F463072

General Info

Members Datasets Scaffolds Average Seq Length
555 237 1110 289

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100063329|Ga0070680_1000633294
Length 310
Sequence MRNKRLILALTGAVLCGLVAVMLVTKYLANVQAYTKDLNNVVVAKVEIPLGTKITVEQLTLAPIPNGSAPEGAFRKLEEVVGRVVVTPIGVREPITGLKLAPEGVGAGLTAVIPEGYRAMTVKVDDVVGVSGFVMPGSYVDVVAVIVPVGQGAAAQGPISKIVLQNIKVLASGAKLDSPENQREPSAVKAVTLQVTPEQAEKLVLAANESKLQLVMRNYGDQEDTQTRGANKSTLLGGDSVKPEPGATSEAKAPSLEGKPVAQKIQAKHRAAVNATAAPRVEKPVASVQAAPRKSVELIEGSKRRDVDIP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
180 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
202 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
208 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
215 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
221 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
222 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
223 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
224 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 19.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100063329 3300005336 Unclassified 3029
2 MRS1b_contig_194141 2162886011 Unclassified 1943
3 MBSR1b_contig_3204424 2162886012 Bacteria 6471
4 MBSR1b_contig_9480698 2162886012 Bacteria 1816
5 JGI24748J21848_1000011 3300002074 Bacteria 157004
6 JGI24034J26672_10000023 3300002239 Bacteria 115999
7 JGI24751J29686_10000016 3300002459 Bacteria 112162
8 Ga0058863_11425981 3300004799 Bacteria 1860
9 Ga0058861_11023071 3300004800 Bacteria 2129
10 Ga0058862_12798203 3300004803 Bacteria 4351
11 Ga0065714_10002184 3300005288 Bacteria 284511
12 Ga0065714_10064507 3300005288 Bacteria 46235
13 Ga0065712_10000138 3300005290 Bacteria 62583
14 Ga0065712_10003263 3300005290 Bacteria 5334
15 Ga0065712_10067743 3300005290 Bacteria 71369
16 Ga0065715_10089648 3300005293 Bacteria 9092
17 Ga0065715_10091076 3300005293 Bacteria 6146
18 Ga0065715_10091096 3300005293 Bacteria 6121
19 Ga0065715_10091434 3300005293 Bacteria 5798
20 Ga0065715_10092194 3300005293 Bacteria 5269
21 Ga0065715_10102223 3300005293 Bacteria 3134
22 Ga0065715_10131887 3300005293 Unclassified 1999
23 Ga0065707_10001679 3300005295 Bacteria 5819
24 Ga0065707_10120409 3300005295 Bacteria 2135
25 Ga0070676_10015454 3300005328 Bacteria 4212
26 Ga0070690_100003858 3300005330 Bacteria 8259
27 Ga0070690_100007062 3300005330 Bacteria 6408
28 Ga0070670_100031206 3300005331 Unclassified 4588
29 Ga0070670_100087200 3300005331 Unclassified 2682
30 Ga0070670_100149537 3300005331 Bacteria 2021
31 Ga0070670_100329744 3300005331 Unclassified 1338
32 Ga0070677_10052211 3300005333 Unclassified 1658
33 Ga0070677_10057746 3300005333 Viruses 1591
34 Ga0068869_100001134 3300005334 Bacteria 15545
35 Ga0068869_100004585 3300005334 Bacteria 8610
36 Ga0068869_100004939 3300005334 Bacteria 8342
37 Ga0068869_100005107 3300005334 Bacteria 8230
38 Ga0068869_100005957 3300005334 Bacteria 7707
39 Ga0068869_100028169 3300005334 Bacteria 3923
40 Ga0068869_100271161 3300005334 Bacteria 1362
41 Ga0070666_10004294 3300005335 Bacteria 8673
42 Ga0070682_100005348 3300005337 Bacteria 7145
43 Ga0070682_100007970 3300005337 Bacteria 5961
44 Ga0068868_100001927 3300005338 Bacteria 14251
45 Ga0068868_100074117 3300005338 Bacteria 2718
46 Ga0070660_100229262 3300005339 Bacteria 1511
47 Ga0070689_100000757 3300005340 Bacteria 19739
48 Ga0070689_100001358 3300005340 Bacteria 15535
49 Ga0070687_100002899 3300005343 Bacteria 6567
50 Ga0070687_100003916 3300005343 Bacteria 5857
51 Ga0070687_100104728 3300005343 Unclassified 1591
52 Ga0070661_100155871 3300005344 Bacteria 1728
53 Ga0070668_100101874 3300005347 Bacteria 2276
54 Ga0070675_100011477 3300005354 Bacteria 6937
55 Ga0070671_100008243 3300005355 Bacteria 8338
56 Ga0070674_100038860 3300005356 Bacteria 3210
57 Ga0070673_100001840 3300005364 Bacteria 12678
58 Ga0070673_100347969 3300005364 Unclassified 1315
59 Ga0070673_100439096 3300005364 Unclassified 1173
60 Ga0070688_100001029 3300005365 Bacteria 13993
61 Ga0070659_100016782 3300005366 Bacteria 5501
62 Ga0070659_100151490 3300005366 Bacteria 1892
63 Ga0070667_100018368 3300005367 Bacteria 5800
64 Ga0070701_10003837 3300005438 Bacteria 6003
65 Ga0070701_10009811 3300005438 Bacteria 4209
66 Ga0070701_10011431 3300005438 Bacteria 3969
67 Ga0070701_10026697 3300005438 Unclassified 2819
68 Ga0070701_10158790 3300005438 Bacteria 1308
69 Ga0070705_100013047 3300005440 Bacteria 4241
70 Ga0070705_100025268 3300005440 Unclassified 3218
71 Ga0070705_100029244 3300005440 Bacteria 3028
72 Ga0070705_100201916 3300005440 Unclassified 1364
73 Ga0070700_100000005 3300005441 Bacteria 233160
74 Ga0070700_100000246 3300005441 Bacteria 29595
75 Ga0070700_100026563 3300005441 Unclassified 3421
76 Ga0070700_100110214 3300005441 Bacteria 1829
77 Ga0070694_100000702 3300005444 Bacteria 18650
78 Ga0070694_100057850 3300005444 Bacteria 2636
79 Ga0070694_100072294 3300005444 Unclassified 2379
80 Ga0070694_100073775 3300005444 Unclassified 2357
81 Ga0070694_100096205 3300005444 Bacteria 2087
82 Ga0070694_100113456 3300005444 Bacteria 1934
83 Ga0070694_100216204 3300005444 Bacteria 1436
84 Ga0070708_100238585 3300005445 Bacteria 1707
85 Ga0070662_100036351 3300005457 Viruses 3483
86 Ga0070681_10003280 3300005458 Bacteria 15110
87 Ga0070681_10022082 3300005458 Bacteria 6386
88 Ga0070681_10053306 3300005458 Unclassified 4030
89 Ga0070681_10151633 3300005458 Bacteria 2244
