F463048

General Info

Members Datasets Scaffolds Average Seq Length
554 251 1108 144

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_82200_c1|nmdc:mga08x19_82200_c1_997_1491
Length 158
Sequence MIAEHRLEPVETKNSANRRSLIMPTSNAVATWEGKLREGKGNFKGQSGAFGTRFEGKKGSNPEELIAAAHAGCFSMALSSALEKAGHPATRIETRAAVTLEMVDGSPKITKSVLDVRGKVDGIDQAAFQQAAEGAKKNCPVSKALQGNVDVTLDAKLV

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 0.18
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_82200_c1 3300050514 Bacteria 2116
2 MRS1b_contig_2669138 2162886011 Bacteria 2215
3 JGI24751J29686_10001433 3300002459 Bacteria 4992
4 Ga0065714_10074150 3300005288 Bacteria 3077
5 Ga0065704_10643246 3300005289 Bacteria 586
6 Ga0065704_10752521 3300005289 Bacteria 541
7 Ga0065712_10000393 3300005290 Bacteria 14469
8 Ga0065712_10069663 3300005290 Bacteria 6918
9 Ga0065712_10350542 3300005290 Bacteria 788
10 Ga0065715_10131732 3300005293 Bacteria 2003
11 Ga0065707_10091743 3300005295 Bacteria 3886
12 Ga0065707_10227114 3300005295 Unclassified 1200
13 Ga0070658_10184936 3300005327 Bacteria 1754
14 Ga0070676_10185212 3300005328 Unclassified 1356
15 Ga0070676_10191605 3300005328 Bacteria 1335
16 Ga0070690_100002003 3300005330 Bacteria 10847
17 Ga0070690_100095727 3300005330 Bacteria 1961
18 Ga0070670_100004466 3300005331 Bacteria 11714
19 Ga0070670_100011332 3300005331 Bacteria 7619
20 Ga0070670_100015247 3300005331 Bacteria 6596
21 Ga0070670_100043064 3300005331 Unclassified 3881
22 Ga0070670_100353777 3300005331 Bacteria 1291
23 Ga0070670_100571015 3300005331 Unclassified 1010
24 Ga0068869_100018070 3300005334 Unclassified 4793
25 Ga0068869_100041017 3300005334 Bacteria 3313
26 Ga0068869_100623128 3300005334 Bacteria 913
27 Ga0070666_10167995 3300005335 Bacteria 1535
28 Ga0070680_100021318 3300005336 Bacteria 5148
29 Ga0070680_100054899 3300005336 Unclassified 3254
30 Ga0070680_100306724 3300005336 Bacteria 1346
31 Ga0068868_100191305 3300005338 Bacteria 1702
32 Ga0070689_100013704 3300005340 Bacteria 5873
33 Ga0070689_100103172 3300005340 Unclassified 2260
34 Ga0070689_100142065 3300005340 Bacteria 1931
35 Ga0070689_101174762 3300005340 Unclassified 688
36 Ga0070689_101228953 3300005340 Bacteria 673
37 Ga0070687_100021291 3300005343 Bacteria 3045
38 Ga0070687_100096694 3300005343 Bacteria 1645
39 Ga0070687_100250323 3300005343 Bacteria 1100
40 Ga0070687_100553224 3300005343 Bacteria 783
41 Ga0070692_10262707 3300005345 Bacteria 1038
42 Ga0070692_10289215 3300005345 Unclassified 996
43 Ga0070692_10308393 3300005345 Bacteria 969
44 Ga0070668_100067980 3300005347 Unclassified 2769
45 Ga0070668_100630313 3300005347 Bacteria 940
46 Ga0070669_100002549 3300005353 Bacteria 13166
47 Ga0070669_100734582 3300005353 Unclassified 835
48 Ga0070675_100004810 3300005354 Bacteria 10303
49 Ga0070675_100022563 3300005354 Bacteria 5031
50 Ga0070675_100027677 3300005354 Bacteria 4557
51 Ga0070671_100488345 3300005355 Bacteria 1059
52 Ga0070674_100086087 3300005356 Bacteria 2256
53 Ga0070674_101041095 3300005356 Bacteria 720
54 Ga0070674_101075555 3300005356 Bacteria 709
55 Ga0070673_100003572 3300005364 Bacteria 9712
56 Ga0070673_100011926 3300005364 Bacteria 5951
57 Ga0070673_100029120 3300005364 Bacteria 4115
58 Ga0070673_100051833 3300005364 Bacteria 3216
59 Ga0070688_100007036 3300005365 Bacteria 6050
60 Ga0070688_100016843 3300005365 Bacteria 4185
61 Ga0070688_100022092 3300005365 Bacteria 3723
62 Ga0070688_100027353 3300005365 Bacteria 3397
63 Ga0070688_100881809 3300005365 Bacteria 704
64 Ga0070703_10000245 3300005406 Bacteria 26412
65 Ga0070714_100001866 3300005435 Bacteria 15357
66 Ga0070714_100813718 3300005435 Bacteria 905
67 Ga0070710_10158977 3300005437 Bacteria 1400
68 Ga0070701_10015250 3300005438 Bacteria 3544
69 Ga0070701_10067889 3300005438 Bacteria 1898
70 Ga0070701_10339171 3300005438 Bacteria 935
71 Ga0070701_10511211 3300005438 Bacteria 782
72 Ga0070701_11219568 3300005438 Bacteria 534
73 Ga0070705_100002366 3300005440 Bacteria 9513
74 Ga0070705_100011027 3300005440 Bacteria 4546
75 Ga0070705_100012344 3300005440 Unclassified 4341
76 Ga0070700_100037548 3300005441 Bacteria 2947
77 Ga0070700_100394143 3300005441 Bacteria 1039
78 Ga0070700_101508128 3300005441 Bacteria 572
79 Ga0070694_100000872 3300005444 Bacteria 16983
80 Ga0070694_100003743 3300005444 Bacteria 9069
81 Ga0070694_100007039 3300005444 Bacteria 6842
82 Ga0070694_100031886 3300005444 Bacteria 3457
83 Ga0070694_100037712 3300005444 Bacteria 3207
84 Ga0070708_100043528 3300005445 Bacteria 3945
