F463101

General Info

Members Datasets Scaffolds Average Seq Length
555 462 285 336

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000071|Ga0105237_10000071134
Length 339
Sequence MTIKFAAIGINHNHIYGQVDCLLREGAEFVAFHAVEDDLAKTFSAKYPQAKRVADRREILEDKTIPLVLTSAIPGDRAEIAATAMRHGKDVMSDKPGMTTLDDLRTLRHVQAETGRIYSVLYSEHLETRSTVKAGELVKAGAIGEVIHTVGLGPHRIGNYGTRPAWFYERSRYGGILCDIASHQCEQFLFFANTLDVEVISATVANRAHPETPGLQDFGDIHFRAPNATGYVRIDWFTPDGLPTWGDGRLTILGTEGYIELRKYVDIAGRPGTDHLLMVDKQGMHYIDTKSVDLPYGRQLIADVLNRTETAMSQAHCFKAMELALNAQAFAERNLGSAK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
14 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
15 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
25 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
26 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
27 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
28 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
29 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
32 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
35 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
36 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
37 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
38 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
39 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
40 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
41 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
42 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
43 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
44 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
45 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
46 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
47 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
48 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
49 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
50 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
51 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
52 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
53 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
54 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
55 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
56 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
57 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
58 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
59 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
60 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
61 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
62 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
63 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
64 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
65 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
66 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
67 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
68 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
69 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
70 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
71 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
72 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
73 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
74 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
75 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
76 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
77 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
78 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
79 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
80 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
81 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
82 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
83 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
84 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
85 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
86 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
87 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
88 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
89 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
90 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
91 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
92 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
93 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
94 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
95 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
96 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
97 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
98 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
99 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
100 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
101 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
102 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
103 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
104 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
105 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
106 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
107 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
108 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
109 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
110 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
111 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
112 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
113 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
114 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
115 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
116 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
117 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
118 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
119 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
120 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
121 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
122 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
123 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
124 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
125 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
126 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
127 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
128 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
129 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
130 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
131 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
132 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
133 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
134 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
135 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
136 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
137 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
138 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
139 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
140 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
141 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
142 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
143 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
144 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
145 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
146 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
147 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
148 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
149 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
150 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
151 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
152 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
153 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
154 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
155 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
156 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
157 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
158 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
159 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
160 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
