F463083

General Info

Members Datasets Scaffolds Average Seq Length
555 289 1110 285

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100179139|Ga0070686_1001791392
Length 347
Sequence VTAVNVDRGGRSLLQRRRGLIPLLLLAPGVLWLAVFYVYPAFQMFLSSFWTGSLEKGFTFSLSNWTTYPEAISRYQEQFVRSILYAGAATILTFLIAYPLAWTIAFKGGRWKNLLIFLVIAPFFTSFLLRTVSWKIILGDAGIVLGPLKDVGLLPDDFRVLATPIAVVSGITYNFLPFMTLPIYVSLEKMDFRLIEAARDLYAGPWRRPGAIVGAIVGGGLFAVLAWIFELSVIPIGAFGAVAGSVIGALLISEAFVRVTFPLSLPGVFAGSLLVLIPAIGDYVNAELLGTTNTRMIGNVIQSRYLVNTDYPTAAALSFTMMAAILVAVLIYARALGTENLTASRGL

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 2643221558 Rhizobium sp. Root149 Isolate Unclassified
289 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.18
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 10.27
Rhizosphere 87.03
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100179139 3300005544 Bacteria 1504
2 JGI25407J50210_10001188 3300003373 Bacteria 5790
3 JGI25404J52841_10039189 3300003659 Bacteria 1004
4 Ga0065707_10020904 3300005295 Bacteria 2026
5 Ga0070658_10176445 3300005327 Bacteria 1797
6 Ga0070676_10117745 3300005328 Bacteria 1663
7 Ga0070676_10323591 3300005328 Bacteria 1052
8 Ga0070683_100014393 3300005329 Bacteria 6919
9 Ga0070683_100060526 3300005329 Bacteria 3519
10 Ga0070683_100236123 3300005329 Bacteria 1738
11 Ga0070690_100093573 3300005330 Bacteria 1982
12 Ga0068869_100169871 3300005334 Bacteria 1703
13 Ga0070680_100000018 3300005336 Bacteria 85499
14 Ga0070680_100027325 3300005336 Bacteria 4569
15 Ga0070680_100248184 3300005336 Bacteria 1505
16 Ga0068868_100107922 3300005338 Bacteria 2259
17 Ga0070660_100002783 3300005339 Bacteria 12008
18 Ga0070660_100027225 3300005339 Bacteria 4265
19 Ga0070661_100003995 3300005344 Bacteria 10142
20 Ga0070668_100108626 3300005347 Bacteria 2206
21 Ga0070668_100239627 3300005347 Bacteria 1502
22 Ga0070675_100233342 3300005354 Bacteria 1606
23 Ga0070675_100336770 3300005354 Bacteria 1336
24 Ga0070674_100255701 3300005356 Bacteria 1378
25 Ga0070674_100313243 3300005356 Bacteria 1255
26 Ga0070673_100026021 3300005364 Bacteria 4315
27 Ga0070688_100119051 3300005365 Unclassified 1766
28 Ga0070659_100011995 3300005366 Bacteria 6416
29 Ga0070659_100068981 3300005366 Bacteria 2806
30 Ga0070714_100010958 3300005435 Bacteria 7180
31 Ga0070714_100070166 3300005435 Bacteria 3028
32 Ga0070714_100460901 3300005435 Bacteria 1208
33 Ga0070700_100025393 3300005441 Bacteria 3488
34 Ga0070700_100115072 3300005441 Bacteria 1794
35 Ga0070694_100392592 3300005444 Bacteria 1084
36 Ga0070708_100055278 3300005445 Bacteria 3529
37 Ga0070678_100009257 3300005456 Bacteria 5955
38 Ga0070662_100166965 3300005457 Bacteria 1725
39 Ga0070681_10003547 3300005458 Bacteria 14632
40 Ga0070681_10250282 3300005458 Bacteria 1685
41 Ga0070685_10189589 3300005466 Bacteria 1329
42 Ga0070685_10235556 3300005466 Bacteria 1206
43 Ga0070706_100085043 3300005467 Bacteria 2931
44 Ga0070707_100060575 3300005468 Bacteria 3630
45 Ga0070707_100097176 3300005468 Bacteria 2852
46 Ga0070698_100036212 3300005471 Bacteria 5100
47 Ga0070699_100001426 3300005518 Bacteria 21971
48 Ga0070679_100013590 3300005530 Bacteria 7802
49 Ga0070684_100031687 3300005535 Bacteria 4502
50 Ga0070684_100032685 3300005535 Bacteria 4436
51 Ga0070684_100087881 3300005535 Bacteria 2760
52 Ga0070697_100079082 3300005536 Bacteria 2707
53 Ga0070672_100107641 3300005543 Bacteria 2269
54 Ga0070686_100032182 3300005544 Bacteria 3213
55 Ga0070695_100025222 3300005545 Bacteria 3670
56 Ga0070695_100177973 3300005545 Bacteria 1505
57 Ga0070695_100223867 3300005545 Bacteria 1357
58 Ga0070696_100001637 3300005546 Bacteria 14706
59 Ga0070696_100004430 3300005546 Bacteria 9369
60 Ga0070696_100030303 3300005546 Bacteria 3703
61 Ga0070696_100066601 3300005546 Bacteria 2526
62 Ga0070696_100417546 3300005546 Bacteria 1052
63 Ga0070693_100099690 3300005547 Bacteria 1767
64 Ga0070693_100143735 3300005547 Bacteria 1504
65 Ga0070665_100083355 3300005548 Bacteria 3202
66 Ga0070704_100061199 3300005549 Bacteria 2693
67 Ga0070704_100136645 3300005549 Bacteria 1908
68 Ga0068855_100094295 3300005563 Bacteria 3451
69 Ga0070664_100172207 3300005564 Bacteria 1921
70 Ga0068857_100129008 3300005577 Bacteria 2280
71 Ga0068854_100061420 3300005578 Bacteria 2722
72 Ga0068854_100096009 3300005578 Bacteria 2214
73 Ga0068856_100058209 3300005614 Bacteria 3816
74 Ga0068856_100212661 3300005614 Bacteria 1949
75 Ga0070702_100012037 3300005615 Bacteria 4321
76 Ga0070702_100019101 3300005615 Bacteria 3567
77 Ga0070702_100073090 3300005615 Unclassified 2031
78 Ga0068852_100041995 3300005616 Bacteria 3869
79 Ga0068852_100117506 3300005616 Bacteria 2428
80 Ga0068859_100047052 3300005617 Bacteria 4333
81 Ga0068859_100101456 3300005617 Bacteria 2935
82 Ga0068864_100106435 3300005618 Bacteria 2494
83 Ga0068864_100106910 3300005618 Bacteria 2488
84 Ga0068864_100244206 3300005618 Unclassified 1664
85 Ga0068866_10084526 3300005718 Bacteria 1713
86 Ga0068870_10135425 3300005840 Bacteria 1436
87 Ga0081455_10001385 3300005937 Bacteria 29923
88 Ga0081455_10005512 3300005937 Bacteria 13870
89 Ga0081455_10026205 3300005937 Bacteria 5370
90 Ga0081455_10048055 3300005937 Bacteria 3690
91 Ga0081455_10063570 3300005937 Bacteria 3097