85 Ga0070708_100230000 3300005445 Bacteria 1740
86 Ga0070708_101095099 3300005445 Bacteria 746
87 Ga0070678_100465307 3300005456 Bacteria 1110
88 Ga0070662_100080981 3300005457 Bacteria 2418
89 Ga0070662_100146896 3300005457 Unclassified 1832
90 Ga0068867_100020227 3300005459 Unclassified 4743
91 Ga0068867_100362164 3300005459 Bacteria 1213
92 Ga0068867_100650848 3300005459 Bacteria 925
93 Ga0068867_101107870 3300005459 Bacteria 723
94 Ga0070685_10003193 3300005466 Bacteria 8344
95 Ga0070685_10071027 3300005466 Bacteria 2063
96 Ga0070685_10082608 3300005466 Bacteria 1928
97 Ga0070706_100070138 3300005467 Bacteria 3241
98 Ga0070706_100112000 3300005467 Bacteria 2540
99 Ga0070706_100138025 3300005467 Bacteria 2275
100 Ga0070706_100659111 3300005467 Bacteria 971
101 Ga0070707_100000077 3300005468 Bacteria 86719
102 Ga0070707_100009322 3300005468 Bacteria 9111
103 Ga0070707_100475139 3300005468 Bacteria 1211
104 Ga0070707_101523336 3300005468 Bacteria 635
105 Ga0070698_100001684 3300005471 Bacteria 24662
106 Ga0070698_100031715 3300005471 Bacteria 5478
107 Ga0070698_100084673 3300005471 Bacteria 3158
108 Ga0070698_100534261 3300005471 Bacteria 1111
109 Ga0070698_101262447 3300005471 Bacteria 688
110 Ga0070699_100087007 3300005518 Bacteria 2728
111 Ga0070699_100093976 3300005518 Bacteria 2624
112 Ga0070699_100240011 3300005518 Bacteria 1617
113 Ga0070699_100826566 3300005518 Bacteria 848
114 Ga0070697_100009133 3300005536 Bacteria 7745
115 Ga0070697_100013996 3300005536 Bacteria 6298
116 Ga0070697_100156401 3300005536 Bacteria 1924
117 Ga0070697_100180502 3300005536 Bacteria 1789
118 Ga0070672_100066056 3300005543 Unclassified 2863
119 Ga0070672_100084227 3300005543 Bacteria 2553
120 Ga0070672_101041989 3300005543 Bacteria 726
121 Ga0070686_100016350 3300005544 Bacteria 4315
122 Ga0070686_100038440 3300005544 Bacteria 2975
123 Ga0070686_100265254 3300005544 Bacteria 1260
124 Ga0070695_100004373 3300005545 Bacteria 8286
125 Ga0070695_100012926 3300005545 Bacteria 5011
126 Ga0070695_100060158 3300005545 Bacteria 2461
127 Ga0070695_100129984 3300005545 Unclassified 1735
128 Ga0070695_100327449 3300005545 Bacteria 1141
129 Ga0070696_100005529 3300005546 Bacteria 8436
130 Ga0070696_100014148 3300005546 Bacteria 5355
131 Ga0070696_101033178 3300005546 Archaea 688
132 Ga0070704_100001416 3300005549 Bacteria 12795
133 Ga0070704_100007963 3300005549 Bacteria 6327
134 Ga0070704_100051875 3300005549 Unclassified 2891
135 Ga0070704_100073517 3300005549 Bacteria 2490
136 Ga0070704_101534686 3300005549 Bacteria 613
137 Ga0070664_100147240 3300005564 Bacteria 2077
138 Ga0070664_100169021 3300005564 Unclassified 1939
139 Ga0068857_100007129 3300005577 Bacteria 9627
140 Ga0068854_100013145 3300005578 Bacteria 5426
141 Ga0068854_100898909 3300005578 Bacteria 778
142 Ga0070702_100341139 3300005615 Bacteria 1052
143 Ga0070702_100377759 3300005615 Unclassified 1006
144 Ga0070702_101118922 3300005615 Bacteria 630
145 Ga0068852_101483910 3300005616 Bacteria 700
146 Ga0068859_100025026 3300005617 Bacteria 5992
147 Ga0068859_100028460 3300005617 Bacteria 5602
148 Ga0068859_100090425 3300005617 Bacteria 3112
149 Ga0068859_100511419 3300005617 Bacteria 1296
150 Ga0068859_100704260 3300005617 Bacteria 1100
151 Ga0068864_100010393 3300005618 Bacteria 7687
152 Ga0068864_100029845 3300005618 Bacteria 4621
153 Ga0068864_100082789 3300005618 Bacteria 2816
154 Ga0068864_100798058 3300005618 Bacteria 928
155 Ga0068866_10304594 3300005718 Bacteria 996
156 Ga0068861_100056066 3300005719 Bacteria 3007
157 Ga0068861_100103697 3300005719 Bacteria 2267
158 Ga0068861_101224172 3300005719 Bacteria 727
159 Ga0068870_10102118 3300005840 Bacteria 1622
160 Ga0068863_100006326 3300005841 Bacteria 11612
161 Ga0068863_100098238 3300005841 Bacteria 2780
162 Ga0068863_100190122 3300005841 Bacteria 1973
163 Ga0068863_100507834 3300005841 Bacteria 1187
164 Ga0068858_100164222 3300005842 Bacteria 2092
165 Ga0068860_100273586 3300005843 Bacteria 1649
166 Ga0068860_100836376 3300005843 Bacteria 935
167 Ga0068860_100927276 3300005843 Unclassified 887
168 Ga0068862_100001278 3300005844 Bacteria 23579
169 Ga0068862_100336309 3300005844 Bacteria 1397
170 Ga0068862_100817665 3300005844 Bacteria 911
171 Ga0070717_10155868 3300006028 Bacteria 1979
172 Ga0075432_10113442 3300006058 Bacteria 1012
173 Ga0070715_10039729 3300006163 Bacteria 1962
174 Ga0070712_100512023 3300006175 Bacteria 1007
175 Ga0097621_100011962 3300006237 Bacteria 6419