90 Ga0068867_100001395 3300005459 Bacteria 16720
91 Ga0070685_10001321 3300005466 Bacteria 13028
92 Ga0070706_100000490 3300005467 Bacteria 46631
93 Ga0070706_100001794 3300005467 Bacteria 22223
94 Ga0070706_100008985 3300005467 Bacteria 9303
95 Ga0070706_100099309 3300005467 Bacteria 2705
96 Ga0070707_100122237 3300005468 Bacteria 2528
97 Ga0070707_100198559 3300005468 Bacteria 1955
98 Ga0070707_100204652 3300005468 Bacteria 1924
99 Ga0070698_100002390 3300005471 Bacteria 20678
100 Ga0070698_100007491 3300005471 Bacteria 11810
101 Ga0070698_100019424 3300005471 Bacteria 7133
102 Ga0070699_100000886 3300005518 Bacteria 27920
103 Ga0070699_100006028 3300005518 Bacteria 10597
104 Ga0070699_100039076 3300005518 Unclassified 4109
105 Ga0070699_100058325 3300005518 Bacteria 3344
106 Ga0070699_100118519 3300005518 Bacteria 2327
107 Ga0070679_100000783 3300005530 Bacteria 27643
108 Ga0070697_100000185 3300005536 Bacteria 51425
109 Ga0070697_100000687 3300005536 Bacteria 25341
110 Ga0070697_100025082 3300005536 Bacteria 4753
111 Ga0070697_100056690 3300005536 Bacteria 3188
112 Ga0070697_100281603 3300005536 Unclassified 1427
113 Ga0070697_100363219 3300005536 Bacteria 1252
114 Ga0068853_100008289 3300005539 Bacteria 8342
115 Ga0068853_100122619 3300005539 Unclassified 2320
116 Ga0068853_100619714 3300005539 Unclassified 1028
117 Ga0070672_100001162 3300005543 Bacteria 16070
118 Ga0070672_100201897 3300005543 Unclassified 1663
119 Ga0070686_100001979 3300005544 Bacteria 11372
120 Ga0070686_100011682 3300005544 Bacteria 4988
121 Ga0070686_100099377 3300005544 Bacteria 1963
122 Ga0070695_100012231 3300005545 Bacteria 5147
123 Ga0070695_100013214 3300005545 Bacteria 4961
124 Ga0070695_100022457 3300005545 Bacteria 3870
125 Ga0070695_100035361 3300005545 Bacteria 3138
126 Ga0070696_100001694 3300005546 Bacteria 14460
127 Ga0070696_100009930 3300005546 Bacteria 6368
128 Ga0070696_100059562 3300005546 Bacteria 2669
129 Ga0070696_100068299 3300005546 Bacteria 2495
130 Ga0070696_100077048 3300005546 Bacteria 2355
131 Ga0070696_100090668 3300005546 Unclassified 2175
132 Ga0070696_100264026 3300005546 Bacteria 1307
133 Ga0070693_100001815 3300005547 Bacteria 9742
134 Ga0070693_100011987 3300005547 Bacteria 4377
135 Ga0070693_100066455 3300005547 Unclassified 2110
136 Ga0070693_100115709 3300005547 Bacteria 1656
137 Ga0070704_100022440 3300005549 Bacteria 4108
138 Ga0070704_100064924 3300005549 Bacteria 2626
139 Ga0070704_100240758 3300005549 Unclassified 1480
140 Ga0070664_100015818 3300005564 Bacteria 6175
141 Ga0070664_100016598 3300005564 Bacteria 6040
142 Ga0070664_100317334 3300005564 Bacteria 1411
143 Ga0068857_100006516 3300005577 Bacteria 10018
144 Ga0068857_100070370 3300005577 Bacteria 3116
145 Ga0068857_100093751 3300005577 Bacteria 2688
146 Ga0068857_100104790 3300005577 Bacteria 2539
147 Ga0068857_100581134 3300005577 Unclassified 1057
148 Ga0068856_100193532 3300005614 Bacteria 2047
149 Ga0070702_100001343 3300005615 Bacteria 10006
150 Ga0070702_100005570 3300005615 Bacteria 5885
151 Ga0070702_100095652 3300005615 Bacteria 1811
152 Ga0070702_100103749 3300005615 Viruses 1749
153 Ga0068859_100002274 3300005617 Bacteria 19488
154 Ga0068859_100002572 3300005617 Bacteria 18441
155 Ga0068859_100009483 3300005617 Bacteria 9830
156 Ga0068859_100029378 3300005617 Bacteria 5516
157 Ga0068859_100052454 3300005617 Bacteria 4100
158 Ga0068859_100068106 3300005617 Bacteria 3595
159 Ga0068859_100228744 3300005617 Bacteria 1948
160 Ga0068859_100255007 3300005617 Bacteria 1845
161 Ga0068859_100493714 3300005617 Bacteria 1319
162 Ga0068864_100004370 3300005618 Bacteria 11600
163 Ga0068864_100008800 3300005618 Bacteria 8324
164 Ga0068864_100037047 3300005618 Unclassified 4160
165 Ga0068864_100136739 3300005618 Bacteria 2207
166 Ga0068864_100270908 3300005618 Unclassified 1582
167 Ga0068864_100419266 3300005618 Bacteria 1275
168 Ga0068864_100460451 3300005618 Unclassified 1217
169 Ga0068864_100665894 3300005618 Unclassified 1014
170 Ga0068861_100005529 3300005719 Bacteria 8560
171 Ga0068861_100056055 3300005719 Unclassified 3007
172 Ga0068851_10024069 3300005834 Bacteria 2980
173 Ga0068870_10002719 3300005840 Bacteria 7419
174 Ga0068870_10004018 3300005840 Bacteria 6281
175 Ga0068870_10061536 3300005840 Bacteria 2018
176 Ga0068863_100001568 3300005841 Bacteria 22602
177 Ga0068863_100051109 3300005841 Bacteria 3918
178 Ga0068863_100133452 3300005841 Bacteria 2371
179 Ga0068863_100194737 3300005841 Bacteria 1948
180 Ga0068858_100000213 3300005842 Bacteria 62602
181 Ga0068858_100002896 3300005842 Bacteria 17256
182 Ga0068858_100038922 3300005842 Bacteria 4410
183 Ga0068858_100094037 3300005842 Unclassified 2791
184 Ga0068858_100170476 3300005842 Unclassified 2052
185 Ga0068858_100193351 3300005842 Bacteria 1922
186 Ga0068858_100199656 3300005842 Bacteria 1891
187 Ga0068860_100003898 3300005843 Bacteria 15330
188 Ga0068860_100021265 3300005843 Bacteria 6284
189 Ga0068860_100195261 3300005843 Bacteria 1960
190 Ga0068860_100278137 3300005843 Bacteria 1635
191 Ga0068862_100080330 3300005844 Bacteria 2828
192 Ga0068862_100096390 3300005844 Bacteria 2582
193 Ga0081539_10000022 3300005985 Bacteria 356710
194 Ga0081539_10000490 3300005985 Bacteria 83577
195 Ga0081539_10029862 3300005985 Bacteria 3397
196 Ga0081539_10061606 3300005985 Bacteria 2054
197 Ga0070715_10000018 3300006163 Bacteria 124487