92 Ga0081538_10000649 3300005981 Bacteria 38484
93 Ga0081538_10007025 3300005981 Bacteria 9790
94 Ga0081538_10051026 3300005981 Bacteria 2489
95 Ga0081540_1002348 3300005983 Bacteria 15492
96 Ga0070717_10012797 3300006028 Bacteria 6406
97 Ga0075365_10004392 3300006038 Bacteria 7467
98 Ga0075365_10011796 3300006038 Bacteria 5157
99 Ga0075365_10022410 3300006038 Bacteria 3957
100 Ga0075365_10031681 3300006038 Bacteria 3393
101 Ga0075365_10154319 3300006038 Bacteria 1598
102 Ga0075364_10051115 3300006051 Bacteria 2698
103 Ga0075364_10082512 3300006051 Bacteria 2127
104 Ga0075432_10009109 3300006058 Bacteria 3382
105 Ga0070712_100005819 3300006175 Bacteria 7628
106 Ga0070712_100077771 3300006175 Bacteria 2392
107 Ga0097621_100487830 3300006237 Bacteria 1115
108 Ga0068871_100200954 3300006358 Unclassified 1721
109 Ga0068871_100302777 3300006358 Bacteria 1403
110 Ga0075428_100005004 3300006844 Bacteria 14724
111 Ga0075428_100048614 3300006844 Bacteria 4655
112 Ga0075428_100080086 3300006844 Bacteria 3564
113 Ga0075431_100030660 3300006847 Bacteria 5540
114 Ga0075431_100089859 3300006847 Bacteria 3170
115 Ga0075431_100190357 3300006847 Bacteria 2102
116 Ga0075433_10038801 3300006852 Bacteria 4115
117 Ga0075433_10150673 3300006852 Bacteria 2069
118 Ga0075433_10230426 3300006852 Bacteria 1645
119 Ga0075433_10244237 3300006852 Bacteria 1594
120 Ga0075434_100031432 3300006871 Bacteria 5235
121 Ga0075434_100033553 3300006871 Bacteria 5066
122 Ga0075434_100037110 3300006871 Bacteria 4823
123 Ga0075434_100137850 3300006871 Bacteria 2459
124 Ga0075434_100147905 3300006871 Bacteria 2369
125 Ga0075434_100219392 3300006871 Bacteria 1921
126 Ga0075429_100009631 3300006880 Bacteria 8382
127 Ga0075436_100017906 3300006914 Bacteria 4851
128 Ga0075436_100020126 3300006914 Bacteria 4580
129 Ga0097620_100047054 3300006931 Bacteria 4333
130 Ga0097620_100101458 3300006931 Bacteria 2935
131 Ga0075435_100000895 3300007076 Bacteria 18764
132 Ga0075435_100050308 3300007076 Bacteria 3353
133 Ga0075435_100117783 3300007076 Bacteria 2214
134 Ga0105240_10174709 3300009093 Bacteria 2540
135 Ga0111539_10002146 3300009094 Bacteria 26383
136 Ga0111539_10014791 3300009094 Bacteria 9733
137 Ga0111539_10166832 3300009094 Bacteria 2574
138 Ga0105245_10003768 3300009098 Bacteria 13496
139 Ga0105245_10045132 3300009098 Bacteria 3935
140 Ga0105245_10047600 3300009098 Bacteria 3834
141 Ga0105245_10087138 3300009098 Bacteria 2866
142 Ga0105245_10132667 3300009098 Bacteria 2338
143 Ga0105245_10136288 3300009098 Bacteria 2307
144 Ga0105245_10191062 3300009098 Bacteria 1961
145 Ga0105247_10096736 3300009101 Bacteria 1882
146 Ga0114129_10059238 3300009147 Bacteria 5354
147 Ga0114129_10230577 3300009147 Bacteria 2494
148 Ga0114129_10421498 3300009147 Bacteria 1755
149 Ga0114129_10964790 3300009147 Bacteria 1076
150 Ga0105243_10089475 3300009148 Bacteria 2531
151 Ga0105243_10096559 3300009148 Bacteria 2445
152 Ga0105243_10393164 3300009148 Bacteria 1286
153 Ga0105242_10139781 3300009176 Bacteria 2100
154 Ga0105242_10560250 3300009176 Bacteria 1097
155 Ga0105248_10388595 3300009177 Bacteria 1571
156 Ga0105237_10011223 3300009545 Bacteria 9488
157 Ga0105237_10072802 3300009545 Bacteria 3430
158 Ga0105237_10282797 3300009545 Bacteria 1661
159 Ga0105238_10018586 3300009551 Bacteria 7076
160 Ga0105238_10037462 3300009551 Bacteria 4930
161 Ga0105238_10445816 3300009551 Bacteria 1291
162 Ga0105249_10025651 3300009553 Bacteria 5309
163 Ga0105249_10068402 3300009553 Bacteria 3275
164 Ga0105249_10369907 3300009553 Bacteria 1457
165 Ga0105249_10396449 3300009553 Bacteria 1409
166 Ga0105030_101719 3300009987 Bacteria 1931
167 Ga0105239_10181004 3300010375 Bacteria 2358
168 Ga0105239_10228454 3300010375 Bacteria 2088
169 Ga0105239_10244510 3300010375 Bacteria 2014
170 Ga0105239_10479016 3300010375 Bacteria 1414
171 Ga0105246_10003991 3300011119 Bacteria 8950
172 Ga0105246_10032961 3300011119 Bacteria 3439
173 Ga0157371_10063881 3300013102 Bacteria 2609
174 Ga0157370_10193577 3300013104 Bacteria 1887
175 Ga0157369_10037559 3300013105 Bacteria 5302
176 Ga0157369_10559542 3300013105 Bacteria 1182
177 Ga0157374_10072732 3300013296 Bacteria 3244
178 Ga0157374_10074223 3300013296 Bacteria 3211
179 Ga0157374_10128418 3300013296 Bacteria 2452
180 Ga0157378_10079697 3300013297 Bacteria 2957
181 Ga0157378_10109743 3300013297 Bacteria 2527
182 Ga0157372_10022825 3300013307 Bacteria 6775
183 Ga0157372_10089842 3300013307 Bacteria 3491
184 Ga0157375_10110632 3300013308 Bacteria 2845
185 Ga0157375_10148641 3300013308 Bacteria 2476
186 Ga0163163_10013072 3300014325 Bacteria 7583
187 Ga0163163_10049032 3300014325 Bacteria 4155
188 Ga0157380_10034866 3300014326 Bacteria 3884
189 Ga0157380_10497791 3300014326 Bacteria 1183
190 Ga0157377_10020287 3300014745 Bacteria 3480
191 Ga0157379_10006502 3300014968 Bacteria 10073
192 Ga0157379_10409153 3300014968 Bacteria 1248
193 Ga0157376_10009505 3300014969 Bacteria 7064
194 Ga0207653_10037214 3300025885 Bacteria 1587
195 Ga0207692_10069122 3300025898 Bacteria 1854
196 Ga0207710_10070309 3300025900 Bacteria 1604
197 Ga0207688_10005714 3300025901 Bacteria 6765
198 Ga0207688_10085189 3300025901 Bacteria 1810