176 Ga0097621_100514175 3300006237 Bacteria 1086
177 Ga0097621_100551037 3300006237 Bacteria 1049
178 Ga0068871_100089073 3300006358 Bacteria 2568
179 Ga0075428_100012694 3300006844 Bacteria 9369
180 Ga0075428_100027284 3300006844 Bacteria 6321
181 Ga0075428_100064508 3300006844 Bacteria 4011
182 Ga0075428_100132510 3300006844 Bacteria 2710
183 Ga0075428_100335232 3300006844 Bacteria 1625
184 Ga0075428_100702067 3300006844 Bacteria 1078
185 Ga0075428_100790913 3300006844 Bacteria 1008
186 Ga0075430_100203948 3300006846 Bacteria 1641
187 Ga0075431_100015629 3300006847 Bacteria 7694
188 Ga0075431_100402196 3300006847 Bacteria 1370
189 Ga0075433_10034149 3300006852 Bacteria 4366
190 Ga0075433_10053283 3300006852 Bacteria 3526
191 Ga0075433_10056824 3300006852 Bacteria 3420
192 Ga0075433_10177928 3300006852 Bacteria 1893
193 Ga0075433_10224975 3300006852 Bacteria 1666
194 Ga0075434_100007170 3300006871 Bacteria 10303
195 Ga0075434_100007922 3300006871 Bacteria 9846
196 Ga0075434_100036460 3300006871 Bacteria 4865
197 Ga0075434_100112314 3300006871 Bacteria 2736
198 Ga0075434_100163948 3300006871 Bacteria 2243
199 Ga0075434_100235379 3300006871 Bacteria 1851
200 Ga0075434_100489519 3300006871 Bacteria 1251
201 Ga0075429_100051926 3300006880 Bacteria 3566
202 Ga0075429_100112039 3300006880 Bacteria 2384
203 Ga0075429_100315389 3300006880 Bacteria 1368
204 Ga0075429_100326913 3300006880 Unclassified 1342
205 Ga0075429_100396673 3300006880 Bacteria 1208
206 Ga0068865_100079019 3300006881 Unclassified 2355
207 Ga0075436_100137655 3300006914 Bacteria 1715
208 Ga0075436_100142146 3300006914 Bacteria 1687
209 Ga0075436_100165819 3300006914 Bacteria 1559
210 Ga0075436_100188960 3300006914 Bacteria 1457
211 Ga0097620_100025023 3300006931 Bacteria 5992
212 Ga0097620_100028459 3300006931 Bacteria 5602
213 Ga0097620_100090425 3300006931 Bacteria 3112
214 Ga0097620_100511449 3300006931 Bacteria 1296
215 Ga0097620_100704253 3300006931 Bacteria 1100
216 Ga0075435_100004986 3300007076 Bacteria 9217
217 Ga0075435_100138357 3300007076 Bacteria 2041
218 Ga0075435_101719420 3300007076 Bacteria 550
219 Ga0099794_10000219 3300007265 Bacteria 20487
220 Ga0099794_10006092 3300007265 Bacteria 4871
221 Ga0099794_10097943 3300007265 Unclassified 1462
222 Ga0099794_10216089 3300007265 Bacteria 984
223 Ga0111539_10000810 3300009094 Bacteria 40595
224 Ga0111539_10004662 3300009094 Bacteria 17918
225 Ga0111539_10025488 3300009094 Bacteria 7250
226 Ga0111539_10108074 3300009094 Bacteria 3264
227 Ga0111539_10244532 3300009094 Bacteria 2089
228 Ga0111539_10439985 3300009094 Bacteria 1518
229 Ga0111539_10596473 3300009094 Bacteria 1286
230 Ga0114129_10070261 3300009147 Bacteria 4882
231 Ga0114129_10074459 3300009147 Bacteria 4730
232 Ga0114129_10079705 3300009147 Bacteria 4553
233 Ga0114129_10180094 3300009147 Bacteria 2876
234 Ga0114129_10649972 3300009147 Bacteria 1361
235 Ga0114129_11772286 3300009147 Bacteria 752
236 Ga0105241_11526261 3300009174 Bacteria 644
237 Ga0105242_10001165 3300009176 Bacteria 20702
238 Ga0105242_10177865 3300009176 Bacteria 1875
239 Ga0105242_10227866 3300009176 Bacteria 1669
240 Ga0105242_11210086 3300009176 Bacteria 775
241 Ga0105248_10343478 3300009177 Bacteria 1680
242 Ga0105249_10002749 3300009553 Bacteria 15219
243 Ga0105249_10003197 3300009553 Bacteria 14178
244 Ga0105249_10020855 3300009553 Bacteria 5860
245 Ga0105249_10065121 3300009553 Bacteria 3352
246 Ga0105249_10085379 3300009553 Bacteria 2941
247 Ga0105249_10467527 3300009553 Unclassified 1302
248 Ga0105249_11710068 3300009553 Bacteria 702
249 Ga0105249_12319721 3300009553 Bacteria 609
250 Ga0105249_12615776 3300009553 Bacteria 577
251 Ga0105246_10222218 3300011119 Bacteria 1481
252 Ga0157374_10610979 3300013296 Bacteria 1101
253 Ga0157378_10081958 3300013297 Bacteria 2917
254 Ga0163162_10043360 3300013306 Bacteria 4505
255 Ga0163162_10052834 3300013306 Unclassified 4082
256 Ga0163162_10164252 3300013306 Bacteria 2344
257 Ga0157375_10020946 3300013308 Bacteria 5983
258 Ga0157375_10135361 3300013308 Unclassified 2587
259 Ga0157375_10234186 3300013308 Bacteria 1995
260 Ga0163163_10226857 3300014325 Bacteria 1917
261 Ga0163163_10326386 3300014325 Bacteria 1589
262 Ga0163163_10840723 3300014325 Bacteria 981
263 Ga0157380_10005493 3300014326 Bacteria 8859
264 Ga0157380_10017785 3300014326 Bacteria 5267
265 Ga0157380_10022727 3300014326 Bacteria 4728
266 Ga0157380_10776908 3300014326 Bacteria 972
267 Ga0157377_10000659 3300014745 Bacteria 14381
268 Ga0157377_10052214 3300014745 Bacteria 2307
