165
262 3300025230 Ga0209563_100201 Ga0209563_10020121 165
263 3300025303 Ga0209051_1026717 Ga0209051_10267173 165
264 3300025921 Ga0207652_10384423 Ga0207652_103844232 165
265 3300025921 Ga0207652_10440310 Ga0207652_104403102 165
266 3300025929 Ga0207664_10274824 Ga0207664_102748242 165
267 3300025929 Ga0207664_10601362 Ga0207664_106013622 165
268 3300025944 Ga0207661_10729050 Ga0207661_107290501 165
269 3300026075 Ga0207708_10051750 Ga0207708_100517501 165
270 3300031903 Ga0307407_10394023 Ga0307407_103940231 165
271 3300031911 Ga0307412_10456829 Ga0307412_104568292 165
272 3300031995 Ga0307409_100117576 Ga0307409_1001175763 165
273 3300031995 Ga0307409_101645118 Ga0307409_1016451181 165
274 3300032002 Ga0307416_100134888 Ga0307416_1001348883 165
275 3300032002 Ga0307416_100981043 Ga0307416_1009810431 165
276 3300033180 Ga0307510_10044663 Ga0307510_100446634 165
277 3300037853 Ga0436364_0207134 Ga0436364_0207134_1165_1662 165
278 3300039437 Ga0436365_0217155 Ga0436365_0217155_36635_37132 165
279 3300039437 Ga0436365_0869447 Ga0436365_0869447_10719_11216 165
280 3300039450 Ga0436363_1192164 Ga0436363_1192164_120_617 165
281 3300041451 Ga0451791_0678676 Ga0451791_0678676_132_632 165
282 3300041491 Ga0451833_0866363 Ga0451833_0866363_177_686 165
283 3300041509 Ga0451843_0046335 Ga0451843_0046335_71_580 165
284 3300041512 Ga0451853_3155658 Ga0451853_3155658_3883_4404 165
285 3300044656 Ga0466969_0162751 Ga0466969_0162751_198_701 165
286 3300044693 Ga0466961_0168132 Ga0466961_0168132_166_696 165
287 3300044719 Ga0466971_0073803 Ga0466971_0073803_188_694 165
288 3300044735 Ga0466968_0136434 Ga0466968_0136434_280_783 165
289 3300044765 Ga0466970_0010714 Ga0466970_0010714_2593_3099 165
290 3300044765 Ga0466970_0031797 Ga0466970_0031797_1271_1801 165
291 3300044842 Ga0466957_0015721 Ga0466957_0015721_970_1500 165
292 3300044842 Ga0466957_0022614 Ga0466957_0022614_1480_1977 165
293 3300044901 Ga0466960_0008545 Ga0466960_0008545_2838_3335 165
294 3300044901 Ga0466960_0011781 Ga0466960_0011781_2186_2716 165
295 3300045049 Ga0466959_0302337 Ga0466959_0302337_56_562 165
296 3300045836 Ga0466958_0032539 Ga0466958_0032539_649_1179 165
297 3300045836 Ga0466958_0364804 Ga0466958_0364804_94_606 165
298 3300045976 Ga0466967_0013591 Ga0466967_0013591_5376_5873 165
299 3300045976 Ga0466967_0065039 Ga0466967_0065039_2378_2884 165
300 3300045976 Ga0466967_0728291 Ga0466967_0728291_133_648 165
301 3300045976 Ga0466967_2125925 Ga0466967_2125925_34_540 165
302 3300046460 Ga0495638_0023724 Ga0495638_0023724_1577_2077 165
303 3300046499 Ga0495594_0182883 Ga0495594_0182883_586_1104 165
304 3300046648 Ga0495611_0334735 Ga0495611_0334735_68_568 165
305 3300047320 Ga0495672_0127815 Ga0495672_0127815_229_729 165
306 3300047322 Ga0495680_0269024 Ga0495680_0269024_14_514 165
307 3300048904 Ga0496101_0146367 Ga0496101_0146367_1269_1769 165
308 3300048917 Ga0496114_0408910 Ga0496114_0408910_436_936 165
309 3300048921 Ga0496118_0000029 Ga0496118_0000029_71860_72357 165
310 3300048924 Ga0496121_0128752 Ga0496121_0128752_118_618 165
311 3300048925 Ga0496122_0014377 Ga0496122_0014377_3041_3550 165
312 3300048929 Ga0496126_0007292 Ga0496126_0007292_11577_12077 165
313 3300048929 Ga0496126_0017865 Ga0496126_0017865_4476_4973 165
314 3300048929 Ga0496126_0140708 Ga0496126_0140708_305_805 165