199 Ga0207688_10085505 3300025901 Bacteria 1806
200 Ga0207643_10007579 3300025908 Bacteria 5827
201 Ga0207684_10121604 3300025910 Bacteria 2238
202 Ga0207684_10258183 3300025910 Bacteria 1503
203 Ga0207654_10031089 3300025911 Bacteria 2938
204 Ga0207707_10170985 3300025912 Bacteria 1899
205 Ga0207671_10020949 3300025914 Bacteria 4970
206 Ga0207693_10001111 3300025915 Bacteria 24207
207 Ga0207693_10005339 3300025915 Bacteria 10737
208 Ga0207693_10019813 3300025915 Bacteria 5349
209 Ga0207663_10065244 3300025916 Bacteria 2327
210 Ga0207660_10000001 3300025917 Bacteria 1034169
211 Ga0207660_10050626 3300025917 Bacteria 2950
212 Ga0207660_10099108 3300025917 Bacteria 2174
213 Ga0207662_10005561 3300025918 Bacteria 6730
214 Ga0207662_10047689 3300025918 Bacteria 2537
215 Ga0207657_10026128 3300025919 Bacteria 5371
216 Ga0207657_10027299 3300025919 Bacteria 5229
217 Ga0207649_10181516 3300025920 Unclassified 1473
218 Ga0207649_10254940 3300025920 Bacteria 1265
219 Ga0207652_10067952 3300025921 Bacteria 3091
220 Ga0207646_10031718 3300025922 Bacteria 4783
221 Ga0207681_10396505 3300025923 Bacteria 1114
222 Ga0207694_10094498 3300025924 Bacteria 2362
223 Ga0207694_10098818 3300025924 Bacteria 2311
224 Ga0207659_10212456 3300025926 Bacteria 1551
225 Ga0207687_10001191 3300025927 Bacteria 17761
226 Ga0207687_10050058 3300025927 Bacteria 2907
227 Ga0207687_10099271 3300025927 Bacteria 2139
228 Ga0207687_10261230 3300025927 Bacteria 1380
229 Ga0207700_10038321 3300025928 Bacteria 3478
230 Ga0207664_10052283 3300025929 Bacteria 3230
231 Ga0207664_10562776 3300025929 Bacteria 1023
232 Ga0207706_10073832 3300025933 Bacteria 2999
233 Ga0207686_10029884 3300025934 Bacteria 3220
234 Ga0207686_10132802 3300025934 Bacteria 1710
235 Ga0207665_10002817 3300025939 Bacteria 11654
236 Ga0207689_10086973 3300025942 Bacteria 2568
237 Ga0207689_10188005 3300025942 Bacteria 1703
238 Ga0207661_10004606 3300025944 Bacteria 9665
239 Ga0207661_10139590 3300025944 Bacteria 2084
240 Ga0207667_10005419 3300025949 Bacteria 15556
241 Ga0207712_10073070 3300025961 Bacteria 2472
242 Ga0207668_10091198 3300025972 Bacteria 2239
243 Ga0207668_10163820 3300025972 Bacteria 1736
244 Ga0207668_10259224 3300025972 Bacteria 1416
245 Ga0207677_10043582 3300026023 Bacteria 2984
246 Ga0207677_10140458 3300026023 Bacteria 1848
247 Ga0207703_10572430 3300026035 Bacteria 1066
248 Ga0207639_10034485 3300026041 Bacteria 3740
249 Ga0207708_10018003 3300026075 Bacteria 5316
250 Ga0207708_10024303 3300026075 Bacteria 4583
251 Ga0207708_10038988 3300026075 Bacteria 3619
252 Ga0207708_10113648 3300026075 Bacteria 2104
253 Ga0207708_10204177 3300026075 Bacteria 1577
254 Ga0207702_10001525 3300026078 Bacteria 22924
255 Ga0207648_10051728 3300026089 Bacteria 3590
256 Ga0207676_10024502 3300026095 Bacteria 4466
257 Ga0207676_10060689 3300026095 Bacteria 2992
258 Ga0207674_10020515 3300026116 Bacteria 7138
259 Ga0207674_10127592 3300026116 Bacteria 2508
260 Ga0207674_10146878 3300026116 Bacteria 2316
261 Ga0207675_100086697 3300026118 Bacteria 2940
262 Ga0207675_100089294 3300026118 Bacteria 2896
263 Ga0207683_10013180 3300026121 Bacteria 7053
264 Ga0207683_10037429 3300026121 Bacteria 4225
265 Ga0207683_10039828 3300026121 Bacteria 4099
266 Ga0207683_10090750 3300026121 Bacteria 2721
267 Ga0207683_10326868 3300026121 Bacteria 1405
268 Ga0207698_10100828 3300026142 Bacteria 2393
269 Ga0209974_10010591 3300027876 Bacteria 3111
270 Ga0207428_10002352 3300027907 Bacteria 18886
271 Ga0207428_10021489 3300027907 Bacteria 5464
272 Ga0207428_10025482 3300027907 Bacteria 4950
273 Ga0268266_10134597 3300028379 Bacteria 2213
274 Ga0307408_100238994 3300031548 Bacteria 1492
275 Ga0307405_10047173 3300031731 Bacteria 2651
276 Ga0307413_10005138 3300031824 Bacteria 5799
277 Ga0307410_10028459 3300031852 Bacteria 3545
278 Ga0307406_10003222 3300031901 Bacteria 8886
279 Ga0307407_10011911 3300031903 Bacteria 4160
280 Ga0307412_10265098 3300031911 Bacteria 1341
281 Ga0307409_100032998 3300031995 Bacteria 3761
282 Ga0307416_100004079 3300032002 Bacteria 8733
283 Ga0307411_10003294 3300032005 Bacteria 7461
284 Ga0307411_10098155 3300032005 Bacteria 2064
285 Ga0307415_100044974 3300032126 Bacteria 2956
286 Ga0307415_100062748 3300032126 Bacteria 2579
287 Ga0373926_0036142 3300035083 Bacteria 1754
288 Ga0373944_0030744 3300035089 Bacteria 1612
289 Ga0373939_0059098 3300035114 Bacteria 1215
290 Ga0373945_0011572 3300035116 Bacteria 2920
291 Ga0373945_0020313 3300035116 Bacteria 2272
292 Ga0373953_0161798 3300035117 Bacteria 962
293 Ga0373943_0161965 3300035170 Bacteria 1218
294 Ga0373955_0017342 3300035172 Bacteria 3563
295 Ga0373961_0117359 3300035241 Bacteria 878
296 Ga0373924_0045707 3300035410 Bacteria 1801
297 Ga0373935_0006546 3300035692 Bacteria 6957
298 Ga0373927_0060013 3300035695 Bacteria 2460
299 Ga0373933_0008402 3300035724 Bacteria 5639
300 Ga0373947_0002753 3300035725 Bacteria 10524
301 Ga0373947_0011012 3300035725 Bacteria 5187
302 Ga0373937_0095238 3300036401 Bacteria 2760
303 Ga0373925_0041515 3300037068 Bacteria 3410
304 Ga0373925_0114451 3300037068 Bacteria 2087
305 Ga0395899_0002021 3300037312 Bacteria 16714
306 Ga0395899_0005076 3300037312 Bacteria 10243