269 Ga0157377_10145595 3300014745 Bacteria 1460
270 Ga0157377_10492566 3300014745 Bacteria 855
271 Ga0157379_10185046 3300014968 Bacteria 1882
272 Ga0157376_10131389 3300014969 Bacteria 2234
273 Ga0157376_12258342 3300014969 Bacteria 583
274 Ga0163161_10015165 3300017792 Bacteria 5369
275 Ga0163161_10743936 3300017792 Bacteria 820
276 Ga0163161_10831738 3300017792 Bacteria 778
277 Ga0197907_10043426 3300020069 Unclassified 577
278 Ga0206356_11365317 3300020070 Unclassified 755
279 Ga0207666_1041706 3300025271 Bacteria 718
280 Ga0207673_1037459 3300025290 Bacteria 678
281 Ga0207697_10059773 3300025315 Bacteria 1584
282 Ga0207697_10065061 3300025315 Unclassified 1521
283 Ga0207653_10000024 3300025885 Bacteria 117069
284 Ga0207682_10009872 3300025893 Bacteria 3754
285 Ga0207682_10234504 3300025893 Bacteria 851
286 Ga0207692_10133065 3300025898 Bacteria 1407
287 Ga0207642_10526589 3300025899 Bacteria 727
288 Ga0207685_10006469 3300025905 Bacteria 3192
289 Ga0207643_10004365 3300025908 Bacteria 7598
290 Ga0207643_10266344 3300025908 Unclassified 1059
291 Ga0207705_10038665 3300025909 Bacteria 3417
292 Ga0207684_10003609 3300025910 Bacteria 15062
293 Ga0207684_10028463 3300025910 Bacteria 4761
294 Ga0207684_10056081 3300025910 Bacteria 3342
295 Ga0207684_10301350 3300025910 Bacteria 1382
296 Ga0207654_11294295 3300025911 Bacteria 531
297 Ga0207693_10400123 3300025915 Bacteria 1074
298 Ga0207660_10002949 3300025917 Bacteria 11123
299 Ga0207660_10035319 3300025917 Unclassified 3470
300 Ga0207660_10462023 3300025917 Bacteria 1027
301 Ga0207662_10057520 3300025918 Bacteria 2324
302 Ga0207662_10119839 3300025918 Bacteria 1649
303 Ga0207662_10128650 3300025918 Bacteria 1594
304 Ga0207662_10134229 3300025918 Bacteria 1563
305 Ga0207662_10815578 3300025918 Bacteria 658
306 Ga0207649_11004323 3300025920 Bacteria 657
307 Ga0207646_10000076 3300025922 Bacteria 135473
308 Ga0207646_10045006 3300025922 Bacteria 3962
309 Ga0207646_10185934 3300025922 Bacteria 1877
310 Ga0207646_10355976 3300025922 Bacteria 1322
311 Ga0207681_10028135 3300025923 Bacteria 3640
312 Ga0207681_10075399 3300025923 Unclassified 2365
313 Ga0207681_10257455 3300025923 Bacteria 1365
314 Ga0207650_10001285 3300025925 Bacteria 18202
315 Ga0207650_10192205 3300025925 Bacteria 1631
316 Ga0207650_10236886 3300025925 Unclassified 1474
317 Ga0207650_10391284 3300025925 Bacteria 1149
318 Ga0207650_10688297 3300025925 Unclassified 863
319 Ga0207650_11221329 3300025925 Unclassified 640
320 Ga0207659_10030626 3300025926 Unclassified 3678
321 Ga0207659_10221620 3300025926 Bacteria 1521
322 Ga0207659_10294348 3300025926 Bacteria 1331
323 Ga0207700_11162853 3300025928 Bacteria 689
324 Ga0207664_10017012 3300025929 Bacteria 5319
325 Ga0207644_10601756 3300025931 Unclassified 913
326 Ga0207644_11367370 3300025931 Bacteria 595
327 Ga0207706_10036362 3300025933 Unclassified 4374
328 Ga0207706_10110390 3300025933 Bacteria 2420
329 Ga0207706_10332173 3300025933 Bacteria 1322
330 Ga0207686_10000498 3300025934 Bacteria 25770
331 Ga0207686_10032968 3300025934 Bacteria 3087
332 Ga0207670_10033390 3300025936 Bacteria 3315
333 Ga0207670_10042309 3300025936 Bacteria 3001
334 Ga0207670_10943979 3300025936 Unclassified 724
335 Ga0207704_10225253 3300025938 Bacteria 1390
336 Ga0207704_11848203 3300025938 Bacteria 519
337 Ga0207691_10014404 3300025940 Bacteria 7541
338 Ga0207691_10038893 3300025940 Bacteria 4402
339 Ga0207691_10183619 3300025940 Bacteria 1827
340 Ga0207711_10412216 3300025941 Bacteria 1256
341 Ga0207689_10045161 3300025942 Unclassified 3644
342 Ga0207689_10053634 3300025942 Bacteria 3322
343 Ga0207689_10212835 3300025942 Bacteria 1597
344 Ga0207679_10515145 3300025945 Bacteria 1069
345 Ga0207667_11401811 3300025949 Bacteria 672
346 Ga0207651_10000912 3300025960 Bacteria 12998
347 Ga0207651_10006411 3300025960 Bacteria 6157
348 Ga0207651_10020926 3300025960 Bacteria 3961
349 Ga0207651_10051114 3300025960 Bacteria 2810
350 Ga0207651_10058501 3300025960 Bacteria 2664
351 Ga0207712_10001312 3300025961 Bacteria 17052
352 Ga0207712_10001935 3300025961 Bacteria 13612
353 Ga0207712_10028489 3300025961 Bacteria 3736
354 Ga0207712_10513107 3300025961 Bacteria 1026
355 Ga0207668_10028706 3300025972 Unclassified 3641
356 Ga0207640_10024352 3300025981 Unclassified 3651
357 Ga0207640_10177516 3300025981 Bacteria 1594
358 Ga0207658_10554696 3300025986 Bacteria 1028
359 Ga0207703_10461384 3300026035 Bacteria 1188
360 Ga0207708_10303056 3300026075 Bacteria 1300