315 3300049568 Ga0501031_0026273 Ga0501031_0026273_1124_1627 165
316 3300049569 Ga0501032_0035746 Ga0501032_0035746_1669_2178 165
317 3300049570 Ga0501033_0164245 Ga0501033_0164245_976_1485 165
318 3300049570 Ga0501033_0419679 Ga0501033_0419679_395_892 165
319 3300049571 Ga0501034_0244894 Ga0501034_0244894_684_1193 165
320 3300049572 Ga0501036_0065640 Ga0501036_0065640_1736_2239 165
321 3300049576 Ga0501040_0548867 Ga0501040_0548867_232_741 165
322 3300049578 Ga0501042_0066013 Ga0501042_0066013_21_524 165
323 3300049581 Ga0501047_0003220 Ga0501047_0003220_93_602 165
324 3300049582 Ga0501048_0267413 Ga0501048_0267413_58_567 165
325 3300049587 Ga0501071_0028270 Ga0501071_0028270_1476_1979 165
326 3300049588 Ga0501072_0029632 Ga0501072_0029632_2996_3499 165
327 3300049592 Ga0501076_0105860 Ga0501076_0105860_350_853 165
328 3300049742 Ga0501080_0904480 Ga0501080_0904480_193_696 165
329 3300049822 Ga0501035_0000542 Ga0501035_0000542_12465_12974 165
330 3300049822 Ga0501035_0379890 Ga0501035_0379890_67_564 165
331 3300049823 Ga0501044_0000153 Ga0501044_0000153_57556_58065 165
332 3300049823 Ga0501044_0018602 Ga0501044_0018602_6384_6881 165
333 3300049823 Ga0501044_0312160 Ga0501044_0312160_906_1403 165
334 3300050490 nmdc:mga03n38_45327_c1 nmdc:mga03n38_45327_c1_1420_1917 165
335 3300050491 nmdc:mga00v17_13259_c1 nmdc:mga00v17_13259_c1_2617_3114 165
336 3300050491 nmdc:mga00v17_21287_c1 nmdc:mga00v17_21287_c1_83_580 165
337 3300050491 nmdc:mga00v17_219588_c1 nmdc:mga00v17_219588_c1_194_691 165
338 3300050492 nmdc:mga0yw44_18555_c1 nmdc:mga0yw44_18555_c1_765_1268 165
339 3300050492 nmdc:mga0yw44_371884_c1 nmdc:mga0yw44_371884_c1_256_756 165
340 3300050492 nmdc:mga0yw44_408631_c1 nmdc:mga0yw44_408631_c1_110_613 165
341 3300050492 nmdc:mga0yw44_409051_c1 nmdc:mga0yw44_409051_c1_344_847 165
342 3300050492 nmdc:mga0yw44_4734_c2 nmdc:mga0yw44_4734_c2_1189_1686 165
343 3300050495 nmdc:mga04h51_471057_c1 nmdc:mga04h51_471057_c1_16_513 165
344 3300050496 nmdc:mga07m45_90879_c1 nmdc:mga07m45_90879_c1_98_595 165
345 3300050512 nmdc:mga0n895_1180186_c1 nmdc:mga0n895_1180186_c1_38_535 165
346 3300050516 nmdc:mga0sz30_38169_c1 nmdc:mga0sz30_38169_c1_270_770 165
347 3300050516 nmdc:mga0sz30_54738_c1 nmdc:mga0sz30_54738_c1_267_767 165
348 3300050516 nmdc:mga0sz30_7720_c1 nmdc:mga0sz30_7720_c1_539_1036 165
349 3300053087 Ga0500643_008471 Ga0500643_008471_3222_3722 165
350 3300053096 Ga0500641_0150700 Ga0500641_0150700_271_771 165
351 3300053119 Ga0500595_083512 Ga0500595_083512_81_581 165
352 3300053158 Ga0500627_0018290 Ga0500627_0018290_1548_2048 165
353 3300053730 Ga0500645_000039 Ga0500645_000039_4841_5341 165
354 3300054114 Ga0501084_0233599 Ga0501084_0233599_1005_1508 165
355 3300060353 Ga0501082_0882272 Ga0501082_0882272_205_708 165
356 3300061719 Ga0466962_0011686 Ga0466962_0011686_121_627 165
357 3300061719 Ga0466962_0069962 Ga0466962_0069962_375_872 165
358 3300061734 Ga0530510_0016337 Ga0530510_0016337_321_824 165
359 3300021388 Ga0213875_10084961 Ga0213875_100849612 166
360 3300025253 Ga0209677_101445 Ga0209677_1014452 166
361 3300028379 Ga0268266_10446266 Ga0268266_104462662 166
362 3300031548 Ga0307408_100275538 Ga0307408_1002755383 166
363 3300031824 Ga0307413_10033079 Ga0307413_100330792 166