307 Ga0395899_0016041 3300037312 Bacteria 5712
308 Ga0395900_0005702 3300037418 Bacteria 13019
309 Ga0395900_0014393 3300037418 Bacteria 8073
310 Ga0395900_0042949 3300037418 Bacteria 4657
311 Ga0395898_0001770 3300037466 Bacteria 28211
312 Ga0395898_0008349 3300037466 Bacteria 10948
313 Ga0395898_0014665 3300037466 Bacteria 8047
314 Ga0395898_0035344 3300037466 Bacteria 4969
315 Ga0395905_0005512 3300037471 Bacteria 12914
316 Ga0395905_0032471 3300037471 Bacteria 4909
317 Ga0395905_0143988 3300037471 Bacteria 2242
318 Ga0395901_0010557 3300038443 Bacteria 9356
319 Ga0395901_0012843 3300038443 Bacteria 8495
320 Ga0395901_0018846 3300038443 Bacteria 7054
321 Ga0395901_0027456 3300038443 Bacteria 5849
322 Ga0395901_0457095 3300038443 Bacteria 1305
323 Ga0395901_0743303 3300038443 Bacteria 975
324 Ga0436365_0345358 3300039437 Bacteria 2587
325 Ga0451853_3422826 3300041512 Bacteria 960
326 Ga0439448_0009102 3300042005 Bacteria 2922
327 Ga0451577_0252519 3300042876 Bacteria 1596
328 Ga0466972_0093277 3300044658 Bacteria 1427
329 Ga0453683_0101273 3300044673 Bacteria 1808
330 Ga0466960_0006463 3300044901 Bacteria 4703
331 Ga0466960_0068645 3300044901 Bacteria 1759
332 Ga0451576_0045907 3300045051 Bacteria 4600
333 Ga0466967_0067707 3300045976 Bacteria 3186
334 Ga0466967_0180711 3300045976 Bacteria 1990
335 Ga0466967_0232235 3300045976 Bacteria 1757
336 Ga0495592_0072864 3300046454 Bacteria 2498
337 Ga0495603_0002642 3300046455 Bacteria 10570
338 Ga0495603_0042355 3300046455 Bacteria 2721
339 Ga0495603_0068101 3300046455 Unclassified 2094
340 Ga0495603_0132388 3300046455 Bacteria 1452
341 Ga0495629_0026353 3300046459 Bacteria 4129
342 Ga0495641_0002221 3300046461 Bacteria 15487
343 Ga0495641_0014207 3300046461 Bacteria 4319
344 Ga0495641_0037210 3300046461 Bacteria 2283
345 Ga0495641_0052801 3300046461 Bacteria 1851
346 Ga0495651_0042133 3300046462 Bacteria 3545
347 Ga0495653_0080805 3300046463 Bacteria 2403
348 Ga0495580_0015102 3300046472 Bacteria 5843
349 Ga0495580_0096654 3300046472 Bacteria 2054
350 Ga0495582_0005239 3300046473 Bacteria 7250
351 Ga0495582_0014846 3300046473 Bacteria 4280
352 Ga0495639_0005319 3300046475 Bacteria 5544
353 Ga0495662_0000966 3300046476 Bacteria 14080
354 Ga0495594_0003329 3300046499 Bacteria 8310
355 Ga0495594_0021427 3300046499 Bacteria 3449
356 Ga0495594_0029663 3300046499 Bacteria 2957
357 Ga0495608_0024130 3300046511 Bacteria 4160
358 Ga0495616_0111123 3300046513 Bacteria 1273
359 Ga0495620_0095142 3300046515 Bacteria 1192
360 Ga0495630_0023737 3300046517 Bacteria 4533
361 Ga0495666_0039397 3300046526 Bacteria 2294
362 Ga0495652_0297212 3300046529 Bacteria 1175
363 Ga0495665_0004131 3300046531 Bacteria 7828
364 Ga0495586_0042915 3300046535 Bacteria 2435
365 Ga0495621_0051462 3300046539 Bacteria 1474
366 Ga0495645_0255333 3300046543 Bacteria 1163
367 Ga0495667_0001693 3300046559 Bacteria 14632
368 Ga0495656_0019728 3300046615 Bacteria 2606
369 Ga0495634_0001514 3300046642 Bacteria 20538
370 Ga0495635_0012117 3300046663 Bacteria 6045
371 Ga0495588_0001771 3300046674 Bacteria 9194
372 Ga0495588_0001956 3300046674 Bacteria 8791
373 Ga0495657_0015941 3300046675 Bacteria 5483
374 Ga0495646_0099689 3300046680 Bacteria 1667
375 Ga0495647_0001379 3300046681 Bacteria 7495
376 Ga0495658_0007834 3300046683 Bacteria 5290
377 Ga0495613_0002685 3300046689 Bacteria 13355
378 Ga0495624_0008016 3300046690 Bacteria 7399
379 Ga0495589_0053607 3300046794 Bacteria 1990
380 Ga0495600_0000905 3300046809 Bacteria 15901
381 Ga0495660_0120370 3300046810 Bacteria 1329
382 Ga0495581_0000401 3300047315 Bacteria 21766
383 Ga0495604_0290369 3300047317 Bacteria 1101
384 Ga0495674_0043543 3300047319 Bacteria 3995
385 Ga0495676_0003524 3300047321 Bacteria 14179
386 Ga0495676_0009898 3300047321 Bacteria 8664
387 Ga0495676_0154398 3300047321 Unclassified 1630
388 Ga0495680_0003355 3300047322 Bacteria 15815
389 Ga0495675_0206740 3300047444 Bacteria 1193
390 Ga0495677_0132244 3300047445 Bacteria 955
391 Ga0495685_072658 3300047447 Bacteria 1151
392 Ga0495684_0008886 3300047471 Bacteria 7759
393 Ga0495593_0001325 3300047673 Bacteria 14484
394 Ga0495602_0090670 3300048088 Bacteria 2538
395 Ga0495614_0004406 3300048089 Bacteria 6350
396 Ga0496100_0002072 3300048903 Bacteria 10079
397 Ga0496100_0020693 3300048903 Bacteria 3949
398 Ga0496101_0000781 3300048904 Bacteria 18842
399 Ga0496101_0089266 3300048904 Bacteria 2290
400 Ga0496102_0028949 3300048905 Bacteria 4952
401 Ga0496102_0030679 3300048905 Bacteria 4812
402 Ga0496102_0101646 3300048905 Bacteria 2671
403 Ga0496102_0660536 3300048905 Bacteria 968
404 Ga0496103_0007852 3300048906 Bacteria 6343
405 Ga0496103_0014771 3300048906 Bacteria 4641
406 Ga0496103_0032331 3300048906 Bacteria 3193
407 Ga0496104_0003949 3300048907 Bacteria 12838
408 Ga0496104_0016952 3300048907 Bacteria 6626
409 Ga0496105_0013618 3300048908 Bacteria 6457
410 Ga0496105_0021565 3300048908 Bacteria 5213
411 Ga0496105_0189792 3300048908 Bacteria 1680
412 Ga0496106_0004743 3300048909 Bacteria 10054
413 Ga0496106_0017973 3300048909 Bacteria 5229
414 Ga0496106_0034671 3300048909 Bacteria 3771
415 Ga0496106_0049377 3300048909 Bacteria 3169
416 Ga0496106_0055028 3300048909 Bacteria 3007