361 Ga0207708_10304159 3300026075 Bacteria 1298
362 Ga0207708_10408855 3300026075 Bacteria 1124
363 Ga0207641_10000467 3300026088 Bacteria 45772
364 Ga0207641_10086236 3300026088 Bacteria 2737
365 Ga0207641_10168910 3300026088 Bacteria 1995
366 Ga0207648_10031304 3300026089 Unclassified 4703
367 Ga0207648_10407968 3300026089 Bacteria 1232
368 Ga0207676_10017905 3300026095 Bacteria 5141
369 Ga0207676_10176165 3300026095 Bacteria 1868
370 Ga0207676_10524107 3300026095 Bacteria 1128
371 Ga0207674_10003180 3300026116 Bacteria 20225
372 Ga0207675_100000299 3300026118 Bacteria 47665
373 Ga0207675_100205800 3300026118 Bacteria 1891
374 Ga0207675_100308952 3300026118 Bacteria 1541
375 Ga0207675_101028266 3300026118 Bacteria 843
376 Ga0207683_10155017 3300026121 Bacteria 2069
377 Ga0207698_10753171 3300026142 Bacteria 973
378 Ga0209588_1000202 3300027671 Bacteria 16230
379 Ga0209588_1003286 3300027671 Bacteria 4473
380 Ga0207428_10043138 3300027907 Bacteria 3644
381 Ga0207428_10135883 3300027907 Unclassified 1879
382 Ga0207428_10148039 3300027907 Bacteria 1789
383 Ga0207428_10383608 3300027907 Bacteria 1030
384 Ga0207428_10781662 3300027907 Bacteria 679
385 Ga0268265_10028813 3300028380 Bacteria 3980
386 Ga0268265_10228365 3300028380 Bacteria 1634
387 Ga0268265_11278350 3300028380 Bacteria 733
388 Ga0268265_11409966 3300028380 Unclassified 699
389 Ga0268264_10282397 3300028381 Unclassified 1556
390 Ga0307408_101894362 3300031548 Bacteria 572
391 Ga0316576_10007772 3300031727 Bacteria 6774
392 Ga0316578_10127318 3300031728 Bacteria 1532
393 Ga0307405_10009318 3300031731 Bacteria 5027
394 Ga0316577_10038066 3300031733 Bacteria 2689
395 Ga0307413_10729486 3300031824 Bacteria 826
396 Ga0307410_10086671 3300031852 Bacteria 2212
397 Ga0307406_10456634 3300031901 Bacteria 1026
398 Ga0307407_10002547 3300031903 Bacteria 7167
399 Ga0307412_10003150 3300031911 Bacteria 9158
400 Ga0307409_100455084 3300031995 Bacteria 1236
401 Ga0307416_100018583 3300032002 Bacteria 4902
402 Ga0307416_100072544 3300032002 Unclassified 2866
403 Ga0307414_10052480 3300032004 Bacteria 2838
404 Ga0307411_10000879 3300032005 Bacteria 11358
405 Ga0307411_10158758 3300032005 Bacteria 1690
406 Ga0307415_100007727 3300032126 Bacteria 5906
407 Ga0307415_100389232 3300032126 Bacteria 1186
408 Ga0373926_0175118 3300035083 Bacteria 822
409 Ga0373940_0155942 3300035088 Bacteria 730
410 Ga0373932_0332830 3300035112 Bacteria 574
411 Ga0373956_0251129 3300035119 Bacteria 841
412 Ga0373943_0128688 3300035170 Bacteria 1353
413 Ga0373946_0451871 3300035171 Bacteria 654
414 Ga0373942_0008855 3300035207 Bacteria 2351
415 Ga0373961_0002701 3300035241 Bacteria 4538
416 Ga0316574_0206095 3300035398 Bacteria 1262
417 Ga0373935_1051708 3300035692 Unclassified 605
418 Ga0373947_0381843 3300035725 Bacteria 948
419 Ga0373937_0097898 3300036401 Bacteria 2721
420 Ga0395898_0930674 3300037466 Bacteria 807
421 Ga0451800_0818037 3300041459 Bacteria 686
422 Ga0451843_0781955 3300041509 Bacteria 2280
423 Ga0439441_031243 3300042001 Bacteria 1033
424 Ga0439445_0016842 3300042004 Bacteria 1802
425 Ga0439445_0082450 3300042004 Bacteria 900
426 Ga0439444_0028166 3300042437 Bacteria 1039
427 Ga0451577_0044384 3300042876 Bacteria 3980
428 Ga0453683_0072496 3300044673 Bacteria 2156
429 Ga0453683_0464403 3300044673 Bacteria 819
430 Ga0453683_1169307 3300044673 Unclassified 514
431 Ga0453684_0825487 3300044712 Bacteria 998
432 Ga0451576_0003131 3300045051 Bacteria 23171
433 Ga0451576_0009663 3300045051 Bacteria 11159
434 Ga0451576_0052021 3300045051 Unclassified 4292
435 Ga0451576_0124866 3300045051 Bacteria 2681
436 Ga0451576_0435148 3300045051 Bacteria 1376
437 Ga0451576_0554143 3300045051 Unclassified 1208
438 Ga0466967_0803844 3300045976 Bacteria 934
439 Ga0495627_001593 3300046453 Bacteria 12752
440 Ga0495603_0063318 3300046455 Bacteria 2182
441 Ga0495629_0834605 3300046459 Bacteria 607
442 Ga0495580_0233579 3300046472 Bacteria 1262
443 Ga0495605_0134240 3300046474 Bacteria 1114
444 Ga0495639_0026741 3300046475 Bacteria 2552
445 Ga0495584_0229946 3300046491 Bacteria 943
446 Ga0495594_0520702 3300046499 Bacteria 675
447 Ga0495596_0255523 3300046500 Bacteria 680
448 Ga0495644_0159487 3300046523 Bacteria 865
449 Ga0495663_0023367 3300046525 Bacteria 1790
450 Ga0495642_0169940 3300046528 Bacteria 947
451 Ga0495642_0338774 3300046528 Bacteria 661
452 Ga0495598_0007728 3300046537 Bacteria 2479
453 Ga0495598_0069337 3300046537 Bacteria 1107
454 Ga0495609_0034840 3300046538 Unclassified 2280