161 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
162 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
163 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
164 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
165 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
166 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
167 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
168 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
169 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
170 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
171 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
172 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
173 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
174 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
175 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
176 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
177 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
178 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
179 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
180 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
181 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
182 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
183 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
184 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
185 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
186 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
187 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
188 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
189 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
190 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
191 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
192 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
193 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
194 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
195 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
196 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
197 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
198 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
199 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
200 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
201 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
202 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
203 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
204 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
205 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
206 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
207 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
208 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
209 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
210 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
211 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
212 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
213 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
214 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
215 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
216 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
217 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
218 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
219 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
220 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
221 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
222 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
223 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
224 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
225 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
226 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
227 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
228 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
229 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
230 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
231 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
232 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
233 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
234 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
235 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
236 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
237 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
238 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
239 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
240 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
241 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
242 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
243 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
244 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
245 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
246 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
247 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
248 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
249 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
250 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
251 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
252 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
253 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
254 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
255 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
256 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
257 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
258 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
259 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
260 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
261 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
262 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
263 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
264 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
265 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
266 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
267 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
268 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
269 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
270 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
271 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
272 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
273 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
274 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
275 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
276 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
277 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
278 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
279 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
280 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
281 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
282 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
283 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
284 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
285 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
286 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
287 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
288 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
289 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
290 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
291 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
292 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
293 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
294 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
295 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
296 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
297 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
298 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
299 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
300 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
301 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
302 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
303 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