198 Ga0070715_10000031 3300006163 Bacteria 86230
199 Ga0070716_100000007 3300006173 Bacteria 256300
200 Ga0070716_100076485 3300006173 Bacteria 1984
201 Ga0097621_100001152 3300006237 Bacteria 18368
202 Ga0097621_100001228 3300006237 Bacteria 17759
203 Ga0068871_100001871 3300006358 Bacteria 14234
204 Ga0068871_100052600 3300006358 Bacteria 3299
205 Ga0075430_100021529 3300006846 Bacteria 5480
206 Ga0075430_100286490 3300006846 Unclassified 1363
207 Ga0075433_10048943 3300006852 Bacteria 3676
208 Ga0075433_10134131 3300006852 Bacteria 2201
209 Ga0075434_100037822 3300006871 Bacteria 4777
210 Ga0075434_100182238 3300006871 Unclassified 2120
211 Ga0075429_100152602 3300006880 Unclassified 2022
212 Ga0075429_100336748 3300006880 Bacteria 1320
213 Ga0068865_100008245 3300006881 Bacteria 6433
214 Ga0068865_100100234 3300006881 Bacteria 2119
215 Ga0097620_100002274 3300006931 Bacteria 19488
216 Ga0097620_100002571 3300006931 Bacteria 18441
217 Ga0097620_100009483 3300006931 Bacteria 9830
218 Ga0097620_100029376 3300006931 Bacteria 5516
219 Ga0097620_100052455 3300006931 Bacteria 4100
220 Ga0097620_100068106 3300006931 Bacteria 3595
221 Ga0097620_100228727 3300006931 Bacteria 1948
222 Ga0097620_100255012 3300006931 Bacteria 1845
223 Ga0097620_100493700 3300006931 Bacteria 1319
224 Ga0075435_100119842 3300007076 Unclassified 2195
225 Ga0075435_100141190 3300007076 Bacteria 2021
226 Ga0105251_10041302 3300009011 Bacteria 2246
227 Ga0105251_10076553 3300009011 Unclassified 1552
228 Ga0111539_10000363 3300009094 Bacteria 55793
229 Ga0111539_10008997 3300009094 Bacteria 12641
230 Ga0105245_10006962 3300009098 Bacteria 9916
231 Ga0105245_10171172 3300009098 Bacteria 2068
232 Ga0105245_10462886 3300009098 Bacteria 1278
233 Ga0105245_10554279 3300009098 Unclassified 1172
234 Ga0105247_10000003 3300009101 Bacteria 694517
235 Ga0105247_10000777 3300009101 Bacteria 24525
236 Ga0105247_10210253 3300009101 Unclassified 1312
237 Ga0114129_10001544 3300009147 Bacteria 31206
238 Ga0114129_10007188 3300009147 Bacteria 15845
239 Ga0114129_10066866 3300009147 Bacteria 5012
240 Ga0114129_10171344 3300009147 Bacteria 2959
241 Ga0114129_10196428 3300009147 Bacteria 2735
242 Ga0114129_10324397 3300009147 Unclassified 2046
243 Ga0114129_10583201 3300009147 Unclassified 1451
244 Ga0114129_10676943 3300009147 Unclassified 1329
245 Ga0114129_11141176 3300009147 Unclassified 974
246 Ga0105243_10002703 3300009148 Bacteria 14739
247 Ga0105243_10004079 3300009148 Bacteria 11635
248 Ga0105243_10012601 3300009148 Bacteria 6389
249 Ga0105243_10104763 3300009148 Bacteria 2355
250 Ga0105243_10424593 3300009148 Bacteria 1241
251 Ga0105241_10081243 3300009174 Unclassified 2538
252 Ga0105241_10229458 3300009174 Bacteria 1564
253 Ga0105242_10002343 3300009176 Bacteria 14949
254 Ga0105242_10092273 3300009176 Bacteria 2551
255 Ga0105242_10126542 3300009176 Unclassified 2200
256 Ga0105242_10590020 3300009176 Bacteria 1071
257 Ga0105248_10004483 3300009177 Bacteria 15449
258 Ga0105248_10006348 3300009177 Bacteria 12967
259 Ga0105248_10020878 3300009177 Bacteria 7258
260 Ga0105248_10094080 3300009177 Bacteria 3375
261 Ga0105248_10232947 3300009177 Bacteria 2073
262 Ga0105248_10243761 3300009177 Bacteria 2023
263 Ga0105248_10552913 3300009177 Unclassified 1298
264 Ga0105237_10000767 3300009545 Bacteria 43919
265 Ga0105237_10114086 3300009545 Bacteria 2695
266 Ga0105237_10238562 3300009545 Bacteria 1819
267 Ga0105238_10015460 3300009551 Bacteria 7724
268 Ga0105238_10042177 3300009551 Bacteria 4621
269 Ga0105249_10010434 3300009553 Bacteria 8166
270 Ga0105249_10015841 3300009553 Bacteria 6680
271 Ga0105249_10204955 3300009553 Bacteria 1932
272 Ga0105239_10044951 3300010375 Bacteria 4840
273 Ga0105239_10173333 3300010375 Unclassified 2413
274 Ga0105239_10239083 3300010375 Bacteria 2038
275 Ga0105239_10587791 3300010375 Bacteria 1269
276 Ga0105246_10023933 3300011119 Bacteria 3959
277 Ga0105246_10061686 3300011119 Bacteria 2610
278 Ga0157373_10209568 3300013100 Bacteria 1374
279 Ga0157374_10471745 3300013296 Bacteria 1257
280 Ga0157378_10000113 3300013297 Bacteria 77834
281 Ga0157378_10002637 3300013297 Bacteria 15983
282 Ga0157378_10066725 3300013297 Bacteria 3223
283 Ga0157378_10099126 3300013297 Bacteria 2658
284 Ga0157378_10281567 3300013297 Bacteria 1603
285 Ga0163162_10011556 3300013306 Bacteria 8613
286 Ga0163162_10013845 3300013306 Bacteria 7879
287 Ga0163162_10013897 3300013306 Bacteria 7864
288 Ga0163162_10102064 3300013306 Bacteria 2961
289 Ga0163162_10116333 3300013306 Bacteria 2774
290 Ga0163162_10235682 3300013306 Bacteria 1961
291 Ga0157372_10018380 3300013307 Bacteria 7513
292 Ga0157372_10396812 3300013307 Unclassified 1608
293 Ga0157375_10000784 3300013308 Bacteria 27774
294 Ga0157375_10014222 3300013308 Bacteria 7093
295 Ga0157375_10211790 3300013308 Bacteria 2095
296 Ga0157375_10642973 3300013308 Bacteria 1217
297 Ga0163163_10002364 3300014325 Bacteria 15966
298 Ga0163163_10009368 3300014325 Bacteria 8739
299 Ga0163163_10015079 3300014325 Bacteria 7131
300 Ga0163163_10029788 3300014325 Bacteria 5252
301 Ga0163163_10043123 3300014325 Unclassified 4421
302 Ga0163163_10682715 3300014325 Unclassified 1090
303 Ga0157380_10002257 3300014326 Bacteria 12958
304 Ga0157380_10005496 3300014326 Bacteria 8857
305 Ga0157380_10090383 3300014326 Bacteria 2526
306 Ga0157380_10172956 3300014326 Bacteria 1889
307 Ga0157380_10218990 3300014326 Unclassified 1702