455 Ga0495621_0004188 3300046539 Bacteria 4030
456 Ga0495621_0065617 3300046539 Unclassified 1327
457 Ga0495621_0100819 3300046539 Bacteria 1098
458 Ga0495621_0111077 3300046539 Bacteria 1051
459 Ga0495622_0010974 3300046557 Bacteria 4181
460 Ga0495633_0000036 3300046558 Bacteria 184999
461 Ga0495633_0125417 3300046558 Bacteria 1188
462 Ga0495659_0107867 3300046664 Unclassified 1085
463 Ga0495658_0920191 3300046683 Bacteria 559
464 Ga0495624_0105993 3300046690 Bacteria 1730
465 Ga0495624_0256141 3300046690 Bacteria 1058
466 Ga0495670_0125293 3300046691 Bacteria 1337
467 Ga0495670_0708540 3300046691 Unclassified 549
468 Ga0495649_0104464 3300046694 Bacteria 1504
469 Ga0495589_0084375 3300046794 Bacteria 1544
470 Ga0495672_0029182 3300047320 Bacteria 3478
471 Ga0495672_0035861 3300047320 Bacteria 3051
472 Ga0495676_0132325 3300047321 Bacteria 1799
473 Ga0495677_0021142 3300047445 Bacteria 2359
474 Ga0495626_0114981 3300048091 Bacteria 1161
475 Ga0501031_0600678 3300049568 Unclassified 708
476 Ga0501032_0004687 3300049569 Bacteria 10262
477 Ga0501032_0027679 3300049569 Bacteria 3896
478 Ga0501034_0029202 3300049571 Bacteria 5605
479 Ga0501034_0094207 3300049571 Unclassified 2991
480 Ga0501034_0595746 3300049571 Bacteria 1011
481 Ga0501034_1039295 3300049571 Bacteria 702
482 Ga0501036_0003416 3300049572 Bacteria 12692
483 Ga0501036_0014802 3300049572 Bacteria 6505
484 Ga0501037_0017762 3300049573 Bacteria 5236
485 Ga0501037_0148621 3300049573 Bacteria 1675
486 Ga0501038_0010673 3300049574 Bacteria 8401
487 Ga0501038_0035197 3300049574 Bacteria 4397
488 Ga0501039_0016906 3300049575 Bacteria 5592
489 Ga0501039_0183254 3300049575 Bacteria 1646
490 Ga0501040_1334136 3300049576 Unclassified 521
491 Ga0501043_0020417 3300049579 Bacteria 5196
492 Ga0501043_0130860 3300049579 Bacteria 1966
493 Ga0501046_0003510 3300049580 Bacteria 14366
494 Ga0501046_0036206 3300049580 Bacteria 3974
495 Ga0501047_0055611 3300049581 Bacteria 3826
496 Ga0501047_0128236 3300049581 Bacteria 2417
497 Ga0501047_0875236 3300049581 Bacteria 712
498 Ga0501048_0035118 3300049582 Bacteria 3610
499 Ga0501067_0191508 3300049583 Unclassified 1139
500 Ga0501068_0035423 3300049584 Bacteria 2979
501 Ga0501070_0012717 3300049586 Bacteria 7098
502 Ga0501073_0329772 3300049589 Unclassified 1053
503 Ga0501074_0003003 3300049590 Bacteria 11870
504 Ga0501079_0133957 3300049741 Bacteria 1929
505 Ga0501083_0001228 3300049744 Bacteria 17354
506 Ga0501283_081036 3300049779 Unclassified 610
507 Ga0501035_0009147 3300049822 Bacteria 9212
508 Ga0501035_0117132 3300049822 Bacteria 2331
509 Ga0501044_0008422 3300049823 Bacteria 11308
510 Ga0501044_0200688 3300049823 Bacteria 1953
511 Ga0501044_0232454 3300049823 Bacteria 1791
512 nmdc:mga05p37_1010560_c1 3300050507 Bacteria 882
513 nmdc:mga05p37_1721450_c1 3300050507 Bacteria 610
514 nmdc:mga05p37_214160_c1 3300050507 Bacteria 2327
515 nmdc:mga09592_155092_c1 3300050508 Bacteria 1976
516 nmdc:mga09592_251377_c1 3300050508 Bacteria 1532
517 nmdc:mga09592_50342_c1 3300050508 Bacteria 3514
518 nmdc:mga09592_594457_c1 3300050508 Bacteria 948
519 nmdc:mga09592_856821_c1 3300050508 Bacteria 766
520 nmdc:mga09592_88102_c1 3300050508 Bacteria 2651
521 nmdc:mga0qj67_21761_c1 3300050509 Bacteria 4920
522 nmdc:mga06r32_44707_c1 3300050510 Bacteria 4218
523 nmdc:mga06r32_71087_c1 3300050510 Bacteria 3367
524 nmdc:mga06r32_88897_c1 3300050510 Bacteria 3016
525 nmdc:mga08y16_138339_c1 3300050511 Bacteria 2532
526 nmdc:mga08y16_2581_c1 3300050511 Bacteria 18625
527 nmdc:mga08y16_280677_c1 3300050511 Bacteria 1718
528 nmdc:mga08y16_31684_c1 3300050511 Bacteria 5559
529 nmdc:mga08y16_390725_c1 3300050511 Bacteria 1425
530 nmdc:mga0n895_136554_c1 3300050512 Unclassified 2479
531 nmdc:mga0n895_487610_c1 3300050512 Bacteria 1243
532 nmdc:mga0n895_49930_c1 3300050512 Bacteria 4101
533 nmdc:mga0n895_56595_c1 3300050512 Bacteria 3863
534 nmdc:mga0n895_675494_c1 3300050512 Bacteria 1030
535 nmdc:mga0n895_997938_c1 3300050512 Bacteria 819
536 nmdc:mga0rr50_43004_c1 3300050513 Bacteria 3303
537 nmdc:mga0rr50_46189_c1 3300050513 Bacteria 3206
538 nmdc:mga0rr50_72971_c1 3300050513 Bacteria 2623
539 nmdc:mga08x19_183293_c1 3300050514 Bacteria 1430
540 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
541 nmdc:mga08x19_65414_c1 3300050514 Bacteria 2361
542 nmdc:mga08x19_88852_c1 3300050514 Bacteria 2037
543 nmdc:mga0a205_26342_c1 3300050515 Bacteria 5544
544 nmdc:mga0a205_718405_c1 3300050515 Bacteria 849
545 nmdc:mga0a205_75254_c1 3300050515 Bacteria 3262