304 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
305 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
306 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
307 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
308 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
309 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
310 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
314 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
315 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
316 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
317 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
318 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
319 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
320 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
321 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
322 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
323 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
324 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
325 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
326 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
327 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
328 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
329 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
332 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
333 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
334 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
337 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
338 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
340 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
341 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
342 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
365 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
367 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
370 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
371 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
372 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
373 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
374 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
375 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
376 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
377 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
378 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
379 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
380 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
381 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
382 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
383 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
384 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
385 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
386 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
387 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
388 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
389 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
392 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
393 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
394 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
395 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
398 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
406 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
407 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
431 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
439 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
440 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
441 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
442 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
443 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
444 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
445 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
446 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
450 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
451 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
452 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
453 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
454 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
455 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
456 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
457 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
458 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
459 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
460 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
461 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
462 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.81
Metatranscriptomes 0.54
Isolates 48.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.27
Nodule 42.88
Rhizoplane 1.62
Rhizosphere 32.43
Stem 0
Stem Tuber 0
Unclassified 12.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004883 3300001979 Bacteria 5704
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1001203 3300002737 Bacteria 15095
6 JGI25162J39368_1002942 3300002737 Bacteria 5755
7 JGI25154J39366_1000026 3300002738 Bacteria 200613
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25159J45721_1000242 3300002987 Bacteria 25793
10 JGI25165J46597_1001246 3300003214 Bacteria 15061
11 JGI25165J46597_1002528 3300003214 Bacteria 5747
12 JGI25165J46597_1004954 3300003214 Bacteria 2683
13 JGI25165J46597_1005731 3300003214 Bacteria 2330
14 rootH2_10015183 3300003320 Bacteria 2704
15 rootL2_10112950 3300003322 Bacteria 7748
16 JGI25160J50197_1000022 3300003354 Bacteria 201071
17 JGI25161J50226_1000024 3300003374 Bacteria 152176
18 Ga0055543_1000025 3300004625 Bacteria 137886
19 Ga0065165_1000200 3300005262 Bacteria 103564
20 Ga0065165_1001369 3300005262 Bacteria 26829
21 Ga0070658_10060193 3300005327 Bacteria 3092
22 Ga0070658_10084054 3300005327 Bacteria 2617
23 Ga0070658_10086291 3300005327 Bacteria 2582
24 Ga0070683_100184840 3300005329 Bacteria 1979
25 Ga0070660_100001762 3300005339 Bacteria 14850
26 Ga0070689_100126867 3300005340 Bacteria 2043
27 Ga0070661_100023850 3300005344 Bacteria 4388
28 Ga0070668_100046535 3300005347 Bacteria 3332
29 Ga0070668_100098310 3300005347 Bacteria 2316
30 Ga0070671_100057348 3300005355 Bacteria 3240
31 Ga0070674_100005304 3300005356 Bacteria 7427
32 Ga0070673_100063157 3300005364 Bacteria 2946
33 Ga0070708_100168370 3300005445 Bacteria 2044
34 Ga0070708_100318973 3300005445 Bacteria 1464
35 Ga0070663_100067848 3300005455 Bacteria 2588
36 Ga0070662_100260387 3300005457 Bacteria 1397
37 Ga0070681_10442428 3300005458 Bacteria 1212
38 Ga0070706_100097806 3300005467 Bacteria 2726
39 Ga0070707_100152816 3300005468 Bacteria 2247
40 Ga0070699_100062171 3300005518 Bacteria 3236
41 Ga0070684_100361619 3300005535 Bacteria 1336
42 Ga0070697_100091215 3300005536 Bacteria 2519
43 Ga0068853_100064264 3300005539 Bacteria 3181
44 Ga0068853_100286784 3300005539 Bacteria 1519
45 Ga0070693_100285953 3300005547 Bacteria 1106
46 Ga0068855_100174023 3300005563 Bacteria 2437
47 Ga0068855_100446575 3300005563 Bacteria 1412
48 Ga0068857_100219393 3300005577 Bacteria 1737
49 Ga0068854_100156977 3300005578 Bacteria 1759
50 Ga0068856_100008285 3300005614 Bacteria 10132
51 Ga0068856_100093394 3300005614 Bacteria 2994
52 Ga0068856_100176054 3300005614 Bacteria 2151
53 Ga0068852_100002107 3300005616 Bacteria 13607
54 Ga0068852_100006927 3300005616 Bacteria 8245
55 Ga0068852_100010073 3300005616 Bacteria 7035
56 Ga0075368_10011992 3300006042 Bacteria 3163
57 Ga0075363_100017783 3300006048 Bacteria 3531
58 Ga0075363_100026662 3300006048 Bacteria 2957
59 Ga0075364_10019248 3300006051 Bacteria 4283
60 Ga0075364_10075249 3300006051 Bacteria 2228
61 Ga0075362_10018813 3300006177 Bacteria 2863
62 Ga0075367_10010227 3300006178 Bacteria 4922
63 Ga0075367_10031396 3300006178 Bacteria 3050
64 Ga0075367_10139196 3300006178 Bacteria 1503
65 Ga0075369_10036958 3300006186 Bacteria 2079
66 Ga0075366_10041375 3300006195 Bacteria 2728
67 Ga0075370_10000790 3300006353 Bacteria 12649
68 Ga0075370_10010473 3300006353 Bacteria 4848
69 Ga0075370_10058160 3300006353 Bacteria 2199
70 Ga0105240_10000013 3300009093 Bacteria 483458
71 Ga0105240_10007818 3300009093 Bacteria 15442