364 3300031852 Ga0307410_10002907 Ga0307410_100029077 166
365 3300031995 Ga0307409_100012864 Ga0307409_1000128647 166
366 3300031995 Ga0307409_101217170 Ga0307409_1012171702 166
367 3300032002 Ga0307416_100014453 Ga0307416_1000144535 166
368 3300032004 Ga0307414_10309540 Ga0307414_103095402 166
369 3300032005 Ga0307411_10084568 Ga0307411_100845685 166
370 3300032126 Ga0307415_100010253 Ga0307415_1000102532 166
371 3300033179 Ga0307507_10557385 Ga0307507_105573851 166
372 3300037853 Ga0436364_1471767 Ga0436364_1471767_700_1221 166
373 3300038443 Ga0395901_0352865 Ga0395901_0352865_148_666 166
374 3300041413 Ga0439465_0278332 Ga0439465_0278332_89_589 166
375 3300046689 Ga0495613_0168537 Ga0495613_0168537_154_663 166
376 3300048911 Ga0496108_0122967 Ga0496108_0122967_748_1275 166
377 3300048916 Ga0496113_0753246 Ga0496113_0753246_179_679 166
378 3300049570 Ga0501033_0167090 Ga0501033_0167090_883_1404 166
379 3300049571 Ga0501034_0149343 Ga0501034_0149343_10_528 166
380 3300049571 Ga0501034_0590391 Ga0501034_0590391_197_715 166
381 3300053101 Ga0500553_080701 Ga0500553_080701_265_774 166
382 3300053107 Ga0500560_154273 Ga0500560_154273_87_596 166
383 3300053123 Ga0500614_075166 Ga0500614_075166_364_873 166
384 3300001991 JGI24743J22301_10002611 JGI24743J22301_100026112 167
385 3300003215 JGI25153J46596_10051829 JGI25153J46596_100518291 167
386 3300005328 Ga0070676_10162077 Ga0070676_101620773 167
387 3300005334 Ga0068869_100006363 Ga0068869_1000063637 167
388 3300005338 Ga0068868_100087892 Ga0068868_1000878922 167
389 3300005347 Ga0070668_100073296 Ga0070668_1000732964 167
390 3300005356 Ga0070674_100814145 Ga0070674_1008141451 167
391 3300005366 Ga0070659_100323441 Ga0070659_1003234412 167
392 3300005434 Ga0070709_10193937 Ga0070709_101939372 167
393 3300005455 Ga0070663_100018581 Ga0070663_1000185813 167
394 3300005458 Ga0070681_10513529 Ga0070681_105135292 167
395 3300005466 Ga0070685_10045651 Ga0070685_100456512 167
396 3300005539 Ga0068853_100153234 Ga0068853_1001532343 167
397 3300005545 Ga0070695_100370220 Ga0070695_1003702202 167
398 3300005548 Ga0070665_100045322 Ga0070665_1000453224 167
399 3300005563 Ga0068855_100585358 Ga0068855_1005853582 167
400 3300005578 Ga0068854_100116238 Ga0068854_1001162383 167
401 3300005615 Ga0070702_100125596 Ga0070702_1001255962 167
402 3300005616 Ga0068852_100597323 Ga0068852_1005973232 167
403 3300005618 Ga0068864_100480925 Ga0068864_1004809251 167
404 3300005719 Ga0068861_100049108 Ga0068861_1000491081 167
405 3300005840 Ga0068870_10793135 Ga0068870_107931351 167
406 3300005841 Ga0068863_100209411 Ga0068863_1002094112 167
407 3300005841 Ga0068863_100340882 Ga0068863_1003408822 167
408 3300005843 Ga0068860_100497693 Ga0068860_1004976931 167
409 3300005844 Ga0068862_101344841 Ga0068862_1013448411 167
410 3300006038 Ga0075365_10076528 Ga0075365_100765284 167
411 3300006048 Ga0075363_100013323 Ga0075363_1000133236 167
412 3300006048 Ga0075363_100061513 Ga0075363_1000615134 167
413 3300006051 Ga0075364_10016390 Ga0075364_100163905 167
414 3300006051 Ga0075364_10037843 Ga0075364_100378432 167
415 3300006051 Ga0075364_10098415 Ga0075364_100984154 167
416 3300006051 Ga0075364_10797677 Ga0075364_107976771 167
417 3300006175 Ga0070712_100680841 Ga0070712_1006808412 167
418 3300006177 Ga0075362_10112222 Ga0075362_101122222 167