546 nmdc:mga0a205_80703_c1 3300050515 Bacteria 3143
547 Ga0500635_0045680 3300053080 Bacteria 1483
548 Ga0500651_0025852 3300053093 Bacteria 3686
549 Ga0500641_0142595 3300053096 Bacteria 1035
550 Ga0500556_0029813 3300053104 Bacteria 1843
551 Ga0500568_0004673 3300053139 Bacteria 7280
552 Ga0500616_0406727 3300053153 Unclassified 543
553 Ga0500637_0061091 3300053178 Bacteria 2158
554 Ga0530510_0054690 3300061734 Bacteria 2885
555 nmdc:mga08x19_82200_c1
556 MRS1b_contig_2669138
557 JGI24751J29686_10001433
558 Ga0065714_10074150
559 Ga0065704_10643246
560 Ga0065704_10752521
561 Ga0065712_10000393
562 Ga0065712_10069663
563 Ga0065712_10350542
564 Ga0065715_10131732
565 Ga0065707_10091743
566 Ga0065707_10227114
567 Ga0070658_10184936
568 Ga0070676_10185212
569 Ga0070676_10191605
570 Ga0070690_100002003
571 Ga0070690_100095727
572 Ga0070670_100004466
573 Ga0070670_100011332
574 Ga0070670_100015247
575 Ga0070670_100043064
576 Ga0070670_100353777
577 Ga0070670_100571015
578 Ga0068869_100018070
579 Ga0068869_100041017
580 Ga0068869_100623128
581 Ga0070666_10167995
582 Ga0070680_100021318
583 Ga0070680_100054899
584 Ga0070680_100306724
585 Ga0068868_100191305
586 Ga0070689_100013704
587 Ga0070689_100103172
588 Ga0070689_100142065
589 Ga0070689_101174762
590 Ga0070689_101228953
591 Ga0070687_100021291
592 Ga0070687_100096694
593 Ga0070687_100250323
594 Ga0070687_100553224
595 Ga0070692_10262707
596 Ga0070692_10289215
597 Ga0070692_10308393
598 Ga0070668_100067980
599 Ga0070668_100630313
600 Ga0070669_100002549
601 Ga0070669_100734582
602 Ga0070675_100004810
603 Ga0070675_100022563
604 Ga0070675_100027677
605 Ga0070671_100488345
606 Ga0070674_100086087
607 Ga0070674_101041095
608 Ga0070674_101075555
609 Ga0070673_100003572
610 Ga0070673_100011926
611 Ga0070673_100029120
612 Ga0070673_100051833
613 Ga0070688_100007036
614 Ga0070688_100016843
615 Ga0070688_100022092
616 Ga0070688_100027353
617 Ga0070688_100881809
618 Ga0070703_10000245
619 Ga0070714_100001866
620 Ga0070714_100813718
621 Ga0070710_10158977
622 Ga0070701_10015250
623 Ga0070701_10067889
624 Ga0070701_10339171
625 Ga0070701_10511211
626 Ga0070701_11219568
627 Ga0070705_100002366
628 Ga0070705_100011027
629 Ga0070705_100012344
630 Ga0070700_100037548
631 Ga0070700_100394143
632 Ga0070700_101508128
633 Ga0070694_100000872
634 Ga0070694_100003743
635 Ga0070694_100007039
636 Ga0070694_100031886
637 Ga0070694_100037712
638 Ga0070708_100043528
639 Ga0070708_100230000
640 Ga0070708_101095099
641 Ga0070678_100465307
642 Ga0070662_100080981
643 Ga0070662_100146896
644 Ga0068867_100020227
645 Ga0068867_100362164
646 Ga0068867_100650848
647 Ga0068867_101107870
648 Ga0070685_10003193
649 Ga0070685_10071027
650 Ga0070685_10082608
651 Ga0070706_100070138
652 Ga0070706_100112000
653 Ga0070706_100138025
654 Ga0070706_100659111
655 Ga0070707_100000077
656 Ga0070707_100009322
657 Ga0070707_100475139
658 Ga0070707_101523336
659 Ga0070698_100001684
660 Ga0070698_100031715
661 Ga0070698_100084673
662 Ga0070698_100534261
663 Ga0070698_101262447
664 Ga0070699_100087007
665 Ga0070699_100093976
666 Ga0070699_100240011
667 Ga0070699_100826566
668 Ga0070697_100009133
669 Ga0070697_100013996
670 Ga0070697_100156401
671 Ga0070697_100180502
672 Ga0070672_100066056
673 Ga0070672_100084227
674 Ga0070672_101041989
675 Ga0070686_100016350
676 Ga0070686_100038440
677 Ga0070686_100265254
678 Ga0070695_100004373
679 Ga0070695_100012926
680 Ga0070695_100060158
681 Ga0070695_100129984
682 Ga0070695_100327449
683 Ga0070696_100005529
684 Ga0070696_100014148
685 Ga0070696_101033178
686 Ga0070704_100001416
687 Ga0070704_100007963
688 Ga0070704_100051875
689 Ga0070704_100073517
690 Ga0070704_101534686
691 Ga0070664_100147240
692 Ga0070664_100169021
693 Ga0068857_100007129
694 Ga0068854_100013145
695 Ga0068854_100898909
696 Ga0070702_100341139
697 Ga0070702_100377759
698 Ga0070702_101118922
699 Ga0068852_101483910
700 Ga0068859_100025026
701 Ga0068859_100028460
702 Ga0068859_100090425
703 Ga0068859_100511419
704 Ga0068859_100704260
705 Ga0068864_100010393
706 Ga0068864_100029845
707 Ga0068864_100082789
708 Ga0068864_100798058
709 Ga0068866_10304594
710 Ga0068861_100056066
711 Ga0068861_100103697
712 Ga0068861_101224172
713 Ga0068870_10102118
714 Ga0068863_100006326
715 Ga0068863_100098238
716 Ga0068863_100190122
717 Ga0068863_100507834
718 Ga0068858_100164222
719 Ga0068860_100273586
720 Ga0068860_100836376
721 Ga0068860_100927276
722 Ga0068862_100001278
723 Ga0068862_100336309