72 Ga0105240_10081019 3300009093 Bacteria 3990
73 Ga0105247_10009605 3300009101 Bacteria 5871
74 Ga0105243_10072373 3300009148 Bacteria 2790
75 Ga0105241_10042714 3300009174 Bacteria 3432
76 Ga0105237_10000071 3300009545 Bacteria 135695
77 Ga0105237_10002420 3300009545 Bacteria 23173
78 Ga0105237_10016814 3300009545 Bacteria 7593
79 Ga0105237_10246576 3300009545 Bacteria 1788
80 Ga0105238_10043265 3300009551 Bacteria 4557
81 Ga0105238_10051937 3300009551 Bacteria 4122
82 Ga0105238_10116700 3300009551 Bacteria 2649
83 Ga0105239_10000768 3300010375 Bacteria 45353
84 Ga0105239_10001189 3300010375 Bacteria 35605
85 Ga0105239_10078512 3300010375 Bacteria 3633
86 Ga0105239_10177357 3300010375 Bacteria 2383
87 Ga0105239_10263365 3300010375 Bacteria 1938
88 Ga0157371_10015320 3300013102 Bacteria 5756
89 Ga0157371_10318466 3300013102 Bacteria 1128
90 Ga0157370_10003431 3300013104 Bacteria 18611
91 Ga0157370_10072323 3300013104 Bacteria 3254
92 Ga0157370_10127403 3300013104 Bacteria 2376
93 Ga0157369_10002596 3300013105 Bacteria 21609
94 Ga0157369_10064646 3300013105 Bacteria 3939
95 Ga0157369_10098498 3300013105 Bacteria 3118
96 Ga0157374_10040993 3300013296 Bacteria 4264
97 Ga0163162_10068227 3300013306 Bacteria 3607
98 Ga0157372_10052860 3300013307 Bacteria 4526
99 Ga0157372_10203520 3300013307 Bacteria 2293
100 Ga0157380_10448393 3300014326 Bacteria 1238
101 Ga0182008_10053008 3300014497 Bacteria 2009
102 Ga0182007_10006551 3300015262 Bacteria 4991
103 Ga0182005_1001647 3300015265 Bacteria 8685
104 Ga0214544_1000771 3300021320 Bacteria 61917
105 Ga0214542_1000032 3300021321 Bacteria 171690
106 Ga0214543_1000016 3300021327 Bacteria 295257
107 Ga0214543_1009269 3300021327 Bacteria 15462
108 Ga0213876_10004601 3300021384 Bacteria 7691
109 Ga0213875_10001344 3300021388 Bacteria 16189
110 Ga0228711_1000006 3300022739 Bacteria 202437
111 Ga0228710_1000004 3300022740 Bacteria 250560
112 Ga0209435_100009 3300025206 Bacteria 476614
113 Ga0209760_101814 3300025207 Bacteria 2118
114 Ga0209672_102531 3300025228 Bacteria 4406
115 Ga0209437_100057 3300025233 Bacteria 362922
116 Ga0209437_100772 3300025233 Bacteria 15151
117 Ga0209646_1000018 3300025246 Bacteria 476716
118 Ga0209026_1000043 3300025250 Bacteria 269142
119 Ga0209677_100426 3300025253 Bacteria 25046
120 Ga0209148_1000305 3300025254 Bacteria 70375
121 Ga0209759_1000007 3300025256 Bacteria 476614
122 Ga0209233_1000130 3300025261 Bacteria 205687
123 Ga0209233_1000255 3300025261 Bacteria 82230
124 Ga0209233_1000290 3300025261 Bacteria 64394
125 Ga0209233_1000332 3300025261 Bacteria 48225
126 Ga0209455_1006533 3300025272 Bacteria 3427
127 Ga0209130_1000164 3300025284 Bacteria 97595
128 Ga0209758_1003392 3300025297 Bacteria 14554
129 Ga0207426_1000082 3300025302 Bacteria 298939
130 Ga0209051_1048728 3300025303 Bacteria 1433
131 Ga0209257_1014939 3300025304 Bacteria 3282
132 Ga0207688_10010706 3300025901 Bacteria 4991
133 Ga0207647_10019341 3300025904 Bacteria 4582
134 Ga0207705_10002602 3300025909 Bacteria 13868
135 Ga0207705_10048317 3300025909 Bacteria 3060
136 Ga0207684_10051423 3300025910 Bacteria 3496
137 Ga0207695_10000044 3300025913 Bacteria 440819
138 Ga0207695_10000136 3300025913 Bacteria 217596
139 Ga0207695_10029206 3300025913 Bacteria 6099
140 Ga0207671_10000043 3300025914 Bacteria 206915
141 Ga0207671_10000099 3300025914 Bacteria 132378
142 Ga0207671_10005950 3300025914 Bacteria 11056
143 Ga0207657_10003030 3300025919 Bacteria 17989
144 Ga0207657_10004936 3300025919 Bacteria 14029
145 Ga0207649_10052297 3300025920 Bacteria 2534
146 Ga0207681_10249218 3300025923 Bacteria 1386
147 Ga0207659_10309527 3300025926 Bacteria 1300
148 Ga0207706_10301123 3300025933 Bacteria 1397
149 Ga0207669_10022958 3300025937 Bacteria 3323
150 Ga0207667_10032885 3300025949 Bacteria 5582
151 Ga0207667_10118010 3300025949 Bacteria 2734
152 Ga0207667_10348850 3300025949 Bacteria 1510
153 Ga0207668_10055163 3300025972 Bacteria 2761
154 Ga0207658_10302554 3300025986 Bacteria 1378
155 Ga0207703_10048242 3300026035 Bacteria 3437
156 Ga0207678_10040377 3300026067 Bacteria 4048
157 Ga0207702_10006190 3300026078 Bacteria 10352
158 Ga0207702_10017912 3300026078 Bacteria 5861
159 Ga0207702_10038032 3300026078 Bacteria 4031
160 Ga0207674_10052495 3300026116 Bacteria 4158
161 Ga0207674_10057790 3300026116 Bacteria 3932
162 Ga0207674_10071212 3300026116 Bacteria 3494
163 Ga0207698_10007021 3300026142 Bacteria 7054
164 Ga0209281_1000102 3300027111 Bacteria 221665
165 Ga0209281_1000563 3300027111 Bacteria 44757
166 Ga0209371_1001347 3300027312 Bacteria 17020
167 Ga0209282_1000013 3300027666 Bacteria 215053
168 Ga0268266_10000391 3300028379 Bacteria 66400
169 Ga0268266_10441988 3300028379 Bacteria 1235
170 Ga0268264_10227754 3300028381 Bacteria 1719
171 Ga0265319_1027112 3300028563 Bacteria 2036
172 Ga0265318_10018314 3300028577 Bacteria 2859
173 Ga0268256_1001200 3300030500 Bacteria 16565
174 Ga0265313_10026406 3300031595 Bacteria 3059
175 Ga0265314_10070836 3300031711 Bacteria 2335
176 Ga0265342_10073275 3300031712 Bacteria 1992
177 Ga0307410_10068086 3300031852 Bacteria 2458
178 Ga0307407_10181450 3300031903 Bacteria 1395
179 Ga0315914_1000004 3300031967 Bacteria 288534
180 Ga0315913_1000055 3300033430 Bacteria 58182
181 Ga0315915_1000003 3300033464 Bacteria 407996
182 Ga0436364_0617972 3300037853 Bacteria 7054
183 Ga0436364_0740264 3300037853 Bacteria 4806
184 Ga0395901_0166681 3300038443 Bacteria 2313
185 Ga0395901_0411347 3300038443 Bacteria 1388
186 Ga0436365_0364034 3300039437 Bacteria 67701
187 Ga0436365_1078535 3300039437 Bacteria 2251
188 Ga0436365_1424493 3300039437 Bacteria 16000
189 Ga0436363_0239262 3300039450 Bacteria 9304
190 Ga0436362_0362206 3300039453 Bacteria 4670
191 Ga0439453_0005659 3300041408 Bacteria 1911
192 Ga0439460_0062895 3300042461 Bacteria 1136
193 Ga0495629_0124561 3300046459 Bacteria 1795
194 Ga0495651_0087919 3300046462 Bacteria 2336
195 Ga0495651_0234875 3300046462 Bacteria 1261
196 Ga0495662_0015516 3300046476 Bacteria 3697
197 Ga0495606_0018190 3300046507 Bacteria 5280
198 Ga0495618_0109362 3300046514 Bacteria 1770
199 Ga0495628_0294263 3300046516 Bacteria 1203
200 Ga0495631_0114636 3300046518 Bacteria 1159
201 Ga0495643_0027200 3300046522 Bacteria 3217
202 Ga0495597_0019632 3300046542 Bacteria 3159
203 Ga0495667_0028344 3300046559 Bacteria 3771
204 Ga0495668_0083467 3300046616 Bacteria 1752
205 Ga0495635_0084705 3300046663 Bacteria 2169
206 Ga0495600_0070586 3300046809 Bacteria 2282
207 Ga0495604_0002107 3300047317 Bacteria 16015
208 Ga0495604_0054994 3300047317 Bacteria 3069
209 Ga0495680_0172752 3300047322 Bacteria 1564
210 Ga0495687_017499 3300047443 Bacteria 3573
211 Ga0495673_0022613 3300047469 Bacteria 3078
212 Ga0495686_0017404 3300047472 Bacteria 4845
213 Ga0496101_0033647 3300048904 Bacteria 3616
214 Ga0496102_0033995 3300048905 Bacteria 4585
215 Ga0496103_0025893 3300048906 Bacteria 3548
216 Ga0496105_0006351 3300048908 Bacteria 9079
217 Ga0496110_0164525 3300048913 Bacteria 2011
218 Ga0496111_0063727 3300048914 Bacteria 2673
219 Ga0496113_0037943 3300048916 Bacteria 3539
220 Ga0496117_0010475 3300048920 Bacteria 8443
221 Ga0496117_0094212 3300048920 Bacteria 1917
222 Ga0496118_0027736 3300048921 Bacteria 4784
223 Ga0496118_0028305 3300048921 Bacteria 4723
224 Ga0496118_0043304 3300048921 Bacteria 3541
225 Ga0496119_0010899 3300048922 Bacteria 7594
226 Ga0496119_0017387 3300048922 Bacteria 5409
227 Ga0496119_0036900 3300048922 Bacteria 3183
228 Ga0496119_0049024 3300048922 Bacteria 2614
229 Ga0496120_0023067 3300048923 Bacteria 3900
230 Ga0496121_0000005 3300048924 Bacteria 1034486
231 Ga0496121_0002070 3300048924 Bacteria 31759
232 Ga0496121_0013681 3300048924 Bacteria 8698
233 Ga0496121_0041492 3300048924 Bacteria 4020
234 Ga0496121_0107002 3300048924 Bacteria 2143
235 Ga0496122_0002236 3300048925 Bacteria 28136
236 Ga0496122_0185919 3300048925 Bacteria 1232
237 Ga0496123_0121495 3300048926 Bacteria 1468
238 Ga0496124_0000080 3300048927 Bacteria 210439
239 Ga0496124_0042053 3300048927 Bacteria 3936
240 Ga0496124_0184450 3300048927 Bacteria 1602
241 Ga0496125_0000159 3300048928 Bacteria 151205
242 Ga0496125_0188182 3300048928 Bacteria 1366
243 Ga0496126_0093405 3300048929 Bacteria 2641
244 Ga0501031_0033902 3300049568 Bacteria 3332
245 Ga0501032_0019351 3300049569 Bacteria 4763