308 Ga0157377_10016377 3300014745 Bacteria 3813
309 Ga0157379_10487407 3300014968 Bacteria 1141
310 Ga0157376_10022082 3300014969 Bacteria 4953
311 Ga0163161_10000604 3300017792 Bacteria 28728
312 Ga0213876_10000111 3300021384 Bacteria 89727
313 Ga0213876_10000325 3300021384 Bacteria 41745
314 Ga0207672_1000021 3300025223 Bacteria 19763
315 Ga0207697_10023797 3300025315 Bacteria 2508
316 Ga0207656_10018486 3300025321 Bacteria 2746
317 Ga0207653_10006721 3300025885 Bacteria 3593
318 Ga0207653_10022425 3300025885 Unclassified 2005
319 Ga0207682_10156034 3300025893 Bacteria 1032
320 Ga0207710_10000001 3300025900 Bacteria 1797433
321 Ga0207710_10002652 3300025900 Bacteria 8248
322 Ga0207688_10034077 3300025901 Unclassified 2818
323 Ga0207680_10012917 3300025903 Bacteria 4268
324 Ga0207647_10045917 3300025904 Unclassified 2724
325 Ga0207685_10000007 3300025905 Bacteria 278341
326 Ga0207685_10000022 3300025905 Bacteria 125184
327 Ga0207645_10194210 3300025907 Unclassified 1334
328 Ga0207643_10001868 3300025908 Bacteria 11652
329 Ga0207643_10014846 3300025908 Bacteria 4235
330 Ga0207643_10088600 3300025908 Bacteria 1802
331 Ga0207643_10101898 3300025908 Unclassified 1684
332 Ga0207684_10000172 3300025910 Bacteria 106888
333 Ga0207684_10052193 3300025910 Bacteria 3470
334 Ga0207684_10079598 3300025910 Bacteria 2787
335 Ga0207684_10228690 3300025910 Unclassified 1605
336 Ga0207684_10341673 3300025910 Bacteria 1289
337 Ga0207684_10455921 3300025910 Bacteria 1097
338 Ga0207654_10122442 3300025911 Bacteria 1635
339 Ga0207707_10000022 3300025912 Bacteria 198808
340 Ga0207707_10010498 3300025912 Bacteria 8038
341 Ga0207707_10029430 3300025912 Unclassified 4802
342 Ga0207671_10001070 3300025914 Bacteria 33237
343 Ga0207671_10079051 3300025914 Bacteria 2464
344 Ga0207671_10158001 3300025914 Bacteria 1754
345 Ga0207660_10059707 3300025917 Unclassified 2739
346 Ga0207662_10003386 3300025918 Bacteria 8192
347 Ga0207649_10070188 3300025920 Bacteria 2233
348 Ga0207649_10337945 3300025920 Bacteria 1111
349 Ga0207652_10000342 3300025921 Bacteria 48463
350 Ga0207646_10067498 3300025922 Unclassified 3193
351 Ga0207646_10112670 3300025922 Unclassified 2442
352 Ga0207646_10119518 3300025922 Bacteria 2367
353 Ga0207681_10022082 3300025923 Bacteria 4054
354 Ga0207694_10163736 3300025924 Unclassified 1798
355 Ga0207694_10403594 3300025924 Bacteria 1137
356 Ga0207650_10000009 3300025925 Bacteria 483583
357 Ga0207650_10039274 3300025925 Bacteria 3459
358 Ga0207650_10040731 3300025925 Bacteria 3401
359 Ga0207650_10084855 3300025925 Bacteria 2408
360 Ga0207650_10270135 3300025925 Unclassified 1382
361 Ga0207659_10020672 3300025926 Bacteria 4355
362 Ga0207687_10004125 3300025927 Bacteria 9726
363 Ga0207644_10000095 3300025931 Bacteria 64023
364 Ga0207644_10035519 3300025931 Bacteria 3493
365 Ga0207686_10003330 3300025934 Bacteria 8636
366 Ga0207686_10004186 3300025934 Bacteria 7737
367 Ga0207686_10139165 3300025934 Bacteria 1675
368 Ga0207709_10001080 3300025935 Bacteria 20038
369 Ga0207709_10004310 3300025935 Bacteria 8242
370 Ga0207709_10004715 3300025935 Bacteria 7834
371 Ga0207709_10006193 3300025935 Bacteria 6735
372 Ga0207709_10221632 3300025935 Bacteria 1364
373 Ga0207670_10000776 3300025936 Bacteria 16778
374 Ga0207670_10000982 3300025936 Bacteria 15067
375 Ga0207670_10512452 3300025936 Bacteria 976
376 Ga0207669_10228480 3300025937 Bacteria 1371
377 Ga0207704_10002642 3300025938 Bacteria 8087
378 Ga0207704_10040864 3300025938 Bacteria 2715
379 Ga0207665_10000018 3300025939 Bacteria 122653
380 Ga0207691_10003845 3300025940 Bacteria 14567
381 Ga0207691_10139139 3300025940 Bacteria 2140
382 Ga0207711_10012927 3300025941 Bacteria 6934
383 Ga0207711_10047603 3300025941 Bacteria 3667
384 Ga0207711_10062370 3300025941 Bacteria 3215
385 Ga0207711_10083213 3300025941 Bacteria 2799
386 Ga0207689_10002314 3300025942 Bacteria 17847
387 Ga0207689_10011031 3300025942 Bacteria 7767
388 Ga0207689_10015622 3300025942 Bacteria 6430
389 Ga0207689_10015777 3300025942 Bacteria 6395
390 Ga0207689_10024428 3300025942 Bacteria 5071
391 Ga0207689_10034263 3300025942 Unclassified 4217
392 Ga0207689_10041908 3300025942 Bacteria 3788
393 Ga0207689_10070808 3300025942 Unclassified 2864
394 Ga0207689_10210904 3300025942 Bacteria 1605
395 Ga0207679_10291135 3300025945 Unclassified 1404
396 Ga0207651_10006635 3300025960 Bacteria 6084
397 Ga0207651_10026437 3300025960 Bacteria 3626
398 Ga0207651_10343173 3300025960 Unclassified 1255
399 Ga0207712_10005808 3300025961 Bacteria 7778
400 Ga0207712_10026761 3300025961 Bacteria 3846
401 Ga0207668_10385987 3300025972 Bacteria 1180
402 Ga0207640_10021160 3300025981 Bacteria 3872
403 Ga0207658_10042609 3300025986 Bacteria 3294
404 Ga0207677_10055642 3300026023 Bacteria 2706
405 Ga0207677_10184896 3300026023 Unclassified 1642
406 Ga0207703_10000055 3300026035 Bacteria 143420
407 Ga0207703_10138032 3300026035 Unclassified 2113
408 Ga0207703_10147016 3300026035 Bacteria 2051
409 Ga0207639_10004389 3300026041 Bacteria 9520
410 Ga0207639_10059671 3300026041 Unclassified 2940
411 Ga0207639_10199261 3300026041 Bacteria 1716
412 Ga0207708_10000017 3300026075 Bacteria 190414
413 Ga0207708_10000528 3300026075 Bacteria 29471
414 Ga0207708_10054040 3300026075 Bacteria 3061
415 Ga0207708_10068098 3300026075 Bacteria 2724
416 Ga0207708_10075299 3300026075 Bacteria 2588
417 Ga0207708_10165498 3300026075 Bacteria 1748