417 Ga0496106_0093218 3300048909 Bacteria 2327
418 Ga0496107_0004598 3300048910 Bacteria 9356
419 Ga0496107_0410164 3300048910 Bacteria 1007
420 Ga0496108_0002372 3300048911 Bacteria 15085
421 Ga0496108_0004711 3300048911 Bacteria 11005
422 Ga0496108_0009157 3300048911 Bacteria 8013
423 Ga0496109_0001588 3300048912 Bacteria 18949
424 Ga0496109_0007413 3300048912 Bacteria 9284
425 Ga0496109_0024716 3300048912 Bacteria 5344
426 Ga0496109_0056997 3300048912 Bacteria 3565
427 Ga0496109_0066985 3300048912 Bacteria 3288
428 Ga0496109_0231458 3300048912 Bacteria 1739
429 Ga0496109_0294717 3300048912 Bacteria 1529
430 Ga0496109_0411143 3300048912 Bacteria 1278
431 Ga0496110_0000112 3300048913 Bacteria 44496
432 Ga0496110_0001153 3300048913 Bacteria 18733
433 Ga0496110_0015283 3300048913 Bacteria 6385
434 Ga0496110_0017605 3300048913 Bacteria 5974
435 Ga0496111_0000091 3300048914 Bacteria 38326
436 Ga0496111_0001686 3300048914 Bacteria 12869
437 Ga0496111_0007362 3300048914 Bacteria 7207
438 Ga0496111_0014505 3300048914 Bacteria 5385
439 Ga0496112_0000278 3300048915 Bacteria 33228
440 Ga0496112_0003366 3300048915 Bacteria 13199
441 Ga0496112_0084065 3300048915 Bacteria 3148
442 Ga0496113_0004701 3300048916 Bacteria 8423
443 Ga0496113_0012054 3300048916 Bacteria 5798
444 Ga0496113_0014793 3300048916 Bacteria 5337
445 Ga0496113_0030681 3300048916 Bacteria 3893
446 Ga0496113_0091091 3300048916 Bacteria 2350
447 Ga0496114_0010123 3300048917 Bacteria 7501
448 Ga0496114_0031603 3300048917 Bacteria 4356
449 Ga0496114_0034381 3300048917 Bacteria 4181
450 Ga0496115_0006334 3300048918 Bacteria 8665
451 Ga0496115_0029620 3300048918 Bacteria 4300
452 Ga0496115_0168180 3300048918 Bacteria 1813
453 Ga0501031_0093589 3300049568 Bacteria 1961
454 Ga0501032_0247238 3300049569 Bacteria 1158
455 Ga0501036_0128426 3300049572 Bacteria 2140
456 Ga0501036_0155004 3300049572 Bacteria 1932
457 Ga0501038_0462583 3300049574 Bacteria 974
458 Ga0501039_0012465 3300049575 Bacteria 6491
459 Ga0501039_0062632 3300049575 Bacteria 2882
460 Ga0501040_0020135 3300049576 Bacteria 4445
461 Ga0501040_0029437 3300049576 Bacteria 3707
462 Ga0501040_0053716 3300049576 Bacteria 2760
463 Ga0501041_0004734 3300049577 Bacteria 7901
464 Ga0501041_0156839 3300049577 Bacteria 1422
465 Ga0501042_0002948 3300049578 Bacteria 10570
466 Ga0501042_0049831 3300049578 Bacteria 2988
467 Ga0501046_0347163 3300049580 Bacteria 1078
468 Ga0501048_0014737 3300049582 Bacteria 5785
469 Ga0501048_0060312 3300049582 Bacteria 2688
470 Ga0501067_0025424 3300049583 Bacteria 3282
471 Ga0501067_0134113 3300049583 Bacteria 1378
472 Ga0501068_0046346 3300049584 Bacteria 2622
473 Ga0501069_0009959 3300049585 Bacteria 5025
474 Ga0501069_0144181 3300049585 Bacteria 1367
475 Ga0501070_0136546 3300049586 Bacteria 2025
476 Ga0501071_0003059 3300049587 Bacteria 10362
477 Ga0501071_0017130 3300049587 Bacteria 4992
478 Ga0501071_0024254 3300049587 Bacteria 4241
479 Ga0501071_0135074 3300049587 Bacteria 1835
480 Ga0501072_0014595 3300049588 Bacteria 6021
481 Ga0501072_0280953 3300049588 Bacteria 1324
482 Ga0501074_0043867 3300049590 Bacteria 3237
483 Ga0501074_0184143 3300049590 Bacteria 1489
484 Ga0501074_0243225 3300049590 Bacteria 1280
485 Ga0501075_0009936 3300049591 Bacteria 6670
486 Ga0501075_0169443 3300049591 Bacteria 1666
487 Ga0501076_0003210 3300049592 Bacteria 11415
488 Ga0501076_0114535 3300049592 Bacteria 2182
489 Ga0501077_0076540 3300049593 Bacteria 2119
490 Ga0501077_0273696 3300049593 Bacteria 1074
491 Ga0501079_0030411 3300049741 Bacteria 4148
492 Ga0501079_0041348 3300049741 Bacteria 3558
493 Ga0501079_0169156 3300049741 Bacteria 1704
494 Ga0501079_0179495 3300049741 Bacteria 1652
495 Ga0501079_0282583 3300049741 Bacteria 1298
496 Ga0501080_0028571 3300049742 Bacteria 5190
497 Ga0501080_0056264 3300049742 Bacteria 3664
498 Ga0501080_0075281 3300049742 Bacteria 3140
499 Ga0501081_0350194 3300049743 Bacteria 1088
500 Ga0501083_0212020 3300049744 Bacteria 1263
501 Ga0501045_0008760 3300049824 Bacteria 7060
502 Ga0501045_0030652 3300049824 Bacteria 3893
503 Ga0501045_0088142 3300049824 Bacteria 2292
504 Ga0501045_0128289 3300049824 Bacteria 1885
505 Ga0501045_0166961 3300049824 Bacteria 1639
506 nmdc:mga00v17_9265_c1 3300050491 Bacteria 5321
507 nmdc:mga0yw44_103757_c1 3300050492 Bacteria 1814
508 nmdc:mga0yw44_5403_c1 3300050492 Bacteria 6030
509 nmdc:mga0yw44_660_c1 3300050492 Bacteria 12561
510 nmdc:mga05p37_226289_c1 3300050507 Bacteria 2255
511 nmdc:mga05p37_3510_c1 3300050507 Bacteria 18322
512 nmdc:mga09592_2196_c1 3300050508 Bacteria 15712
513 nmdc:mga06r32_173464_c1 3300050510 Bacteria 2141
514 nmdc:mga06r32_7984_c1 3300050510 Bacteria 9515
515 nmdc:mga08y16_105261_c1 3300050511 Bacteria 2937
516 nmdc:mga08y16_123709_c1 3300050511 Bacteria 2692
517 nmdc:mga08y16_27106_c1 3300050511 Bacteria 6039
518 nmdc:mga08y16_3920_c1 3300050511 Bacteria 15490
519 nmdc:mga08y16_40150_c1 3300050511 Bacteria 4906
520 nmdc:mga0n895_28256_c1 3300050512 Bacteria 5335
521 nmdc:mga0n895_29869_c1 3300050512 Bacteria 5203
522 nmdc:mga0n895_369639_c1 3300050512 Bacteria 1452
523 nmdc:mga0n895_37006_c1 3300050512 Bacteria 4717