419 3300006177 Ga0075362_10356164 Ga0075362_103561641 167
420 3300006178 Ga0075367_10033485 Ga0075367_100334855 167
421 3300006178 Ga0075367_10772034 Ga0075367_107720341 167
422 3300006186 Ga0075369_10126551 Ga0075369_101265512 167
423 3300006186 Ga0075369_10140222 Ga0075369_101402222 167
424 3300006186 Ga0075369_10318935 Ga0075369_103189352 167
425 3300006195 Ga0075366_10064863 Ga0075366_100648632 167
426 3300006237 Ga0097621_100733153 Ga0097621_1007331532 167
427 3300006353 Ga0075370_10069470 Ga0075370_100694704 167
428 3300006353 Ga0075370_10081269 Ga0075370_100812694 167
429 3300009092 Ga0105250_10083487 Ga0105250_100834872 167
430 3300009094 Ga0111539_12084851 Ga0111539_120848511 167
431 3300009098 Ga0105245_10395164 Ga0105245_103951641 167
432 3300009101 Ga0105247_10085510 Ga0105247_100855102 167
433 3300009148 Ga0105243_10098025 Ga0105243_100980256 167
434 3300009176 Ga0105242_10104281 Ga0105242_101042812 167
435 3300009176 Ga0105242_11446592 Ga0105242_114465922 167
436 3300009177 Ga0105248_11625480 Ga0105248_116254801 167
437 3300009553 Ga0105249_10116411 Ga0105249_101164114 167
438 3300009553 Ga0105249_10817287 Ga0105249_108172871 167
439 3300011119 Ga0105246_10014095 Ga0105246_100140952 167
440 3300013105 Ga0157369_11146324 Ga0157369_111463241 167
441 3300013296 Ga0157374_10005379 Ga0157374_100053797 167
442 3300013306 Ga0163162_10125840 Ga0163162_101258405 167
443 3300013306 Ga0163162_10354389 Ga0163162_103543893 167
444 3300013308 Ga0157375_10434818 Ga0157375_104348182 167
445 3300014326 Ga0157380_10027628 Ga0157380_100276283 167
446 3300014745 Ga0157377_10664298 Ga0157377_106642981 167
447 3300014745 Ga0157377_11262865 Ga0157377_112628651 167
448 3300014968 Ga0157379_10030442 Ga0157379_100304426 167
449 3300025297 Ga0209758_1014772 Ga0209758_10147722 167
450 3300025901 Ga0207688_10007861 Ga0207688_100078612 167
451 3300025904 Ga0207647_10145372 Ga0207647_101453722 167
452 3300025906 Ga0207699_10149320 Ga0207699_101493202 167
453 3300025908 Ga0207643_10267317 Ga0207643_102673171 167
454 3300025915 Ga0207693_10406353 Ga0207693_104063532 167
455 3300025927 Ga0207687_10259600 Ga0207687_102596002 167
456 3300025927 Ga0207687_10381978 Ga0207687_103819781 167
457 3300025934 Ga0207686_10666852 Ga0207686_106668522 167
458 3300025937 Ga0207669_10896503 Ga0207669_108965031 167
459 3300025941 Ga0207711_10129481 Ga0207711_101294815 167
460 3300025942 Ga0207689_10004281 Ga0207689_100042816 167
461 3300025944 Ga0207661_10296271 Ga0207661_102962713 167
462 3300025949 Ga0207667_11381883 Ga0207667_113818832 167
463 3300025972 Ga0207668_10376066 Ga0207668_103760663 167
464 3300025981 Ga0207640_10395892 Ga0207640_103958922 167
465 3300026023 Ga0207677_10168382 Ga0207677_101683822 167
466 3300026035 Ga0207703_10166073 Ga0207703_101660731 167
467 3300026041 Ga0207639_10558926 Ga0207639_105589261 167
468 3300026067 Ga0207678_10017782 Ga0207678_100177823 167
469 3300026089 Ga0207648_10100389 Ga0207648_101003896 167
470 3300026095 Ga0207676_10439393 Ga0207676_104393933 167
471 3300026118 Ga0207675_100022653 Ga0207675_1000226538 167
472 3300026121 Ga0207683_11190219 Ga0207683_111902192 167
473 3300028379 Ga0268266_10020222 Ga0268266_100202224 167
474 3300028380 Ga0268265_11096142 Ga0268265_110961421 167
475 3300028381 Ga0268264_10484671 Ga0268264_104846712 167