418 Ga0207708_10176701 3300026075 Unclassified 1694
419 Ga0207708_10256050 3300026075 Bacteria 1412
420 Ga0207702_10036654 3300026078 Bacteria 4103
421 Ga0207641_10003938 3300026088 Bacteria 12980
422 Ga0207641_10021719 3300026088 Bacteria 5275
423 Ga0207641_10114140 3300026088 Bacteria 2400
424 Ga0207641_10594172 3300026088 Unclassified 1083
425 Ga0207648_10034347 3300026089 Bacteria 4470
426 Ga0207648_10040512 3300026089 Bacteria 4093
427 Ga0207648_10095671 3300026089 Bacteria 2598
428 Ga0207648_10310535 3300026089 Viruses 1415
429 Ga0207676_10001022 3300026095 Bacteria 21425
430 Ga0207676_10003062 3300026095 Bacteria 11924
431 Ga0207676_10016141 3300026095 Bacteria 5403
432 Ga0207676_10175567 3300026095 Unclassified 1871
433 Ga0207676_10351071 3300026095 Bacteria 1364
434 Ga0207674_10004393 3300026116 Bacteria 16998
435 Ga0207674_10018690 3300026116 Bacteria 7526
436 Ga0207674_10066891 3300026116 Bacteria 3619
437 Ga0207674_10095301 3300026116 Bacteria 2962
438 Ga0207674_10668657 3300026116 Unclassified 1003
439 Ga0207675_100001018 3300026118 Bacteria 27768
440 Ga0207675_100054501 3300026118 Bacteria 3730
441 Ga0207428_10011380 3300027907 Bacteria 7864
442 Ga0207428_10060893 3300027907 Unclassified 2990
443 Ga0268265_10059469 3300028380 Bacteria 2924
444 Ga0268265_10116829 3300028380 Bacteria 2190
445 Ga0268264_10011924 3300028381 Bacteria 7160
446 Ga0268264_10044626 3300028381 Bacteria 3677
447 Ga0268264_10046515 3300028381 Bacteria 3604
448 Ga0268264_10222933 3300028381 Unclassified 1737
449 Ga0268264_10283524 3300028381 Bacteria 1553
450 Ga0307408_100037346 3300031548 Bacteria 3421
451 Ga0307408_100106631 3300031548 Bacteria 2144
452 Ga0307405_10155787 3300031731 Bacteria 1612
453 Ga0307405_10187728 3300031731 Bacteria 1490
454 Ga0307410_10103990 3300031852 Bacteria 2041
455 Ga0307410_10119766 3300031852 Bacteria 1918
456 Ga0307406_10122434 3300031901 Unclassified 1811
457 Ga0307406_10139000 3300031901 Bacteria 1716
458 Ga0307407_10259321 3300031903 Unclassified 1195
459 Ga0307412_10112820 3300031911 Bacteria 1944
460 Ga0307416_100132052 3300032002 Bacteria 2250
461 Ga0307416_100273948 3300032002 Bacteria 1659
462 Ga0307414_10016422 3300032004 Unclassified 4499
463 Ga0307414_10067171 3300032004 Bacteria 2567
464 Ga0307411_10173250 3300032005 Bacteria 1630
465 Ga0307415_100185311 3300032126 Unclassified 1637
466 Ga0373940_0049593 3300035088 Bacteria 1176
467 Ga0373932_0074718 3300035112 Unclassified 1059
468 Ga0395899_0153362 3300037312 Unclassified 1632
469 Ga0395900_0059602 3300037418 Unclassified 3930
470 Ga0395898_0076328 3300037466 Bacteria 3236
471 Ga0395901_0087483 3300038443 Bacteria 3258
472 Ga0395901_0125518 3300038443 Unclassified 2697
473 Ga0242419_000478 3300038698 Bacteria 2173
474 Ga0242422_00032 3300038699 Bacteria 5423
475 Ga0436365_0407503 3300039437 Bacteria 219857
476 Ga0436365_1230778 3300039437 Bacteria 38145
477 Ga0439455_0028467 3300042012 Bacteria 1376
478 Ga0439462_0007984 3300042015 Unclassified 2661
479 Ga0450889_005416 3300042144 Unclassified 1272
480 Ga0439458_0001962 3300042157 Bacteria 5101
481 Ga0439458_0003929 3300042157 Bacteria 3433
482 Ga0439434_0018158 3300042435 Bacteria 2104
483 Ga0453683_0049852 3300044673 Bacteria 2624
484 Ga0453683_0212949 3300044673 Bacteria 1228
485 Ga0451576_0968632 3300045051 Unclassified 892
486 Ga0495610_0058594 3300046512 Bacteria 1842
487 Ga0495663_0000602 3300046525 Bacteria 12559
488 Ga0495598_0000902 3300046537 Bacteria 5723
489 Ga0495621_0000030 3300046539 Bacteria 27481
490 Ga0496102_0435904 3300048905 Bacteria 1230
491 Ga0496104_0114931 3300048907 Bacteria 2582
492 Ga0496106_0020912 3300048909 Bacteria 4856
493 Ga0496106_0141666 3300048909 Unclassified 1891
494 Ga0496108_0175910 3300048911 Bacteria 1853
495 Ga0496110_0178641 3300048913 Unclassified 1927
496 Ga0496112_0025490 3300048915 Bacteria 5678
497 Ga0496112_0112565 3300048915 Bacteria 2692
498 Ga0496112_0215290 3300048915 Bacteria 1878
499 Ga0496112_0478258 3300048915 Unclassified 1182
500 Ga0496113_0081242 3300048916 Unclassified 2484
501 Ga0496113_0108504 3300048916 Unclassified 2158
502 Ga0501306_003941 3300049127 Unclassified 1634
503 Ga0501298_002265 3300049521 Bacteria 2903
504 Ga0501312_005578 3300049528 Bacteria 1535
505 Ga0501038_0006538 3300049574 Bacteria 10783
506 Ga0501198_002128 3300049649 Bacteria 2640
507 Ga0501202_002693 3300049652 Unclassified 3000
508 Ga0501207_006773 3300049654 Bacteria 1618
509 Ga0501207_023816 3300049654 Bacteria 995
510 Ga0501209_003573 3300049656 Bacteria 2588
511 Ga0501216_002932 3300049660 Bacteria 2459
512 Ga0501223_009969 3300049663 Bacteria 1917
513 Ga0501224_003999 3300049664 Unclassified 2077
514 Ga0501227_008399 3300049665 Bacteria 2213
515 Ga0501233_003545 3300049668 Bacteria 2810
516 Ga0501235_017653 3300049669 Bacteria 1579
517 Ga0501236_011433 3300049670 Bacteria 1179
518 Ga0501240_005600 3300049673 Bacteria 1510
519 Ga0501243_003165 3300049675 Bacteria 2432
520 Ga0501249_001515 3300049679 Bacteria 4769
521 Ga0501221_005327 3300049704 Unclassified 2147
522 Ga0501225_0003070 3300049705 Bacteria 5100
523 Ga0501225_0014857 3300049705 Bacteria 2171
524 Ga0501229_013516 3300049706 Bacteria 1049
525 Ga0501245_003498 3300049708 Bacteria 2136
526 Ga0501241_008892 3300049758 Bacteria 1831
527 Ga0501263_001926 3300049760 Bacteria 2052
528 Ga0501267_007028 3300049764 Unclassified 1089
529 nmdc:mga05p37_372523_c1 3300050507 Unclassified 1675