524 nmdc:mga0n895_64840_c1 3300050512 Bacteria 3614
525 nmdc:mga0n895_97305_c1 3300050512 Bacteria 2949
526 nmdc:mga0rr50_12702_c1 3300050513 Bacteria 5455
527 nmdc:mga0rr50_2435_c1 3300050513 Bacteria 10496
528 nmdc:mga0rr50_251560_c1 3300050513 Bacteria 1468
529 nmdc:mga08x19_289009_c1 3300050514 Bacteria 1137
530 nmdc:mga08x19_68597_c1 3300050514 Bacteria 2308
531 nmdc:mga0a205_17646_c1 3300050515 Bacteria 6699
532 nmdc:mga0a205_32659_c1 3300050515 Bacteria 4989
533 nmdc:mga0a205_34112_c1 3300050515 Bacteria 4882
534 nmdc:mga0a205_428569_c1 3300050515 Bacteria 1184
535 nmdc:mga0a205_86137_c1 3300050515 Bacteria 3034
536 Ga0495601_0039336 3300053077 Bacteria 2961
537 Ga0495612_0013892 3300053078 Bacteria 3244
538 Ga0495595_0004537 3300053084 Bacteria 5586
539 Ga0501084_0013156 3300054114 Bacteria 6846
540 Ga0501084_0022980 3300054114 Bacteria 5205
541 Ga0501084_0042935 3300054114 Bacteria 3782
542 Ga0501084_0411258 3300054114 Bacteria 1143
543 Ga0590075_006084 3300059424 Bacteria 2858
544 Ga0590077_008827 3300059426 Bacteria 2064
545 Ga0587070_009011 3300059491 Bacteria 1431
546 Ga0501082_0014487 3300060353 Bacteria 6789
547 Ga0501082_0026817 3300060353 Bacteria 4966
548 Ga0501082_0164379 3300060353 Bacteria 1929
549 Ga0501082_0264309 3300060353 Bacteria 1497
550 Ga0530510_0014954 3300061734 Bacteria 5479
551 Ga0530510_0086987 3300061734 Bacteria 2277
552 Ga0530510_0087957 3300061734 Bacteria 2264
553 Ga0530510_0161882 3300061734 Bacteria 1655
554 2643812913 2643221558 Bacteria 5460675
555 2734972294 2734482000 Bacteria 5525167
556 Ga0070686_100179139
557 JGI25407J50210_10001188
558 JGI25404J52841_10039189
559 Ga0065707_10020904
560 Ga0070658_10176445
561 Ga0070676_10117745
562 Ga0070676_10323591
563 Ga0070683_100014393
564 Ga0070683_100060526
565 Ga0070683_100236123
566 Ga0070690_100093573
567 Ga0068869_100169871
568 Ga0070680_100000018
569 Ga0070680_100027325
570 Ga0070680_100248184
571 Ga0068868_100107922
572 Ga0070660_100002783
573 Ga0070660_100027225
574 Ga0070661_100003995
575 Ga0070668_100108626
576 Ga0070668_100239627
577 Ga0070675_100233342
578 Ga0070675_100336770
579 Ga0070674_100255701
580 Ga0070674_100313243
581 Ga0070673_100026021
582 Ga0070688_100119051
583 Ga0070659_100011995
584 Ga0070659_100068981
585 Ga0070714_100010958
586 Ga0070714_100070166
587 Ga0070714_100460901
588 Ga0070700_100025393
589 Ga0070700_100115072
590 Ga0070694_100392592
591 Ga0070708_100055278
592 Ga0070678_100009257
593 Ga0070662_100166965
594 Ga0070681_10003547
595 Ga0070681_10250282
596 Ga0070685_10189589
597 Ga0070685_10235556
598 Ga0070706_100085043
599 Ga0070707_100060575
600 Ga0070707_100097176
601 Ga0070698_100036212
602 Ga0070699_100001426
603 Ga0070679_100013590
604 Ga0070684_100031687
605 Ga0070684_100032685
606 Ga0070684_100087881
607 Ga0070697_100079082
608 Ga0070672_100107641
609 Ga0070686_100032182
610 Ga0070695_100025222
611 Ga0070695_100177973
612 Ga0070695_100223867
613 Ga0070696_100001637
614 Ga0070696_100004430
615 Ga0070696_100030303
616 Ga0070696_100066601
617 Ga0070696_100417546
618 Ga0070693_100099690
619 Ga0070693_100143735
620 Ga0070665_100083355
621 Ga0070704_100061199
622 Ga0070704_100136645
623 Ga0068855_100094295
624 Ga0070664_100172207
625 Ga0068857_100129008
626 Ga0068854_100061420
627 Ga0068854_100096009
628 Ga0068856_100058209
629 Ga0068856_100212661
630 Ga0070702_100012037
631 Ga0070702_100019101
632 Ga0070702_100073090
633 Ga0068852_100041995
634 Ga0068852_100117506
635 Ga0068859_100047052
636 Ga0068859_100101456
637 Ga0068864_100106435
638 Ga0068864_100106910
639 Ga0068864_100244206
640 Ga0068866_10084526
641 Ga0068870_10135425
642 Ga0081455_10001385
643 Ga0081455_10005512
644 Ga0081455_10026205
645 Ga0081455_10048055
646 Ga0081455_10063570
647 Ga0081538_10000649
648 Ga0081538_10007025
649 Ga0081538_10051026
650 Ga0081540_1002348
651 Ga0070717_10012797
652 Ga0075365_10004392
653 Ga0075365_10011796
654 Ga0075365_10022410
655 Ga0075365_10031681
656 Ga0075365_10154319
657 Ga0075364_10051115
658 Ga0075364_10082512
659 Ga0075432_10009109
660 Ga0070712_100005819
661 Ga0070712_100077771
662 Ga0097621_100487830
663 Ga0068871_100200954
664 Ga0068871_100302777
665 Ga0075428_100005004
666 Ga0075428_100048614
667 Ga0075428_100080086
668 Ga0075431_100030660
669 Ga0075431_100089859
670 Ga0075431_100190357
671 Ga0075433_10038801
672 Ga0075433_10150673
673 Ga0075433_10230426
674 Ga0075433_10244237
675 Ga0075434_100031432
676 Ga0075434_100033553
677 Ga0075434_100037110
678 Ga0075434_100137850
679 Ga0075434_100147905
680 Ga0075434_100219392
681 Ga0075429_100009631
682 Ga0075436_100017906
683 Ga0075436_100020126
684 Ga0097620_100047054
685 Ga0097620_100101458
686 Ga0075435_100000895
687 Ga0075435_100050308
688 Ga0075435_100117783
689 Ga0105240_10174709
690 Ga0111539_10002146
691 Ga0111539_10014791
692 Ga0111539_10166832
693 Ga0105245_10003768
694 Ga0105245_10045132
695 Ga0105245_10047600
696 Ga0105245_10087138
697 Ga0105245_10132667
698 Ga0105245_10136288
699 Ga0105245_10191062
700 Ga0105247_10096736
701 Ga0114129_10059238
702 Ga0114129_10230577
703 Ga0114129_10421498
704 Ga0114129_10964790
705 Ga0105243_10089475
706 Ga0105243_10096559
707 Ga0105243_10393164
708 Ga0105242_10139781
709 Ga0105242_10560250