246 Ga0501034_0027120 3300049571 Bacteria 5827
247 Ga0501034_0129124 3300049571 Bacteria 2511
248 Ga0501034_0161748 3300049571 Bacteria 2209
249 Ga0501034_0228500 3300049571 Bacteria 1811
250 Ga0501034_0484805 3300049571 Bacteria 1151
251 Ga0501034_0539117 3300049571 Bacteria 1077
252 Ga0501036_0021649 3300049572 Bacteria 5405
253 Ga0501037_0007341 3300049573 Bacteria 8060
254 Ga0501037_0069416 3300049573 Bacteria 2565
255 Ga0501039_0144456 3300049575 Bacteria 1869
256 Ga0501046_0159088 3300049580 Bacteria 1700
257 Ga0501070_0019852 3300049586 Bacteria 5635
258 Ga0501070_0050474 3300049586 Bacteria 3454
259 Ga0501070_0143260 3300049586 Bacteria 1973
260 Ga0501073_0062913 3300049589 Bacteria 2588
261 Ga0501080_0251753 3300049742 Bacteria 1611
262 Ga0501035_0020842 3300049822 Bacteria 6023
263 Ga0501044_0026318 3300049823 Bacteria 6160
264 Ga0501044_0133775 3300049823 Bacteria 2472
265 Ga0501044_0424568 3300049823 Bacteria 1239
266 nmdc:mga03n38_141975_c1 3300050490 Bacteria 1200
267 nmdc:mga00v17_20380_c1 3300050491 Bacteria 3798
268 nmdc:mga06z11_12978_c1 3300050494 Bacteria 3641
269 nmdc:mga06z11_17450_c1 3300050494 Bacteria 3258
270 Ga0495619_0054853 3300053085 Bacteria 2639
271 Ga0500595_000538 3300053119 Bacteria 22785
272 Ga0500595_023410 3300053119 Bacteria 2171
273 Ga0500607_090115 3300053121 Bacteria 1545
274 Ga0500642_0034259 3300053130 Bacteria 2147
275 Ga0500573_0031120 3300053140 Bacteria 3079
276 Ga0500573_0076715 3300053140 Bacteria 1902
277 Ga0500577_0149153 3300053142 Bacteria 991
278 Ga0500588_0008325 3300053146 Bacteria 2419
279 Ga0500590_071848 3300053148 Bacteria 1717
280 Ga0500636_0000011 3300053177 Bacteria 140769
281 Ga0500636_0000283 3300053177 Bacteria 28087
282 Ga0587073_0008905 3300059492 Bacteria 1640
283 Ga0587083_0006610 3300059505 Bacteria 1735
284 Ga0587106_000487 3300059605 Bacteria 2796
285 Ga0466962_0077681 3300061719 Bacteria 1587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053142 Ga0500577_0149153 Ga0500577_0149153_71_934 287
2 3300025923 Ga0207681_10249218 Ga0207681_102492182 293
3 3300031903 Ga0307407_10181450 Ga0307407_101814502 314
4 3300005340 Ga0070689_100126867 Ga0070689_1001268672 318
5 3300053140 Ga0500573_0076715 Ga0500573_0076715_11_967 318
6 3300031852 Ga0307410_10068086 Ga0307410_100680862 319
7 3300005445 Ga0070708_100168370 Ga0070708_1001683702 321
8 3300005467 Ga0070706_100097806 Ga0070706_1000978063 321
9 3300005468 Ga0070707_100152816 Ga0070707_1001528163 321
10 3300005518 Ga0070699_100062171 Ga0070699_1000621713 321
11 3300005536 Ga0070697_100091215 Ga0070697_1000912151 321
12 3300025910 Ga0207684_10051423 Ga0207684_100514232 321
13 3300048924 Ga0496121_0041492 Ga0496121_0041492_534_1550 324
14 3300009148 Ga0105243_10072373 Ga0105243_100723733 329
15 3300025901 Ga0207688_10010706 Ga0207688_100107064 329
16 iso_pu_bacteria 2513237094 2513641468 331
17 3300049586 Ga0501070_0143260 Ga0501070_0143260_253_1251 332
18 3300049589 Ga0501073_0062913 Ga0501073_0062913_860_1858 332
19 iso_pu_bacteria 2894817345 2894818902 332
20 3300025926 Ga0207659_10309527 Ga0207659_103095271 333
21 3300042461 Ga0439460_0062895 Ga0439460_0062895_61_1062 333
22 iso_pu_bacteria 2558860983 2561467603 333
23 iso_pu_bacteria 2838074704 2838075795 333
24 iso_pu_bacteria 2929138655 2929142967 333
25 3300005445 Ga0070708_100318973 Ga0070708_1003189732 334
26 3300006048 Ga0075363_100026662 Ga0075363_1000266623 334
27 3300006051 Ga0075364_10019248 Ga0075364_100192482 334
28 3300006353 Ga0075370_10058160 Ga0075370_100581602 334
29 3300014326 Ga0157380_10448393 Ga0157380_104483931 334
30 3300049823 Ga0501044_0133775 Ga0501044_0133775_143_1147 334
31 3300050494 nmdc:mga06z11_17450_c1 nmdc:mga06z11_17450_c1_2220_3224 334
32 iso_pu_bacteria 2509276019 2509379499 334
33 iso_pu_bacteria 2510065057 2510307140 334
34 iso_pu_bacteria 2511231052 2511498713 334
35 iso_pu_bacteria 2512047086 2512534850 334
36 iso_pu_bacteria 2512875026 2512973322 334
37 iso_pu_bacteria 2513237086 2513587033 334
38 iso_pu_bacteria 2513237089 2513603677 334
39 iso_pu_bacteria 2513237091 2513619445 334
40 iso_pu_bacteria 2513237140 2513886043 334
41 iso_pu_bacteria 2513237143 2513904381 334
42 iso_pu_bacteria 2513237156 2513983385 334
43 iso_pu_bacteria 2513237160 2514005917 334
44 iso_pu_bacteria 2515154107 2515607153 334
45 iso_pu_bacteria 2516143018 2516208011 334
46 iso_pu_bacteria 2516653046 2516894990 334
47 iso_pu_bacteria 2517487022 2517571675 334
48 iso_pu_bacteria 2524023207 2524452596 334
49 iso_pu_bacteria 2551306084 2551675565 334
50 iso_pu_bacteria 2551306085 2551685320 334
51 iso_pu_bacteria 2551306086 2551693961 334
52 iso_pu_bacteria 2551306087 2551698094 334
53 iso_pu_bacteria 2551306090 2551716946 334
54 iso_pu_bacteria 2551306091 2551728265 334
55 iso_pu_bacteria 2551306091 2551728570 334
56 iso_pu_bacteria 2558860100 2558867608 334
57 iso_pu_bacteria 2657244999 2657684932 334
58 iso_pu_bacteria 2690316117 2692319029 334
59 iso_pu_bacteria 2751185821 2753463606 334
60 iso_pu_bacteria 2791355091 2792621649 334
61 iso_pu_bacteria 2791355092 2792627666 334
62 iso_pu_bacteria 2791355094 2792640379 334
63 iso_pu_bacteria 2802428858 2802721251 334
64 iso_pu_bacteria 2802428859 2802724564 334
65 iso_pu_bacteria 2802428860 2802729769 334
66 iso_pu_bacteria 2802428861 2802737115 334
67 iso_pu_bacteria 2802428862 2802746872 334
68 iso_pu_bacteria 2802428863 2802751732 334
69 iso_pu_bacteria 2802429268 2804755717 334
70 iso_pu_bacteria 2840764183 2840768349 334
71 iso_pu_bacteria 2847417321 2847422471 334
72 iso_pu_bacteria 2848992105 2848998120 334
73 iso_pu_bacteria 2850079185 2850079281 334
74 iso_pu_bacteria 2855825444 2855827625 334
75 iso_pu_bacteria 2855839649 2855843001 334
76 iso_pu_bacteria 2855872281 2855875808 334
77 iso_pu_bacteria 2858800743 2858801956 334
78 iso_pu_bacteria 2896384573 2896388244 334
79 iso_pu_bacteria 2913295892 2913296237 334
80 iso_pu_bacteria 2915980308 2915983212 334
81 iso_pu_bacteria 2915986958 2915991693 334
82 iso_pu_bacteria 2915993759 2915998939 334
83 iso_pu_bacteria 2916000859 2916002890 334
84 iso_pu_bacteria 2916007675 2916011232 334
85 iso_pu_bacteria 2916014648 2916018748 334
86 iso_pu_bacteria 2916021584 2916025408 334
87 iso_pu_bacteria 2916028427 2916032218 334
88 iso_pu_bacteria 2916035215 2916038115 334
89 iso_pu_bacteria 2916041962 2916042359 334
90 iso_pu_bacteria 2916048683 2916050084 334
91 iso_pu_bacteria 2916055098 2916059012 334
92 iso_pu_bacteria 2916061851 2916063523 334
93 iso_pu_bacteria 2916068649 2916075086 334
94 iso_pu_bacteria 2916076590 2916078505 334
95 iso_pu_bacteria 2920760137 2920764353 334
96 iso_pu_bacteria 2921201388 2921206387 334
97 iso_pu_bacteria 2921208531 2921211243 334
98 iso_pu_bacteria 2921237296 2921241209 334
99 iso_pu_bacteria 2921244191 2921249361 334
100 iso_pu_bacteria 2921250672 2921256208 334
101 iso_pu_bacteria 2921257292 2921258747 334
102 iso_pu_bacteria 2921263974 2921268226 334
103 iso_pu_bacteria 2921282425 2921285263 334
104 iso_pu_bacteria 2921289301 2921293419 334
105 iso_pu_bacteria 2921296804 2921301114 334
106 iso_pu_bacteria 2924144063 2924147845 334
107 iso_pu_bacteria 2924150972 2924151908 334
108 iso_pu_bacteria 2924158325 2924163294 334
109 iso_pu_bacteria 2924165586 2924171101 334
110 iso_pu_bacteria 2924172951 2924178486 334
111 iso_pu_bacteria 2924179722 2924185001 334
112 iso_pu_bacteria 2924186466 2924192106 334
113 iso_pu_bacteria 2924193448 2924196287 334
114 iso_pu_bacteria 2924200457 2924203997 334
115 iso_pu_bacteria 2924207177 2924210663 334
116 iso_pu_bacteria 2924214083 2924219967 334
117 iso_pu_bacteria 2924221636 2924225549 334
118 iso_pu_bacteria 2924228884 2924232393 334
119 iso_pu_bacteria 2936996657 2936998860 334
120 iso_pu_bacteria 2937009748 2937013263 334
121 iso_pu_bacteria 2937016420 2937019953 334
122 iso_pu_bacteria 2937023124 2937025549 334
123 iso_pu_bacteria 2937029754 2937032509 334
124 iso_pu_bacteria 2937036028 2937039172 334
125 iso_pu_bacteria 2937042894 2937043220 334
126 iso_pu_bacteria 2937049772 2937053157 334
127 iso_pu_bacteria 2937056579 2937061973 334
128 iso_pu_bacteria 2937063883 2937065707 334
129 iso_pu_bacteria 2937071275 2937075754 334
130 iso_pu_bacteria 2937078374 2937084043 334
131 iso_pu_bacteria 2937084907 2937087344 334
132 iso_pu_bacteria 2937091812 2937097659 334