530 nmdc:mga05p37_43084_c1 3300050507 Bacteria 5550
531 nmdc:mga05p37_54468_c1 3300050507 Unclassified 4921
532 nmdc:mga05p37_563623_c1 3300050507 Bacteria 1294
533 nmdc:mga05p37_67548_c1 3300050507 Unclassified 4398
534 nmdc:mga05p37_690759_c1 3300050507 Unclassified 1135
535 nmdc:mga09592_20950_c1 3300050508 Bacteria 5383
536 nmdc:mga09592_271014_c1 3300050508 Bacteria 1472
537 nmdc:mga0qj67_254051_c1 3300050509 Bacteria 1426
538 nmdc:mga0qj67_54870_c1 3300050509 Unclassified 3156
539 nmdc:mga06r32_78102_c1 3300050510 Unclassified 3217
540 nmdc:mga08y16_1742_c1 3300050511 Bacteria 22070
541 nmdc:mga08y16_23388_c1 3300050511 Bacteria 6528
542 nmdc:mga08y16_73462_c1 3300050511 Unclassified 3564
543 nmdc:mga0n895_18579_c1 3300050512 Bacteria 6437
544 nmdc:mga0n895_270578_c1 3300050512 Bacteria 1723
545 nmdc:mga0n895_424819_c1 3300050512 Unclassified 1343
546 nmdc:mga0rr50_157664_c1 3300050513 Unclassified 1840
547 nmdc:mga08x19_38241_c1 3300050514 Bacteria 3048
548 nmdc:mga0a205_11752_c1 3300050515 Bacteria 8076
549 nmdc:mga0a205_302818_c1 3300050515 Bacteria 1471
550 nmdc:mga0a205_436693_c1 3300050515 Bacteria 1170
551 nmdc:mga0a205_98171_c1 3300050515 Bacteria 2828
552 Ga0587066_001503 3300059490 Unclassified 2358
553 Ga0587068_002583 3300059641 Unclassified 2218
554 Ga0587111_0000296 3300060346 Bacteria 4296
555 Ga0530510_0225855 3300061734 Unclassified 1392
556 Ga0070680_100063329
557 MRS1b_contig_194141
558 MBSR1b_contig_3204424
559 MBSR1b_contig_9480698
560 JGI24748J21848_1000011
561 JGI24034J26672_10000023
562 JGI24751J29686_10000016
563 Ga0058863_11425981
564 Ga0058861_11023071
565 Ga0058862_12798203
566 Ga0065714_10002184
567 Ga0065714_10064507
568 Ga0065712_10000138
569 Ga0065712_10003263
570 Ga0065712_10067743
571 Ga0065715_10089648
572 Ga0065715_10091076
573 Ga0065715_10091096
574 Ga0065715_10091434
575 Ga0065715_10092194
576 Ga0065715_10102223
577 Ga0065715_10131887
578 Ga0065707_10001679
579 Ga0065707_10120409
580 Ga0070676_10015454
581 Ga0070690_100003858
582 Ga0070690_100007062
583 Ga0070670_100031206
584 Ga0070670_100087200
585 Ga0070670_100149537
586 Ga0070670_100329744
587 Ga0070677_10052211
588 Ga0070677_10057746
589 Ga0068869_100001134
590 Ga0068869_100004585
591 Ga0068869_100004939
592 Ga0068869_100005107
593 Ga0068869_100005957
594 Ga0068869_100028169
595 Ga0068869_100271161
596 Ga0070666_10004294
597 Ga0070682_100005348
598 Ga0070682_100007970
599 Ga0068868_100001927
600 Ga0068868_100074117
601 Ga0070660_100229262
602 Ga0070689_100000757
603 Ga0070689_100001358
604 Ga0070687_100002899
605 Ga0070687_100003916
606 Ga0070687_100104728
607 Ga0070661_100155871
608 Ga0070668_100101874
609 Ga0070675_100011477
610 Ga0070671_100008243
611 Ga0070674_100038860
612 Ga0070673_100001840
613 Ga0070673_100347969
614 Ga0070673_100439096
615 Ga0070688_100001029
616 Ga0070659_100016782
617 Ga0070659_100151490
618 Ga0070667_100018368
619 Ga0070701_10003837
620 Ga0070701_10009811
621 Ga0070701_10011431
622 Ga0070701_10026697
623 Ga0070701_10158790
624 Ga0070705_100013047
625 Ga0070705_100025268
626 Ga0070705_100029244
627 Ga0070705_100201916
628 Ga0070700_100000005
629 Ga0070700_100000246
630 Ga0070700_100026563
631 Ga0070700_100110214
632 Ga0070694_100000702
633 Ga0070694_100057850
634 Ga0070694_100072294
635 Ga0070694_100073775
636 Ga0070694_100096205
637 Ga0070694_100113456
638 Ga0070694_100216204
639 Ga0070708_100238585
640 Ga0070662_100036351
641 Ga0070681_10003280
642 Ga0070681_10022082
643 Ga0070681_10053306
644 Ga0070681_10151633
645 Ga0068867_100001395
646 Ga0070685_10001321
647 Ga0070706_100000490
648 Ga0070706_100001794
649 Ga0070706_100008985
650 Ga0070706_100099309
651 Ga0070707_100122237
652 Ga0070707_100198559
653 Ga0070707_100204652
654 Ga0070698_100002390
655 Ga0070698_100007491
656 Ga0070698_100019424
657 Ga0070699_100000886
658 Ga0070699_100006028
659 Ga0070699_100039076
660 Ga0070699_100058325
661 Ga0070699_100118519
662 Ga0070679_100000783
663 Ga0070697_100000185
664 Ga0070697_100000687
665 Ga0070697_100025082
666 Ga0070697_100056690
667 Ga0070697_100281603
668 Ga0070697_100363219
669 Ga0068853_100008289
670 Ga0068853_100122619
671 Ga0068853_100619714
672 Ga0070672_100001162
673 Ga0070672_100201897
674 Ga0070686_100001979
675 Ga0070686_100011682
676 Ga0070686_100099377
677 Ga0070695_100012231
678 Ga0070695_100013214
679 Ga0070695_100022457
680 Ga0070695_100035361
681 Ga0070696_100001694
682 Ga0070696_100009930
683 Ga0070696_100059562
684 Ga0070696_100068299
685 Ga0070696_100077048
686 Ga0070696_100090668
687 Ga0070696_100264026
688 Ga0070693_100001815
689 Ga0070693_100011987
690 Ga0070693_100066455
691 Ga0070693_100115709
692 Ga0070704_100022440
693 Ga0070704_100064924
694 Ga0070704_100240758
695 Ga0070664_100015818
696 Ga0070664_100016598
697 Ga0070664_100317334
698 Ga0068857_100006516
699 Ga0068857_100070370
700 Ga0068857_100093751
701 Ga0068857_100104790
702 Ga0068857_100581134
703 Ga0068856_100193532
704 Ga0070702_100001343
705 Ga0070702_100005570
706 Ga0070702_100095652
707 Ga0070702_100103749
708 Ga0068859_100002274
709 Ga0068859_100002572
710 Ga0068859_100009483
711 Ga0068859_100029378
712 Ga0068859_100052454
713 Ga0068859_100068106
714 Ga0068859_100228744
715 Ga0068859_100255007
716 Ga0068859_100493714
717 Ga0068864_100004370
718 Ga0068864_100008800
719 Ga0068864_100037047
720 Ga0068864_100136739
721 Ga0068864_100270908