710 Ga0105248_10388595
711 Ga0105237_10011223
712 Ga0105237_10072802
713 Ga0105237_10282797
714 Ga0105238_10018586
715 Ga0105238_10037462
716 Ga0105238_10445816
717 Ga0105249_10025651
718 Ga0105249_10068402
719 Ga0105249_10369907
720 Ga0105249_10396449
721 Ga0105030_101719
722 Ga0105239_10181004
723 Ga0105239_10228454
724 Ga0105239_10244510
725 Ga0105239_10479016
726 Ga0105246_10003991
727 Ga0105246_10032961
728 Ga0157371_10063881
729 Ga0157370_10193577
730 Ga0157369_10037559
731 Ga0157369_10559542
732 Ga0157374_10072732
733 Ga0157374_10074223
734 Ga0157374_10128418
735 Ga0157378_10079697
736 Ga0157378_10109743
737 Ga0157372_10022825
738 Ga0157372_10089842
739 Ga0157375_10110632
740 Ga0157375_10148641
741 Ga0163163_10013072
742 Ga0163163_10049032
743 Ga0157380_10034866
744 Ga0157380_10497791
745 Ga0157377_10020287
746 Ga0157379_10006502
747 Ga0157379_10409153
748 Ga0157376_10009505
749 Ga0207653_10037214
750 Ga0207692_10069122
751 Ga0207710_10070309
752 Ga0207688_10005714
753 Ga0207688_10085189
754 Ga0207688_10085505
755 Ga0207643_10007579
756 Ga0207684_10121604
757 Ga0207684_10258183
758 Ga0207654_10031089
759 Ga0207707_10170985
760 Ga0207671_10020949
761 Ga0207693_10001111
762 Ga0207693_10005339
763 Ga0207693_10019813
764 Ga0207663_10065244
765 Ga0207660_10000001
766 Ga0207660_10050626
767 Ga0207660_10099108
768 Ga0207662_10005561
769 Ga0207662_10047689
770 Ga0207657_10026128
771 Ga0207657_10027299
772 Ga0207649_10181516
773 Ga0207649_10254940
774 Ga0207652_10067952
775 Ga0207646_10031718
776 Ga0207681_10396505
777 Ga0207694_10094498
778 Ga0207694_10098818
779 Ga0207659_10212456
780 Ga0207687_10001191
781 Ga0207687_10050058
782 Ga0207687_10099271
783 Ga0207687_10261230
784 Ga0207700_10038321
785 Ga0207664_10052283
786 Ga0207664_10562776
787 Ga0207706_10073832
788 Ga0207686_10029884
789 Ga0207686_10132802
790 Ga0207665_10002817
791 Ga0207689_10086973
792 Ga0207689_10188005
793 Ga0207661_10004606
794 Ga0207661_10139590
795 Ga0207667_10005419
796 Ga0207712_10073070
797 Ga0207668_10091198
798 Ga0207668_10163820
799 Ga0207668_10259224
800 Ga0207677_10043582
801 Ga0207677_10140458
802 Ga0207703_10572430
803 Ga0207639_10034485
804 Ga0207708_10018003
805 Ga0207708_10024303
806 Ga0207708_10038988
807 Ga0207708_10113648
808 Ga0207708_10204177
809 Ga0207702_10001525
810 Ga0207648_10051728
811 Ga0207676_10024502
812 Ga0207676_10060689
813 Ga0207674_10020515
814 Ga0207674_10127592
815 Ga0207674_10146878
816 Ga0207675_100086697
817 Ga0207675_100089294
818 Ga0207683_10013180
819 Ga0207683_10037429
820 Ga0207683_10039828
821 Ga0207683_10090750
822 Ga0207683_10326868
823 Ga0207698_10100828
824 Ga0209974_10010591
825 Ga0207428_10002352
826 Ga0207428_10021489
827 Ga0207428_10025482
828 Ga0268266_10134597
829 Ga0307408_100238994
830 Ga0307405_10047173
831 Ga0307413_10005138
832 Ga0307410_10028459
833 Ga0307406_10003222
834 Ga0307407_10011911
835 Ga0307412_10265098
836 Ga0307409_100032998
837 Ga0307416_100004079
838 Ga0307411_10003294
839 Ga0307411_10098155
840 Ga0307415_100044974
841 Ga0307415_100062748
842 Ga0373926_0036142
843 Ga0373944_0030744
844 Ga0373939_0059098
845 Ga0373945_0011572
846 Ga0373945_0020313
847 Ga0373953_0161798
848 Ga0373943_0161965
849 Ga0373955_0017342
850 Ga0373961_0117359
851 Ga0373924_0045707
852 Ga0373935_0006546
853 Ga0373927_0060013
854 Ga0373933_0008402
855 Ga0373947_0002753
856 Ga0373947_0011012
857 Ga0373937_0095238
858 Ga0373925_0041515
859 Ga0373925_0114451
860 Ga0395899_0002021
861 Ga0395899_0005076
862 Ga0395899_0016041
863 Ga0395900_0005702
864 Ga0395900_0014393
865 Ga0395900_0042949
866 Ga0395898_0001770
867 Ga0395898_0008349
868 Ga0395898_0014665
869 Ga0395898_0035344
870 Ga0395905_0005512
871 Ga0395905_0032471
872 Ga0395905_0143988
873 Ga0395901_0010557
874 Ga0395901_0012843
875 Ga0395901_0018846
876 Ga0395901_0027456
877 Ga0395901_0457095
878 Ga0395901_0743303
879 Ga0436365_0345358
880 Ga0451853_3422826
881 Ga0439448_0009102
882 Ga0451577_0252519
883 Ga0466972_0093277
884 Ga0453683_0101273
885 Ga0466960_0006463
886 Ga0466960_0068645
887 Ga0451576_0045907
888 Ga0466967_0067707
889 Ga0466967_0180711
890 Ga0466967_0232235
891 Ga0495592_0072864
892 Ga0495603_0002642
893 Ga0495603_0042355
894 Ga0495603_0068101
895 Ga0495603_0132388
896 Ga0495629_0026353
897 Ga0495641_0002221
898 Ga0495641_0014207
899 Ga0495641_0037210
900 Ga0495641_0052801
901 Ga0495651_0042133
902 Ga0495653_0080805
903 Ga0495580_0015102
904 Ga0495580_0096654
905 Ga0495582_0005239
906 Ga0495582_0014846
907 Ga0495639_0005319
908 Ga0495662_0000966
909 Ga0495594_0003329
910 Ga0495594_0021427
911 Ga0495594_0029663
912 Ga0495608_0024130
913 Ga0495616_0111123
914 Ga0495620_0095142
915 Ga0495630_0023737
916 Ga0495666_0039397
917 Ga0495652_0297212
918 Ga0495665_0004131
919 Ga0495586_0042915
920 Ga0495621_0051462
921 Ga0495645_0255333
922 Ga0495667_0001693
923 Ga0495656_0019728
924 Ga0495634_0001514
925 Ga0495635_0012117
926 Ga0495588_0001771
927 Ga0495588_0001956
928 Ga0495657_0015941
929 Ga0495646_0099689
930 Ga0495647_0001379
931 Ga0495658_0007834
932 Ga0495613_0002685
933 Ga0495624_0008016
934 Ga0495589_0053607
935 Ga0495600_0000905
936 Ga0495660_0120370
937 Ga0495581_0000401
938 Ga0495604_0290369