133 iso_pu_bacteria 2937106411 2937111197 334
134 iso_pu_bacteria 2937113482 2937115944 334
135 iso_pu_bacteria 2937119839 2937123512 334
136 iso_pu_bacteria 2937126314 2937129165 334
137 iso_pu_bacteria 2957375807 2957378137 334
138 iso_pu_bacteria 2957382221 2957386327 334
139 iso_pu_bacteria 2957388812 2957392678 334
140 iso_pu_bacteria 2957395598 2957401631 334
141 iso_pu_bacteria 2957402308 2957404962 334
142 iso_pu_bacteria 2957408893 2957411937 334
143 iso_pu_bacteria 2957415311 2957417141 334
144 iso_pu_bacteria 2957422303 2957427987 334
145 iso_pu_bacteria 2957430029 2957433003 334
146 iso_pu_bacteria 2957437181 2957439244 334
147 iso_pu_bacteria 2957443900 2957446578 334
148 iso_pu_bacteria 2957450854 2957455829 334
149 iso_pu_bacteria 2957457609 2957461203 334
150 iso_pu_bacteria 2957464669 2957467687 334
151 iso_pu_bacteria 2957471148 2957471794 334
152 iso_pu_bacteria 2957478035 2957483179 334
153 iso_pu_bacteria 2957484790 2957486980 334
154 iso_pu_bacteria 2957491536 2957493850 334
155 iso_pu_bacteria 2957498199 2957502330 334
156 iso_pu_bacteria 2957505466 2957506289 334
157 iso_pu_bacteria 2960584000 2960587201 334
158 iso_pu_bacteria 2960591022 2960593048 334
159 iso_pu_bacteria 2960597568 2960601179 334
160 iso_pu_bacteria 2960603979 2960608168 334
161 iso_pu_bacteria 2960610863 2960612272 334
162 iso_pu_bacteria 2960617483 2960620259 334
163 iso_pu_bacteria 2960624210 2960626012 334
164 iso_pu_bacteria 2960631154 2960635493 334
165 iso_pu_bacteria 2960637947 2960643897 334
166 iso_pu_bacteria 2960645483 2960651958 334
167 iso_pu_bacteria 2960652885 2960655942 334
168 iso_pu_bacteria 2960660292 2960663089 334
169 iso_pu_bacteria 2960667422 2960671324 334
170 iso_pu_bacteria 2960674078 2960678033 334
171 iso_pu_bacteria 2960680706 2960683818 334
172 iso_pu_bacteria 2960687367 2960689233 334
173 iso_pu_bacteria 2960693952 2960697052 334
174 iso_pu_bacteria 2964607997 2964613679 334
175 iso_pu_bacteria 2964615318 2964616375 334
176 iso_pu_bacteria 2964621998 2964625349 334
177 iso_pu_bacteria 2964628898 2964632049 334
178 iso_pu_bacteria 2964636051 2964640466 334
179 iso_pu_bacteria 2964643177 2964647370 334
180 iso_pu_bacteria 2964649959 2964653744 334
181 iso_pu_bacteria 2964656573 2964662411 334
182 iso_pu_bacteria 2964663802 2964667430 334
183 iso_pu_bacteria 2964670856 2964676281 334
184 iso_pu_bacteria 2964678106 2964684970 334
185 iso_pu_bacteria 2964685014 2964687821 334
186 iso_pu_bacteria 2964691889 2964695720 334
187 iso_pu_bacteria 2964698721 2964702356 334
188 iso_pu_bacteria 2964705432 2964708146 334
189 iso_pu_bacteria 2964712639 2964717426 334
190 iso_pu_bacteria 2964719344 2964722582 334
191 iso_pu_bacteria 2967664464 2967669728 334
192 iso_pu_bacteria 2967671571 2967675226 334
193 iso_pu_bacteria 2967678726 2967684289 334
194 iso_pu_bacteria 2967686174 2967688333 334
195 iso_pu_bacteria 2967693043 2967695756 334
196 iso_pu_bacteria 2967699805 2967700217 334
197 iso_pu_bacteria 2967706974 2967711264 334
198 iso_pu_bacteria 2967714385 2967719507 334
199 iso_pu_bacteria 2967721400 2967727576 334
200 iso_pu_bacteria 2967728569 2967733934 334
201 iso_pu_bacteria 2967735183 2967738583 334
202 iso_pu_bacteria 2967742019 2967747575 334
203 iso_pu_bacteria 2967748971 2967752888 334
204 iso_pu_bacteria 2967755722 2967756437 334
205 iso_pu_bacteria 2967762386 2967765331 334
206 iso_pu_bacteria 2967769361 2967773031 334
207 iso_pu_bacteria 2967775926 2967781435 334
208 iso_pu_bacteria 2970019648 2970025355 334
209 iso_pu_bacteria 2970026789 2970028824 334
210 iso_pu_bacteria 2970033650 2970038098 334
211 iso_pu_bacteria 2970040964 2970044379 334
212 iso_pu_bacteria 2970047711 2970054286 334
213 iso_pu_bacteria 2970054988 2970059131 334
214 iso_pu_bacteria 2970061556 2970067966 334
215 iso_pu_bacteria 2970068827 2970074326 334
216 iso_pu_bacteria 2970076120 2970080243 334
217 iso_pu_bacteria 2970082768 2970087642 334
218 iso_pu_bacteria 2970088815 2970092133 334
219 iso_pu_bacteria 2970095765 2970097855 334
220 iso_pu_bacteria 2970102677 2970104378 334
221 iso_pu_bacteria 2970109326 2970111795 334
222 iso_pu_bacteria 2970116247 2970120828 334
223 iso_pu_bacteria 2970122695 2970122897 334
224 iso_pu_bacteria 2970129317 2970132268 334
225 iso_pu_bacteria 2970136068 2970137743 334
226 iso_pu_bacteria 2970143518 2970145422 334
227 iso_pu_bacteria 2970149975 2970153763 334
228 iso_pu_bacteria 2970156795 2970163867 334
229 iso_pu_bacteria 2970164137 2970168523 334
230 iso_pu_bacteria 2970170962 2970174555 334
231 iso_pu_bacteria 2970177841 2970184375 334
232 iso_pu_bacteria 2970184632 2970190351 334
233 iso_pu_bacteria 2970191845 2970195877 334
234 iso_pu_bacteria 2977516862 2977522223 334
235 iso_pu_bacteria 2977523885 2977525684 334
236 iso_pu_bacteria 2977530762 2977530781 334
237 iso_pu_bacteria 2977537788 2977540690 334
238 iso_pu_bacteria 2977544691 2977546808 334
239 iso_pu_bacteria 2977551784 2977557132 334
240 iso_pu_bacteria 2977558990 2977562078 334
241 iso_pu_bacteria 2977565890 2977568753 334
242 iso_pu_bacteria 2977572785 2977576783 334
243 iso_pu_bacteria 2977579622 2977582559 334
244 iso_pu_bacteria 643692032 643823657 334
245 iso_pu_bacteria 648276728 648740448 334
246 iso_pu_bacteria 8003992118 8003995580 334
247 iso_pu_bacteria 8003999396 8004003347 334
248 3300005347 Ga0070668_100046535 Ga0070668_1000465351 335
249 3300005355 Ga0070671_100057348 Ga0070671_1000573483 335
250 3300005455 Ga0070663_100067848 Ga0070663_1000678483 335
251 3300005457 Ga0070662_100260387 Ga0070662_1002603872 335
252 3300005547 Ga0070693_100285953 Ga0070693_1002859531 335
253 3300005563 Ga0068855_100174023 Ga0068855_1001740232 335
254 3300005577 Ga0068857_100219393 Ga0068857_1002193932 335
255 3300005614 Ga0068856_100176054 Ga0068856_1001760542 335
256 3300005616 Ga0068852_100002107 Ga0068852_1000021076 335
257 3300006042 Ga0075368_10011992 Ga0075368_100119923 335
258 3300006051 Ga0075364_10075249 Ga0075364_100752493 335
259 3300006178 Ga0075367_10031396 Ga0075367_100313963 335
260 3300006186 Ga0075369_10036958 Ga0075369_100369582 335
261 3300006195 Ga0075366_10041375 Ga0075366_100413752 335
262 3300009093 Ga0105240_10007818 Ga0105240_100078187 335
263 3300009101 Ga0105247_10009605 Ga0105247_100096055 335
264 3300009545 Ga0105237_10002420 Ga0105237_1000242011 335
265 3300009545 Ga0105237_10016814 Ga0105237_100168145 335
266 3300010375 Ga0105239_10177357 Ga0105239_101773571 335
267 3300013296 Ga0157374_10040993 Ga0157374_100409934 335
268 3300013306 Ga0163162_10068227 Ga0163162_100682274 335
269 3300021384 Ga0213876_10004601 Ga0213876_100046013 335
270 3300021388 Ga0213875_10001344 Ga0213875_1000134411 335
271 3300025254 Ga0209148_1000305 Ga0209148_100030535 335
272 3300025272 Ga0209455_1006533 Ga0209455_10065333 335
273 3300025297 Ga0209758_1003392 Ga0209758_10033929 335
274 3300025304 Ga0209257_1014939 Ga0209257_10149392 335
275 3300025904 Ga0207647_10019341 Ga0207647_100193413 335
276 3300025913 Ga0207695_10000136 Ga0207695_10000136110 335
277 3300025914 Ga0207671_10005950 Ga0207671_100059503 335
278 3300025933 Ga0207706_10301123 Ga0207706_103011232 335
279 3300026035 Ga0207703_10048242 Ga0207703_100482424 335
280 3300026067 Ga0207678_10040377 Ga0207678_100403773 335
281 3300026116 Ga0207674_10052495 Ga0207674_100524954 335
282 3300028381 Ga0268264_10227754 Ga0268264_102277542 335
283 3300031595 Ga0265313_10026406 Ga0265313_100264063 335
284 3300037853 Ga0436364_0617972 Ga0436364_0617972_3132_4139 335
285 3300039437 Ga0436365_0364034 Ga0436365_0364034_64907_65914 335
286 3300039437 Ga0436365_1424493 Ga0436365_1424493_3785_4792 335
287 3300039450 Ga0436363_0239262 Ga0436363_0239262_555_1562 335
288 3300039453 Ga0436362_0362206 Ga0436362_0362206_1109_2116 335
289 3300046462 Ga0495651_0087919 Ga0495651_0087919_817_1824 335
290 3300046507 Ga0495606_0018190 Ga0495606_0018190_1504_2511 335
291 3300046518 Ga0495631_0114636 Ga0495631_0114636_89_1096 335
292 3300046522 Ga0495643_0027200 Ga0495643_0027200_1474_2481 335
293 3300046542 Ga0495597_0019632 Ga0495597_0019632_649_1656 335
294 3300046559 Ga0495667_0028344 Ga0495667_0028344_40_1047 335
295 3300046616 Ga0495668_0083467 Ga0495668_0083467_503_1510 335
296 3300047322 Ga0495680_0172752 Ga0495680_0172752_270_1277 335
297 3300047443 Ga0495687_017499 Ga0495687_017499_2556_3563 335