476 3300028381 Ga0268264_12225096 Ga0268264_122250961 167
477 3300031824 Ga0307413_10628750 Ga0307413_106287501 167
478 3300031901 Ga0307406_10233622 Ga0307406_102336222 167
479 3300031911 Ga0307412_10091909 Ga0307412_100919093 167
480 3300032002 Ga0307416_100199112 Ga0307416_1001991123 167
481 3300032126 Ga0307415_100077749 Ga0307415_1000777492 167
482 3300039450 Ga0436363_0784449 Ga0436363_0784449_428_931 167
483 3300044658 Ga0466972_0013086 Ga0466972_0013086_3618_4121 167
484 3300044658 Ga0466972_0028744 Ga0466972_0028744_647_1177 167
485 3300044658 Ga0466972_0114574 Ga0466972_0114574_695_1198 167
486 3300044683 Ga0466965_0001959 Ga0466965_0001959_2224_2727 167
487 3300044683 Ga0466965_0033832 Ga0466965_0033832_1698_2285 167
488 3300044683 Ga0466965_0055085 Ga0466965_0055085_331_861 167
489 3300044684 Ga0466966_0009879 Ga0466966_0009879_1348_1869 167
490 3300044684 Ga0466966_0054544 Ga0466966_0054544_761_1264 167
491 3300044693 Ga0466961_0003461 Ga0466961_0003461_123_644 167
492 3300044693 Ga0466961_0064892 Ga0466961_0064892_425_928 167
493 3300044694 Ga0466963_0350852 Ga0466963_0350852_271_774 167
494 3300044719 Ga0466971_0004869 Ga0466971_0004869_4240_4743 167
495 3300044735 Ga0466968_0018298 Ga0466968_0018298_709_1212 167
496 3300044765 Ga0466970_0048224 Ga0466970_0048224_186_689 167
497 3300044842 Ga0466957_0002759 Ga0466957_0002759_8690_9205 167
498 3300044842 Ga0466957_0054291 Ga0466957_0054291_1780_2283 167
499 3300044901 Ga0466960_0129705 Ga0466960_0129705_124_645 167
500 3300044901 Ga0466960_0194625 Ga0466960_0194625_19_522 167
501 3300045049 Ga0466959_0003428 Ga0466959_0003428_2134_2637 167
502 3300045049 Ga0466959_0353027 Ga0466959_0353027_371_874 167
503 3300045836 Ga0466958_0000426 Ga0466958_0000426_12161_12676 167
504 3300045836 Ga0466958_0058732 Ga0466958_0058732_1124_1654 167
505 3300045976 Ga0466967_0034872 Ga0466967_0034872_2865_3368 167
506 3300045976 Ga0466967_0101111 Ga0466967_0101111_793_1305 167
507 3300048904 Ga0496101_0686727 Ga0496101_0686727_129_650 167
508 3300048905 Ga0496102_0061645 Ga0496102_0061645_1850_2353 167
509 3300048905 Ga0496102_0088114 Ga0496102_0088114_272_814 167
510 3300048905 Ga0496102_0247308 Ga0496102_0247308_1080_1583 167
511 3300048906 Ga0496103_0276427 Ga0496103_0276427_275_778 167
512 3300048910 Ga0496107_1061785 Ga0496107_1061785_51_554 167
513 3300048911 Ga0496108_0003142 Ga0496108_0003142_2909_3412 167
514 3300048911 Ga0496108_0029447 Ga0496108_0029447_404_910 167
515 3300048911 Ga0496108_0132426 Ga0496108_0132426_156_659 167
516 3300048912 Ga0496109_0025185 Ga0496109_0025185_362_865 167
517 3300048912 Ga0496109_0103544 Ga0496109_0103544_1650_2153 167
518 3300048913 Ga0496110_0024693 Ga0496110_0024693_4366_4869 167
519 3300048913 Ga0496110_0859347 Ga0496110_0859347_261_767 167
520 3300048915 Ga0496112_0031365 Ga0496112_0031365_3601_4104 167
521 3300048915 Ga0496112_0962588 Ga0496112_0962588_127_633 167
522 3300048916 Ga0496113_0439319 Ga0496113_0439319_212_715 167
523 3300048929 Ga0496126_0637948 Ga0496126_0637948_147_662 167
524 3300049570 Ga0501033_0184881 Ga0501033_0184881_942_1457 167
525 3300049571 Ga0501034_0001916 Ga0501034_0001916_14406_14921 167
526 3300049572 Ga0501036_0125486 Ga0501036_0125486_1428_1943 167
527 3300049580 Ga0501046_0001059 Ga0501046_0001059_16355_16870 167