722 Ga0068864_100419266
723 Ga0068864_100460451
724 Ga0068864_100665894
725 Ga0068861_100005529
726 Ga0068861_100056055
727 Ga0068851_10024069
728 Ga0068870_10002719
729 Ga0068870_10004018
730 Ga0068870_10061536
731 Ga0068863_100001568
732 Ga0068863_100051109
733 Ga0068863_100133452
734 Ga0068863_100194737
735 Ga0068858_100000213
736 Ga0068858_100002896
737 Ga0068858_100038922
738 Ga0068858_100094037
739 Ga0068858_100170476
740 Ga0068858_100193351
741 Ga0068858_100199656
742 Ga0068860_100003898
743 Ga0068860_100021265
744 Ga0068860_100195261
745 Ga0068860_100278137
746 Ga0068862_100080330
747 Ga0068862_100096390
748 Ga0081539_10000022
749 Ga0081539_10000490
750 Ga0081539_10029862
751 Ga0081539_10061606
752 Ga0070715_10000018
753 Ga0070715_10000031
754 Ga0070716_100000007
755 Ga0070716_100076485
756 Ga0097621_100001152
757 Ga0097621_100001228
758 Ga0068871_100001871
759 Ga0068871_100052600
760 Ga0075430_100021529
761 Ga0075430_100286490
762 Ga0075433_10048943
763 Ga0075433_10134131
764 Ga0075434_100037822
765 Ga0075434_100182238
766 Ga0075429_100152602
767 Ga0075429_100336748
768 Ga0068865_100008245
769 Ga0068865_100100234
770 Ga0097620_100002274
771 Ga0097620_100002571
772 Ga0097620_100009483
773 Ga0097620_100029376
774 Ga0097620_100052455
775 Ga0097620_100068106
776 Ga0097620_100228727
777 Ga0097620_100255012
778 Ga0097620_100493700
779 Ga0075435_100119842
780 Ga0075435_100141190
781 Ga0105251_10041302
782 Ga0105251_10076553
783 Ga0111539_10000363
784 Ga0111539_10008997
785 Ga0105245_10006962
786 Ga0105245_10171172
787 Ga0105245_10462886
788 Ga0105245_10554279
789 Ga0105247_10000003
790 Ga0105247_10000777
791 Ga0105247_10210253
792 Ga0114129_10001544
793 Ga0114129_10007188
794 Ga0114129_10066866
795 Ga0114129_10171344
796 Ga0114129_10196428
797 Ga0114129_10324397
798 Ga0114129_10583201
799 Ga0114129_10676943
800 Ga0114129_11141176
801 Ga0105243_10002703
802 Ga0105243_10004079
803 Ga0105243_10012601
804 Ga0105243_10104763
805 Ga0105243_10424593
806 Ga0105241_10081243
807 Ga0105241_10229458
808 Ga0105242_10002343
809 Ga0105242_10092273
810 Ga0105242_10126542
811 Ga0105242_10590020
812 Ga0105248_10004483
813 Ga0105248_10006348
814 Ga0105248_10020878
815 Ga0105248_10094080
816 Ga0105248_10232947
817 Ga0105248_10243761
818 Ga0105248_10552913
819 Ga0105237_10000767
820 Ga0105237_10114086
821 Ga0105237_10238562
822 Ga0105238_10015460
823 Ga0105238_10042177
824 Ga0105249_10010434
825 Ga0105249_10015841
826 Ga0105249_10204955
827 Ga0105239_10044951
828 Ga0105239_10173333
829 Ga0105239_10239083
830 Ga0105239_10587791
831 Ga0105246_10023933
832 Ga0105246_10061686
833 Ga0157373_10209568
834 Ga0157374_10471745
835 Ga0157378_10000113
836 Ga0157378_10002637
837 Ga0157378_10066725
838 Ga0157378_10099126
839 Ga0157378_10281567
840 Ga0163162_10011556
841 Ga0163162_10013845
842 Ga0163162_10013897
843 Ga0163162_10102064
844 Ga0163162_10116333
845 Ga0163162_10235682
846 Ga0157372_10018380
847 Ga0157372_10396812
848 Ga0157375_10000784
849 Ga0157375_10014222
850 Ga0157375_10211790
851 Ga0157375_10642973
852 Ga0163163_10002364
853 Ga0163163_10009368
854 Ga0163163_10015079
855 Ga0163163_10029788
856 Ga0163163_10043123
857 Ga0163163_10682715
858 Ga0157380_10002257
859 Ga0157380_10005496
860 Ga0157380_10090383
861 Ga0157380_10172956
862 Ga0157380_10218990
863 Ga0157377_10016377
864 Ga0157379_10487407
865 Ga0157376_10022082
866 Ga0163161_10000604
867 Ga0213876_10000111
868 Ga0213876_10000325
869 Ga0207672_1000021
870 Ga0207697_10023797
871 Ga0207656_10018486
872 Ga0207653_10006721
873 Ga0207653_10022425
874 Ga0207682_10156034
875 Ga0207710_10000001
876 Ga0207710_10002652
877 Ga0207688_10034077
878 Ga0207680_10012917
879 Ga0207647_10045917
880 Ga0207685_10000007
881 Ga0207685_10000022
882 Ga0207645_10194210
883 Ga0207643_10001868
884 Ga0207643_10014846
885 Ga0207643_10088600
886 Ga0207643_10101898
887 Ga0207684_10000172
888 Ga0207684_10052193
889 Ga0207684_10079598
890 Ga0207684_10228690
891 Ga0207684_10341673
892 Ga0207684_10455921
893 Ga0207654_10122442
894 Ga0207707_10000022
895 Ga0207707_10010498
896 Ga0207707_10029430
897 Ga0207671_10001070
898 Ga0207671_10079051
899 Ga0207671_10158001
900 Ga0207660_10059707
901 Ga0207662_10003386
902 Ga0207649_10070188
903 Ga0207649_10337945
904 Ga0207652_10000342
905 Ga0207646_10067498
906 Ga0207646_10112670
907 Ga0207646_10119518
908 Ga0207681_10022082
909 Ga0207694_10163736
910 Ga0207694_10403594
911 Ga0207650_10000009
912 Ga0207650_10039274
913 Ga0207650_10040731
914 Ga0207650_10084855
915 Ga0207650_10270135
916 Ga0207659_10020672
917 Ga0207687_10004125
918 Ga0207644_10000095
919 Ga0207644_10035519
920 Ga0207686_10003330
921 Ga0207686_10004186
922 Ga0207686_10139165
923 Ga0207709_10001080
924 Ga0207709_10004310
925 Ga0207709_10004715
926 Ga0207709_10006193
927 Ga0207709_10221632
928 Ga0207670_10000776
929 Ga0207670_10000982
930 Ga0207670_10512452
931 Ga0207669_10228480
932 Ga0207704_10002642
933 Ga0207704_10040864
934 Ga0207665_10000018
935 Ga0207691_10003845
936 Ga0207691_10139139
937 Ga0207711_10012927
938 Ga0207711_10047603
939 Ga0207711_10062370
940 Ga0207711_10083213
941 Ga0207689_10002314
942 Ga0207689_10011031
943 Ga0207689_10015622
944 Ga0207689_10015777
945 Ga0207689_10024428
946 Ga0207689_10034263
947 Ga0207689_10041908
948 Ga0207689_10070808
949 Ga0207689_10210904
950 Ga0207679_10291135
951 Ga0207651_10006635
952 Ga0207651_10026437
953 Ga0207651_10343173
954 Ga0207712_10005808