298 3300047469 Ga0495673_0022613 Ga0495673_0022613_300_1307 335
299 3300048904 Ga0496101_0033647 Ga0496101_0033647_1847_2854 335
300 3300048905 Ga0496102_0033995 Ga0496102_0033995_1788_2795 335
301 3300048906 Ga0496103_0025893 Ga0496103_0025893_754_1761 335
302 3300048908 Ga0496105_0006351 Ga0496105_0006351_1056_2063 335
303 3300048913 Ga0496110_0164525 Ga0496110_0164525_189_1196 335
304 3300048914 Ga0496111_0063727 Ga0496111_0063727_240_1247 335
305 3300048916 Ga0496113_0037943 Ga0496113_0037943_399_1406 335
306 3300048921 Ga0496118_0027736 Ga0496118_0027736_2272_3279 335
307 3300048922 Ga0496119_0017387 Ga0496119_0017387_3915_4922 335
308 3300048922 Ga0496119_0049024 Ga0496119_0049024_1208_2215 335
309 3300048924 Ga0496121_0002070 Ga0496121_0002070_14873_15880 335
310 3300048924 Ga0496121_0107002 Ga0496121_0107002_922_1929 335
311 3300048928 Ga0496125_0188182 Ga0496125_0188182_336_1343 335
312 3300050490 nmdc:mga03n38_141975_c1 nmdc:mga03n38_141975_c1_11_1018 335
313 3300050491 nmdc:mga00v17_20380_c1 nmdc:mga00v17_20380_c1_909_1916 335
314 3300053119 Ga0500595_000538 Ga0500595_000538_6073_7080 335
315 3300053119 Ga0500595_023410 Ga0500595_023410_416_1423 335
316 3300053130 Ga0500642_0034259 Ga0500642_0034259_111_1118 335
317 3300053146 Ga0500588_0008325 Ga0500588_0008325_367_1374 335
318 iso_pu_bacteria 2508501122 2509112220 335
319 iso_pu_bacteria 2844315083 2844320826 335
320 iso_pu_bacteria 2903727486 2903728104 335
321 iso_pu_bacteria 2906602504 2906608109 335
322 iso_pu_bacteria 8054460903 8054464673 335
323 iso_pu_bacteria 8056967851 8056969207 335
324 3300041408 Ga0439453_0005659 Ga0439453_0005659_104_1114 336
325 iso_pu_bacteria 8055431914 8055435337 336
326 3300005262 Ga0065165_1001369 Ga0065165_100136924 337
327 3300013105 Ga0157369_10098498 Ga0157369_100984982 337
328 3300037853 Ga0436364_0740264 Ga0436364_0740264_171_1184 337
329 3300039437 Ga0436365_1078535 Ga0436365_1078535_688_1701 337
330 3300048920 Ga0496117_0010475 Ga0496117_0010475_339_1352 337
331 3300048921 Ga0496118_0028305 Ga0496118_0028305_1127_2140 337
332 3300048921 Ga0496118_0043304 Ga0496118_0043304_1274_2293 337
333 3300048922 Ga0496119_0036900 Ga0496119_0036900_747_1760 337
334 3300048924 Ga0496121_0000005 Ga0496121_0000005_908683_909696 337
335 3300048925 Ga0496122_0002236 Ga0496122_0002236_155_1168 337
336 3300048925 Ga0496122_0185919 Ga0496122_0185919_154_1167 337
337 3300048927 Ga0496124_0000080 Ga0496124_0000080_105217_106230 337
338 3300048927 Ga0496124_0042053 Ga0496124_0042053_2858_3871 337
339 3300048927 Ga0496124_0184450 Ga0496124_0184450_66_1079 337
340 3300048928 Ga0496125_0000159 Ga0496125_0000159_32780_33793 337
341 3300053121 Ga0500607_090115 Ga0500607_090115_396_1409 337
342 3300053177 Ga0500636_0000011 Ga0500636_0000011_127771_128784 337
343 3300053177 Ga0500636_0000283 Ga0500636_0000283_20249_21265 337
344 iso_pu_bacteria 2510917022 2511133100 337
345 iso_pu_bacteria 2524023209 2524458622 337
346 iso_pu_bacteria 2582581307 2585271837 337
347 iso_pu_bacteria 2582581308 2585279797 337
348 iso_pu_bacteria 2582581315 2585326663 337
349 iso_pu_bacteria 2582581316 2585333829 337
350 iso_pu_bacteria 2585427527 2585531799 337
351 iso_pu_bacteria 2585427530 2585551253 337
352 iso_pu_bacteria 2585427531 2585563797 337
353 iso_pu_bacteria 2585427608 2585897005 337
354 iso_pu_bacteria 2585427609 2585907136 337
355 iso_pu_bacteria 2585428125 2587982870 337
356 iso_pu_bacteria 2615840626 2616306588 337
357 iso_pu_bacteria 2615840698 2616551225 337
358 iso_pu_bacteria 2617270742 2617382976 337
359 iso_pu_bacteria 2667528174 2671113349 337
360 iso_pu_bacteria 2775507266 2778179044 337
361 iso_pu_bacteria 2818991448 2819611638 337
362 iso_pu_bacteria 2818991453 2819638684 337
363 iso_pu_bacteria 2838029111 2838031065 337
364 iso_pu_bacteria 2842298080 2842300117 337
365 iso_pu_bacteria 2842357229 2842359028 337
366 iso_pu_bacteria 2842475841 2842477797 337
367 iso_pu_bacteria 2842482326 2842485094 337
368 iso_pu_bacteria 2842502639 2842504331 337
369 iso_pu_bacteria 2842509118 2842511550 337
370 iso_pu_bacteria 2852387548 2852391909 337
371 iso_pu_bacteria 2874123672 2874128761 337
372 iso_pu_bacteria 2899803654 2899804635 337
373 iso_pu_bacteria 2919408235 2919411196 337
374 iso_pu_bacteria 3005416602 3005421488 337
375 iso_pu_bacteria 8005314921 8005319809 337
376 iso_pu_bacteria 8005484373 8005490434 337
377 iso_pu_bacteria 8005645114 8005647077 337
378 iso_pu_bacteria 8005682033 8005687007 337
379 iso_pu_bacteria 8046767195 8046767404 337
380 iso_pu_bacteria 8057575449 8057578460 337
381 3300003214 JGI25165J46597_1004954 JGI25165J46597_10049541 338
382 3300005327 Ga0070658_10060193 Ga0070658_100601933 338
383 3300005327 Ga0070658_10084054 Ga0070658_100840543 338
384 3300005327 Ga0070658_10086291 Ga0070658_100862912 338
385 3300005329 Ga0070683_100184840 Ga0070683_1001848401 338
386 3300005339 Ga0070660_100001762 Ga0070660_1000017625 338
387 3300005344 Ga0070661_100023850 Ga0070661_1000238502 338
388 3300005347 Ga0070668_100098310 Ga0070668_1000983103 338
389 3300005356 Ga0070674_100005304 Ga0070674_1000053044 338
390 3300005364 Ga0070673_100063157 Ga0070673_1000631572 338
391 3300005458 Ga0070681_10442428 Ga0070681_104424281 338
392 3300005535 Ga0070684_100361619 Ga0070684_1003616192 338
393 3300005539 Ga0068853_100064264 Ga0068853_1000642642 338
394 3300005539 Ga0068853_100286784 Ga0068853_1002867842 338
395 3300005563 Ga0068855_100446575 Ga0068855_1004465752 338
396 3300005578 Ga0068854_100156977 Ga0068854_1001569772 338
397 3300005614 Ga0068856_100093394 Ga0068856_1000933942 338
398 3300005616 Ga0068852_100006927 Ga0068852_1000069274 338
399 3300005616 Ga0068852_100010073 Ga0068852_1000100732 338
400 3300006177 Ga0075362_10018813 Ga0075362_100188132 338
401 3300006178 Ga0075367_10010227 Ga0075367_100102275 338
402 3300006353 Ga0075370_10000790 Ga0075370_1000079011 338
403 3300009093 Ga0105240_10081019 Ga0105240_100810193 338
404 3300009174 Ga0105241_10042714 Ga0105241_100427144 338
405 3300009545 Ga0105237_10000071 Ga0105237_10000071134 338
406 3300009551 Ga0105238_10043265 Ga0105238_100432653 338
407 3300009551 Ga0105238_10051937 Ga0105238_100519373 338
408 3300009551 Ga0105238_10116700 Ga0105238_101167003 338
409 3300010375 Ga0105239_10001189 Ga0105239_100011897 338
410 3300010375 Ga0105239_10078512 Ga0105239_100785122 338
411 3300010375 Ga0105239_10263365 Ga0105239_102633652 338
412 3300013102 Ga0157371_10015320 Ga0157371_100153203 338
413 3300013102 Ga0157371_10318466 Ga0157371_103184661 338
414 3300013104 Ga0157370_10072323 Ga0157370_100723233 338
415 3300013104 Ga0157370_10127403 Ga0157370_101274033 338
416 3300013105 Ga0157369_10002596 Ga0157369_1000259614 338
417 3300013307 Ga0157372_10052860 Ga0157372_100528604 338
418 3300013307 Ga0157372_10203520 Ga0157372_102035202 338
419 3300021320 Ga0214544_1000771 Ga0214544_100077138 338
420 3300021321 Ga0214542_1000032 Ga0214542_100003256 338
421 3300021327 Ga0214543_1000016 Ga0214543_1000016222 338
422 3300021327 Ga0214543_1009269 Ga0214543_100926912 338
423 3300022739 Ga0228711_1000006 Ga0228711_1000006176 338
424 3300022740 Ga0228710_1000004 Ga0228710_1000004227 338
425 3300025261 Ga0209233_1000290 Ga0209233_100029043 338
426 3300025303 Ga0209051_1048728 Ga0209051_10487282 338
427 3300025909 Ga0207705_10002602 Ga0207705_100026026 338
428 3300025909 Ga0207705_10048317 Ga0207705_100483173 338
429 3300025913 Ga0207695_10029206 Ga0207695_100292062 338
430 3300025914 Ga0207671_10000099 Ga0207671_1000009946 338
431 3300025919 Ga0207657_10003030 Ga0207657_1000303010 338
432 3300025919 Ga0207657_10004936 Ga0207657_1000493616 338
433 3300025920 Ga0207649_10052297 Ga0207649_100522972 338
434 3300025937 Ga0207669_10022958 Ga0207669_100229582 338
435 3300025949 Ga0207667_10032885 Ga0207667_100328855 338
436 3300025949 Ga0207667_10118010 Ga0207667_101180103 338
437 3300025949 Ga0207667_10348850 Ga0207667_103488502 338
438 3300025972 Ga0207668_10055163 Ga0207668_100551632 338
439 3300026078 Ga0207702_10017912 Ga0207702_100179125 338
440 3300026078 Ga0207702_10038032 Ga0207702_100380324 338
441 3300026116 Ga0207674_10057790 Ga0207674_100577903 338
442 3300026116 Ga0207674_10071212 Ga0207674_100712122 338
443 3300026142 Ga0207698_10007021 Ga0207698_100070215 338
444 3300027111 Ga0209281_1000102 Ga0209281_1000102159 338