939 Ga0495674_0043543
940 Ga0495676_0003524
941 Ga0495676_0009898
942 Ga0495676_0154398
943 Ga0495680_0003355
944 Ga0495675_0206740
945 Ga0495677_0132244
946 Ga0495685_072658
947 Ga0495684_0008886
948 Ga0495593_0001325
949 Ga0495602_0090670
950 Ga0495614_0004406
951 Ga0496100_0002072
952 Ga0496100_0020693
953 Ga0496101_0000781
954 Ga0496101_0089266
955 Ga0496102_0028949
956 Ga0496102_0030679
957 Ga0496102_0101646
958 Ga0496102_0660536
959 Ga0496103_0007852
960 Ga0496103_0014771
961 Ga0496103_0032331
962 Ga0496104_0003949
963 Ga0496104_0016952
964 Ga0496105_0013618
965 Ga0496105_0021565
966 Ga0496105_0189792
967 Ga0496106_0004743
968 Ga0496106_0017973
969 Ga0496106_0034671
970 Ga0496106_0049377
971 Ga0496106_0055028
972 Ga0496106_0093218
973 Ga0496107_0004598
974 Ga0496107_0410164
975 Ga0496108_0002372
976 Ga0496108_0004711
977 Ga0496108_0009157
978 Ga0496109_0001588
979 Ga0496109_0007413
980 Ga0496109_0024716
981 Ga0496109_0056997
982 Ga0496109_0066985
983 Ga0496109_0231458
984 Ga0496109_0294717
985 Ga0496109_0411143
986 Ga0496110_0000112
987 Ga0496110_0001153
988 Ga0496110_0015283
989 Ga0496110_0017605
990 Ga0496111_0000091
991 Ga0496111_0001686
992 Ga0496111_0007362
993 Ga0496111_0014505
994 Ga0496112_0000278
995 Ga0496112_0003366
996 Ga0496112_0084065
997 Ga0496113_0004701
998 Ga0496113_0012054
999 Ga0496113_0014793
1000 Ga0496113_0030681
1001 Ga0496113_0091091
1002 Ga0496114_0010123
1003 Ga0496114_0031603
1004 Ga0496114_0034381
1005 Ga0496115_0006334
1006 Ga0496115_0029620
1007 Ga0496115_0168180
1008 Ga0501031_0093589
1009 Ga0501032_0247238
1010 Ga0501036_0128426
1011 Ga0501036_0155004
1012 Ga0501038_0462583
1013 Ga0501039_0012465
1014 Ga0501039_0062632
1015 Ga0501040_0020135
1016 Ga0501040_0029437
1017 Ga0501040_0053716
1018 Ga0501041_0004734
1019 Ga0501041_0156839
1020 Ga0501042_0002948
1021 Ga0501042_0049831
1022 Ga0501046_0347163
1023 Ga0501048_0014737
1024 Ga0501048_0060312
1025 Ga0501067_0025424
1026 Ga0501067_0134113
1027 Ga0501068_0046346
1028 Ga0501069_0009959
1029 Ga0501069_0144181
1030 Ga0501070_0136546
1031 Ga0501071_0003059
1032 Ga0501071_0017130
1033 Ga0501071_0024254
1034 Ga0501071_0135074
1035 Ga0501072_0014595
1036 Ga0501072_0280953
1037 Ga0501074_0043867
1038 Ga0501074_0184143
1039 Ga0501074_0243225
1040 Ga0501075_0009936
1041 Ga0501075_0169443
1042 Ga0501076_0003210
1043 Ga0501076_0114535
1044 Ga0501077_0076540
1045 Ga0501077_0273696
1046 Ga0501079_0030411
1047 Ga0501079_0041348
1048 Ga0501079_0169156
1049 Ga0501079_0179495
1050 Ga0501079_0282583
1051 Ga0501080_0028571
1052 Ga0501080_0056264
1053 Ga0501080_0075281
1054 Ga0501081_0350194
1055 Ga0501083_0212020
1056 Ga0501045_0008760
1057 Ga0501045_0030652
1058 Ga0501045_0088142
1059 Ga0501045_0128289
1060 Ga0501045_0166961
1061 nmdc:mga00v17_9265_c1
1062 nmdc:mga0yw44_103757_c1
1063 nmdc:mga0yw44_5403_c1
1064 nmdc:mga0yw44_660_c1
1065 nmdc:mga05p37_226289_c1
1066 nmdc:mga05p37_3510_c1
1067 nmdc:mga09592_2196_c1
1068 nmdc:mga06r32_173464_c1
1069 nmdc:mga06r32_7984_c1
1070 nmdc:mga08y16_105261_c1
1071 nmdc:mga08y16_123709_c1
1072 nmdc:mga08y16_27106_c1
1073 nmdc:mga08y16_3920_c1
1074 nmdc:mga08y16_40150_c1
1075 nmdc:mga0n895_28256_c1
1076 nmdc:mga0n895_29869_c1
1077 nmdc:mga0n895_369639_c1
1078 nmdc:mga0n895_37006_c1
1079 nmdc:mga0n895_64840_c1
1080 nmdc:mga0n895_97305_c1
1081 nmdc:mga0rr50_12702_c1
1082 nmdc:mga0rr50_2435_c1
1083 nmdc:mga0rr50_251560_c1
1084 nmdc:mga08x19_289009_c1
1085 nmdc:mga08x19_68597_c1
1086 nmdc:mga0a205_17646_c1
1087 nmdc:mga0a205_32659_c1
1088 nmdc:mga0a205_34112_c1
1089 nmdc:mga0a205_428569_c1
1090 nmdc:mga0a205_86137_c1
1091 Ga0495601_0039336
1092 Ga0495612_0013892
1093 Ga0495595_0004537
1094 Ga0501084_0013156
1095 Ga0501084_0022980
1096 Ga0501084_0042935
1097 Ga0501084_0411258
1098 Ga0590075_006084
1099 Ga0590077_008827
1100 Ga0587070_009011
1101 Ga0501082_0014487
1102 Ga0501082_0026817
1103 Ga0501082_0164379
1104 Ga0501082_0264309
1105 Ga0530510_0014954
1106 Ga0530510_0086987
1107 Ga0530510_0087957
1108 Ga0530510_0161882
1109 2643812913
1110 2734972294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8807 6 279
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.877 11 285
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8545 6 279
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8483 11 285
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8478 8 274
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9022 20 279 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8996 13 274 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8912 54 281 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8864 5 274 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8819 13 281 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538GNX0-F1-model_v4 ABC transporter permease 0.9855 21 272 GO:0005886
GO:0055085
AF-A0A838GB84-F1-model_v4 ABC transporter permease 0.9768 26 248 GO:0005886
GO:0055085
AF-A0A4P7GR72-F1-model_v4 ABC transporter permease 0.9766 21 283 GO:0005886
GO:0055085
AF-A0A6J4MWX8-F1-model_v4 Putrescine transport system permease protein PotH 0.9749 12 283 GO:0005886
GO:0055085
AF-A0A538GNX0-F1-model_v4 ABC transporter permease 0.9739 21 272 GO:0005886
GO:0055085

Map