955 Ga0207712_10026761
956 Ga0207668_10385987
957 Ga0207640_10021160
958 Ga0207658_10042609
959 Ga0207677_10055642
960 Ga0207677_10184896
961 Ga0207703_10000055
962 Ga0207703_10138032
963 Ga0207703_10147016
964 Ga0207639_10004389
965 Ga0207639_10059671
966 Ga0207639_10199261
967 Ga0207708_10000017
968 Ga0207708_10000528
969 Ga0207708_10054040
970 Ga0207708_10068098
971 Ga0207708_10075299
972 Ga0207708_10165498
973 Ga0207708_10176701
974 Ga0207708_10256050
975 Ga0207702_10036654
976 Ga0207641_10003938
977 Ga0207641_10021719
978 Ga0207641_10114140
979 Ga0207641_10594172
980 Ga0207648_10034347
981 Ga0207648_10040512
982 Ga0207648_10095671
983 Ga0207648_10310535
984 Ga0207676_10001022
985 Ga0207676_10003062
986 Ga0207676_10016141
987 Ga0207676_10175567
988 Ga0207676_10351071
989 Ga0207674_10004393
990 Ga0207674_10018690
991 Ga0207674_10066891
992 Ga0207674_10095301
993 Ga0207674_10668657
994 Ga0207675_100001018
995 Ga0207675_100054501
996 Ga0207428_10011380
997 Ga0207428_10060893
998 Ga0268265_10059469
999 Ga0268265_10116829
1000 Ga0268264_10011924
1001 Ga0268264_10044626
1002 Ga0268264_10046515
1003 Ga0268264_10222933
1004 Ga0268264_10283524
1005 Ga0307408_100037346
1006 Ga0307408_100106631
1007 Ga0307405_10155787
1008 Ga0307405_10187728
1009 Ga0307410_10103990
1010 Ga0307410_10119766
1011 Ga0307406_10122434
1012 Ga0307406_10139000
1013 Ga0307407_10259321
1014 Ga0307412_10112820
1015 Ga0307416_100132052
1016 Ga0307416_100273948
1017 Ga0307414_10016422
1018 Ga0307414_10067171
1019 Ga0307411_10173250
1020 Ga0307415_100185311
1021 Ga0373940_0049593
1022 Ga0373932_0074718
1023 Ga0395899_0153362
1024 Ga0395900_0059602
1025 Ga0395898_0076328
1026 Ga0395901_0087483
1027 Ga0395901_0125518
1028 Ga0242419_000478
1029 Ga0242422_00032
1030 Ga0436365_0407503
1031 Ga0436365_1230778
1032 Ga0439455_0028467
1033 Ga0439462_0007984
1034 Ga0450889_005416
1035 Ga0439458_0001962
1036 Ga0439458_0003929
1037 Ga0439434_0018158
1038 Ga0453683_0049852
1039 Ga0453683_0212949
1040 Ga0451576_0968632
1041 Ga0495610_0058594
1042 Ga0495663_0000602
1043 Ga0495598_0000902
1044 Ga0495621_0000030
1045 Ga0496102_0435904
1046 Ga0496104_0114931
1047 Ga0496106_0020912
1048 Ga0496106_0141666
1049 Ga0496108_0175910
1050 Ga0496110_0178641
1051 Ga0496112_0025490
1052 Ga0496112_0112565
1053 Ga0496112_0215290
1054 Ga0496112_0478258
1055 Ga0496113_0081242
1056 Ga0496113_0108504
1057 Ga0501306_003941
1058 Ga0501298_002265
1059 Ga0501312_005578
1060 Ga0501038_0006538
1061 Ga0501198_002128
1062 Ga0501202_002693
1063 Ga0501207_006773
1064 Ga0501207_023816
1065 Ga0501209_003573
1066 Ga0501216_002932
1067 Ga0501223_009969
1068 Ga0501224_003999
1069 Ga0501227_008399
1070 Ga0501233_003545
1071 Ga0501235_017653
1072 Ga0501236_011433
1073 Ga0501240_005600
1074 Ga0501243_003165
1075 Ga0501249_001515
1076 Ga0501221_005327
1077 Ga0501225_0003070
1078 Ga0501225_0014857
1079 Ga0501229_013516
1080 Ga0501245_003498
1081 Ga0501241_008892
1082 Ga0501263_001926
1083 Ga0501267_007028
1084 nmdc:mga05p37_372523_c1
1085 nmdc:mga05p37_43084_c1
1086 nmdc:mga05p37_54468_c1
1087 nmdc:mga05p37_563623_c1
1088 nmdc:mga05p37_67548_c1
1089 nmdc:mga05p37_690759_c1
1090 nmdc:mga09592_20950_c1
1091 nmdc:mga09592_271014_c1
1092 nmdc:mga0qj67_254051_c1
1093 nmdc:mga0qj67_54870_c1
1094 nmdc:mga06r32_78102_c1
1095 nmdc:mga08y16_1742_c1
1096 nmdc:mga08y16_23388_c1
1097 nmdc:mga08y16_73462_c1
1098 nmdc:mga0n895_18579_c1
1099 nmdc:mga0n895_270578_c1
1100 nmdc:mga0n895_424819_c1
1101 nmdc:mga0rr50_157664_c1
1102 nmdc:mga08x19_38241_c1
1103 nmdc:mga0a205_11752_c1
1104 nmdc:mga0a205_302818_c1
1105 nmdc:mga0a205_436693_c1
1106 nmdc:mga0a205_98171_c1
1107 Ga0587066_001503
1108 Ga0587068_002583
1109 Ga0587111_0000296
1110 Ga0530510_0225855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08666

SAF

SAF domain

39

100

0.95

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

107

217

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3frn-assembly1.cif.gz_A crystal structure of flagellar protein flga from thermotoga maritima msb8 0.9111 40 103
5xqr-assembly1.cif.gz_B crystal structure of notched-fin eelpout type iii antifreeze protein a20v mutant (nfe6, afp), c2221 form 0.8553 39 102
1ucs-assembly1.cif.gz_A type iii antifreeze protein rd1 from an antarctic eel pout 0.8539 41 100
4ur6-assembly2.cif.gz_A structure of the type iii fish antifreeze protein from zoarces viviparus zvafp6 0.8496 39 100
5xqr-assembly1.cif.gz_B crystal structure of notched-fin eelpout type iii antifreeze protein a20v mutant (nfe6, afp), c2221 form 0.8427 39 102
ID Description Score Start End Superfamily
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9483 40 102 3.90.1210.10
3frnA02 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9447 40 100 3.90.1210.10
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.9342 40 102 3.90.1210.10
af_Q9VG74_312_372_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8568 39 102 3.90.1210.10
5xqrB00 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8553 39 102 3.90.1210.10
ID Description Score Start End GO Terms
AF-A0A2M8NRA4-F1-model_v4 SAF domain-containing protein 0.9752 40 103 GO:0016020
AF-A0A536EJ64-F1-model_v4 SAF domain-containing protein 0.8636 41 108
AF-A0A529VMQ5-F1-model_v4 deleted 0.8353 40 237
AF-A0A2V8Q771-F1-model_v4 Flp pilus assembly protein CpaB 0.7964 1 107
AF-A0A2V8Q771-F1-model_v4 Flp pilus assembly protein CpaB 0.7898 1 107

Map