445 3300027111 Ga0209281_1000563 Ga0209281_100056316 338
446 3300027666 Ga0209282_1000013 Ga0209282_1000013194 338
447 3300028379 Ga0268266_10000391 Ga0268266_1000039155 338
448 3300028379 Ga0268266_10441988 Ga0268266_104419882 338
449 3300028563 Ga0265319_1027112 Ga0265319_10271122 338
450 3300028577 Ga0265318_10018314 Ga0265318_100183143 338
451 3300031711 Ga0265314_10070836 Ga0265314_100708362 338
452 3300031712 Ga0265342_10073275 Ga0265342_100732752 338
453 3300031967 Ga0315914_1000004 Ga0315914_1000004229 338
454 3300033430 Ga0315913_1000055 Ga0315913_100005520 338
455 3300033464 Ga0315915_1000003 Ga0315915_1000003336 338
456 3300038443 Ga0395901_0166681 Ga0395901_0166681_762_1778 338
457 3300049568 Ga0501031_0033902 Ga0501031_0033902_362_1378 338
458 3300049569 Ga0501032_0019351 Ga0501032_0019351_582_1598 338
459 3300049571 Ga0501034_0027120 Ga0501034_0027120_286_1302 338
460 3300049571 Ga0501034_0129124 Ga0501034_0129124_1258_2274 338
461 3300049571 Ga0501034_0161748 Ga0501034_0161748_776_1792 338
462 3300049571 Ga0501034_0228500 Ga0501034_0228500_398_1414 338
463 3300049571 Ga0501034_0484805 Ga0501034_0484805_116_1132 338
464 3300049571 Ga0501034_0539117 Ga0501034_0539117_51_1067 338
465 3300049572 Ga0501036_0021649 Ga0501036_0021649_3734_4750 338
466 3300049573 Ga0501037_0007341 Ga0501037_0007341_2511_3527 338
467 3300049573 Ga0501037_0069416 Ga0501037_0069416_1279_2295 338
468 3300049575 Ga0501039_0144456 Ga0501039_0144456_182_1198 338
469 3300049580 Ga0501046_0159088 Ga0501046_0159088_597_1613 338
470 3300049586 Ga0501070_0019852 Ga0501070_0019852_4014_5030 338
471 3300049586 Ga0501070_0050474 Ga0501070_0050474_509_1525 338
472 3300049742 Ga0501080_0251753 Ga0501080_0251753_47_1063 338
473 3300049822 Ga0501035_0020842 Ga0501035_0020842_2528_3544 338
474 3300049823 Ga0501044_0026318 Ga0501044_0026318_3966_4982 338
475 3300050494 nmdc:mga06z11_12978_c1 nmdc:mga06z11_12978_c1_1228_2244 338
476 3300013105 Ga0157369_10064646 Ga0157369_100646464 339
477 3300038443 Ga0395901_0411347 Ga0395901_0411347_347_1378 339
478 3300049823 Ga0501044_0424568 Ga0501044_0424568_134_1165 339
479 iso_pu_bacteria 2508501050 2508727109 339
480 iso_pu_bacteria 2508501114 2509074854 339
481 iso_pu_bacteria 2775506901 2776262736 339
482 iso_pu_bacteria 2835312727 2835318608 339
483 iso_pu_bacteria 2894232714 2894241242 339
484 3300046459 Ga0495629_0124561 Ga0495629_0124561_305_1327 340
485 3300046462 Ga0495651_0234875 Ga0495651_0234875_215_1237 340
486 3300046476 Ga0495662_0015516 Ga0495662_0015516_194_1216 340
487 3300046514 Ga0495618_0109362 Ga0495618_0109362_465_1487 340
488 3300046516 Ga0495628_0294263 Ga0495628_0294263_59_1081 340
489 3300046663 Ga0495635_0084705 Ga0495635_0084705_289_1311 340
490 3300046809 Ga0495600_0070586 Ga0495600_0070586_702_1724 340
491 3300047317 Ga0495604_0002107 Ga0495604_0002107_14668_15690 340
492 3300047317 Ga0495604_0054994 Ga0495604_0054994_1543_2565 340
493 3300047472 Ga0495686_0017404 Ga0495686_0017404_1266_2321 340
494 3300053085 Ga0495619_0054853 Ga0495619_0054853_587_1609 340
495 3300053140 Ga0500573_0031120 Ga0500573_0031120_459_1481 340
496 3300053148 Ga0500590_071848 Ga0500590_071848_337_1359 340
497 3300001979 JGI24740J21852_10004883 JGI24740J21852_100048834 341
498 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004129 341
499 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001451 341
500 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001545 341
501 3300002737 JGI25162J39368_1001203 JGI25162J39368_100120310 341
502 3300002737 JGI25162J39368_1002942 JGI25162J39368_10029424 341
503 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002657 341
504 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005134 341
505 3300002987 JGI25159J45721_1000242 JGI25159J45721_100024214 341
506 3300003214 JGI25165J46597_1001246 JGI25165J46597_10012464 341
507 3300003214 JGI25165J46597_1002528 JGI25165J46597_10025284 341
508 3300003214 JGI25165J46597_1005731 JGI25165J46597_10057312 341
509 3300003320 rootH2_10015183 rootH2_100151832 341
510 3300003322 rootL2_10112950 rootL2_101129506 341
511 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002238 341
512 3300003374 JGI25161J50226_1000024 JGI25161J50226_100002494 341
513 3300004625 Ga0055543_1000025 Ga0055543_100002538 341
514 3300005262 Ga0065165_1000200 Ga0065165_100020038 341
515 3300005614 Ga0068856_100008285 Ga0068856_1000082853 341
516 3300006048 Ga0075363_100017783 Ga0075363_1000177833 341
517 3300006178 Ga0075367_10139196 Ga0075367_101391962 341
518 3300006353 Ga0075370_10010473 Ga0075370_100104732 341
519 3300009093 Ga0105240_10000013 Ga0105240_10000013362 341
520 3300009545 Ga0105237_10246576 Ga0105237_102465762 341
521 3300010375 Ga0105239_10000768 Ga0105239_1000076837 341
522 3300013104 Ga0157370_10003431 Ga0157370_1000343116 341
523 3300014497 Ga0182008_10053008 Ga0182008_100530082 341
524 3300015262 Ga0182007_10006551 Ga0182007_100065513 341
525 3300015265 Ga0182005_1001647 Ga0182005_10016473 341
526 3300025206 Ga0209435_100009 Ga0209435_100009131 341
527 3300025207 Ga0209760_101814 Ga0209760_1018142 341
528 3300025228 Ga0209672_102531 Ga0209672_1025314 341
529 3300025233 Ga0209437_100057 Ga0209437_100057342 341
530 3300025233 Ga0209437_100772 Ga0209437_1007724 341
531 3300025246 Ga0209646_1000018 Ga0209646_1000018131 341
532 3300025250 Ga0209026_1000043 Ga0209026_1000043131 341
533 3300025253 Ga0209677_100426 Ga0209677_1004269 341
534 3300025256 Ga0209759_1000007 Ga0209759_1000007131 341
535 3300025261 Ga0209233_1000130 Ga0209233_1000130144 341
536 3300025261 Ga0209233_1000255 Ga0209233_100025525 341
537 3300025261 Ga0209233_1000332 Ga0209233_100033237 341
538 3300025284 Ga0209130_1000164 Ga0209130_100016451 341
539 3300025302 Ga0207426_1000082 Ga0207426_100008251 341
540 3300025913 Ga0207695_10000044 Ga0207695_10000044319 341
541 3300025914 Ga0207671_10000043 Ga0207671_10000043169 341
542 3300025986 Ga0207658_10302554 Ga0207658_103025542 341
543 3300026078 Ga0207702_10006190 Ga0207702_100061907 341
544 3300027312 Ga0209371_1001347 Ga0209371_10013474 341
545 3300030500 Ga0268256_1001200 Ga0268256_100120012 341
546 3300048920 Ga0496117_0094212 Ga0496117_0094212_482_1507 341
547 3300048922 Ga0496119_0010899 Ga0496119_0010899_93_1118 341
548 3300048923 Ga0496120_0023067 Ga0496120_0023067_2359_3384 341
549 3300048924 Ga0496121_0013681 Ga0496121_0013681_569_1594 341
550 3300048926 Ga0496123_0121495 Ga0496123_0121495_178_1203 341
551 3300048929 Ga0496126_0093405 Ga0496126_0093405_1226_2251 341
552 3300059492 Ga0587073_0008905 Ga0587073_0008905_503_1528 341
553 3300059505 Ga0587083_0006610 Ga0587083_0006610_456_1481 341
554 3300059605 Ga0587106_000487 Ga0587106_000487_1517_2542 341
555 3300061719 Ga0466962_0077681 Ga0466962_0077681_346_1371 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

131

260

0.92

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

3

122

0.88

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

135

313

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.988 4 331
3u3x-assembly3.cif.gz_M crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 0.9792 4 331
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9721 4 331
2p2s-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_050235.1) from erwinia carotovora atroseptica scri1043 at 1.25 a resolution 0.9549 4 331
3ip3-assembly4.cif.gz_G structure of putative oxidoreductase (tm_0425) from thermotoga maritima 0.8875 4 334
ID Description Score Start End Superfamily
3u3xG02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9813 123 331 3.30.360.10
3u3xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.972 4 124 3.40.50.720
3u3xG02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9711 123 331 3.30.360.10
2p2sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 2 124 3.40.50.720
2p2sB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9321 123 331 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9802 90 331
AF-A0A1S9CA72-F1-model_v4 Oxidoreductase 0.957 2 331 GO:0000166
GO:0016491
AF-A0A7C5QIQ7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9493 90 331
AF-A0A329MFN4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9293 2 330 GO:0000166
GO:0016491
AF-A0A1S9CA72-F1-model_v4 Oxidoreductase 0.9242 2 331 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map