528 3300049581 Ga0501047_0065743 Ga0501047_0065743_321_836 167
529 3300049582 Ga0501048_0001266 Ga0501048_0001266_9408_9923 167
530 3300049586 Ga0501070_0003494 Ga0501070_0003494_2887_3402 167
531 3300049586 Ga0501070_0063092 Ga0501070_0063092_2459_2986 167
532 3300049742 Ga0501080_0185499 Ga0501080_0185499_1242_1757 167
533 3300049822 Ga0501035_0010624 Ga0501035_0010624_2266_2781 167
534 3300049823 Ga0501044_0003155 Ga0501044_0003155_10357_10872 167
535 3300050489 nmdc:mga03683_172238_c1 nmdc:mga03683_172238_c1_395_898 167
536 3300050489 nmdc:mga03683_289524_c1 nmdc:mga03683_289524_c1_175_678 167
537 3300050490 nmdc:mga03n38_40813_c1 nmdc:mga03n38_40813_c1_1100_1606 167
538 3300050490 nmdc:mga03n38_5392_c1 nmdc:mga03n38_5392_c1_2504_3007 167
539 3300050490 nmdc:mga03n38_79072_c1 nmdc:mga03n38_79072_c1_265_768 167
540 3300050491 nmdc:mga00v17_377810_c1 nmdc:mga00v17_377810_c1_384_887 167
541 3300050491 nmdc:mga00v17_40525_c1 nmdc:mga00v17_40525_c1_1829_2332 167
542 3300050491 nmdc:mga00v17_508752_c1 nmdc:mga00v17_508752_c1_203_706 167
543 3300050492 nmdc:mga0yw44_25132_c1 nmdc:mga0yw44_25132_c1_1554_2057 167
544 3300050492 nmdc:mga0yw44_82326_c1 nmdc:mga0yw44_82326_c1_262_765 167
545 3300050493 nmdc:mga0k408_192506_c1 nmdc:mga0k408_192506_c1_266_769 167
546 3300050494 nmdc:mga06z11_284150_c1 nmdc:mga06z11_284150_c1_316_819 167
547 3300050495 nmdc:mga04h51_13643_c1 nmdc:mga04h51_13643_c1_1168_1671 167
548 3300050496 nmdc:mga07m45_208081_c1 nmdc:mga07m45_208081_c1_559_1062 167
549 3300050496 nmdc:mga07m45_2264_c1 nmdc:mga07m45_2264_c1_6691_7194 167
550 3300050516 nmdc:mga0sz30_117165_c1 nmdc:mga0sz30_117165_c1_459_962 167
551 3300050516 nmdc:mga0sz30_175738_c1 nmdc:mga0sz30_175738_c1_136_639 167
552 3300050516 nmdc:mga0sz30_32052_c2 nmdc:mga0sz30_32052_c2_414_926 167
553 3300053083 Ga0495655_0101393 Ga0495655_0101393_172_675 167
554 3300061719 Ga0466962_0043677 Ga0466962_0043677_827_1330 167
555 iso_pu_bacteria 2731639228 2731908240 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

13

164

0.94

PF00149

Metallophos

Calcineurin-like phosphoesterase

13

100

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8232 2 163
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.8228 1 163
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8225 1 163
5w8m-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.819 2 163
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8095 2 163
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8811 1 161 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8706 1 161 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8438 1 164 3.60.21.10
af_Q4DWH1_2_191_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8356 1 151 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8252 1 164 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1I0DSY4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9968 1 165 GO:0016787
GO:0046872
AF-A0A656L2G3-F1-model_v4 deleted 0.9954 1 62
AF-A0A6J4JPC8-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9949 1 165 GO:0016787
GO:0046872
AF-A0A7X5ZFR9-F1-model_v4 Putative phosphoesterase 0.9947 56 163
AF-A0A561T8E7-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.994 1 166 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map