724 Ga0068862_100817665
725 Ga0070717_10155868
726 Ga0075432_10113442
727 Ga0070715_10039729
728 Ga0070712_100512023
729 Ga0097621_100011962
730 Ga0097621_100514175
731 Ga0097621_100551037
732 Ga0068871_100089073
733 Ga0075428_100012694
734 Ga0075428_100027284
735 Ga0075428_100064508
736 Ga0075428_100132510
737 Ga0075428_100335232
738 Ga0075428_100702067
739 Ga0075428_100790913
740 Ga0075430_100203948
741 Ga0075431_100015629
742 Ga0075431_100402196
743 Ga0075433_10034149
744 Ga0075433_10053283
745 Ga0075433_10056824
746 Ga0075433_10177928
747 Ga0075433_10224975
748 Ga0075434_100007170
749 Ga0075434_100007922
750 Ga0075434_100036460
751 Ga0075434_100112314
752 Ga0075434_100163948
753 Ga0075434_100235379
754 Ga0075434_100489519
755 Ga0075429_100051926
756 Ga0075429_100112039
757 Ga0075429_100315389
758 Ga0075429_100326913
759 Ga0075429_100396673
760 Ga0068865_100079019
761 Ga0075436_100137655
762 Ga0075436_100142146
763 Ga0075436_100165819
764 Ga0075436_100188960
765 Ga0097620_100025023
766 Ga0097620_100028459
767 Ga0097620_100090425
768 Ga0097620_100511449
769 Ga0097620_100704253
770 Ga0075435_100004986
771 Ga0075435_100138357
772 Ga0075435_101719420
773 Ga0099794_10000219
774 Ga0099794_10006092
775 Ga0099794_10097943
776 Ga0099794_10216089
777 Ga0111539_10000810
778 Ga0111539_10004662
779 Ga0111539_10025488
780 Ga0111539_10108074
781 Ga0111539_10244532
782 Ga0111539_10439985
783 Ga0111539_10596473
784 Ga0114129_10070261
785 Ga0114129_10074459
786 Ga0114129_10079705
787 Ga0114129_10180094
788 Ga0114129_10649972
789 Ga0114129_11772286
790 Ga0105241_11526261
791 Ga0105242_10001165
792 Ga0105242_10177865
793 Ga0105242_10227866
794 Ga0105242_11210086
795 Ga0105248_10343478
796 Ga0105249_10002749
797 Ga0105249_10003197
798 Ga0105249_10020855
799 Ga0105249_10065121
800 Ga0105249_10085379
801 Ga0105249_10467527
802 Ga0105249_11710068
803 Ga0105249_12319721
804 Ga0105249_12615776
805 Ga0105246_10222218
806 Ga0157374_10610979
807 Ga0157378_10081958
808 Ga0163162_10043360
809 Ga0163162_10052834
810 Ga0163162_10164252
811 Ga0157375_10020946
812 Ga0157375_10135361
813 Ga0157375_10234186
814 Ga0163163_10226857
815 Ga0163163_10326386
816 Ga0163163_10840723
817 Ga0157380_10005493
818 Ga0157380_10017785
819 Ga0157380_10022727
820 Ga0157380_10776908
821 Ga0157377_10000659
822 Ga0157377_10052214
823 Ga0157377_10145595
824 Ga0157377_10492566
825 Ga0157379_10185046
826 Ga0157376_10131389
827 Ga0157376_12258342
828 Ga0163161_10015165
829 Ga0163161_10743936
830 Ga0163161_10831738
831 Ga0197907_10043426
832 Ga0206356_11365317
833 Ga0207666_1041706
834 Ga0207673_1037459
835 Ga0207697_10059773
836 Ga0207697_10065061
837 Ga0207653_10000024
838 Ga0207682_10009872
839 Ga0207682_10234504
840 Ga0207692_10133065
841 Ga0207642_10526589
842 Ga0207685_10006469
843 Ga0207643_10004365
844 Ga0207643_10266344
845 Ga0207705_10038665
846 Ga0207684_10003609
847 Ga0207684_10028463
848 Ga0207684_10056081
849 Ga0207684_10301350
850 Ga0207654_11294295
851 Ga0207693_10400123
852 Ga0207660_10002949
853 Ga0207660_10035319
854 Ga0207660_10462023
855 Ga0207662_10057520
856 Ga0207662_10119839
857 Ga0207662_10128650
858 Ga0207662_10134229
859 Ga0207662_10815578
860 Ga0207649_11004323
861 Ga0207646_10000076
862 Ga0207646_10045006
863 Ga0207646_10185934
864 Ga0207646_10355976
865 Ga0207681_10028135
866 Ga0207681_10075399
867 Ga0207681_10257455
868 Ga0207650_10001285
869 Ga0207650_10192205
870 Ga0207650_10236886
871 Ga0207650_10391284
872 Ga0207650_10688297
873 Ga0207650_11221329
874 Ga0207659_10030626
875 Ga0207659_10221620
876 Ga0207659_10294348
877 Ga0207700_11162853
878 Ga0207664_10017012
879 Ga0207644_10601756
880 Ga0207644_11367370
881 Ga0207706_10036362
882 Ga0207706_10110390
883 Ga0207706_10332173
884 Ga0207686_10000498
885 Ga0207686_10032968
886 Ga0207670_10033390
887 Ga0207670_10042309
888 Ga0207670_10943979
889 Ga0207704_10225253
890 Ga0207704_11848203
891 Ga0207691_10014404
892 Ga0207691_10038893
893 Ga0207691_10183619
894 Ga0207711_10412216
895 Ga0207689_10045161
896 Ga0207689_10053634
897 Ga0207689_10212835
898 Ga0207679_10515145
899 Ga0207667_11401811
900 Ga0207651_10000912
901 Ga0207651_10006411
902 Ga0207651_10020926
903 Ga0207651_10051114
904 Ga0207651_10058501
905 Ga0207712_10001312
906 Ga0207712_10001935
907 Ga0207712_10028489
908 Ga0207712_10513107
909 Ga0207668_10028706
910 Ga0207640_10024352
911 Ga0207640_10177516
912 Ga0207658_10554696
913 Ga0207703_10461384
914 Ga0207708_10303056
915 Ga0207708_10304159
916 Ga0207708_10408855
917 Ga0207641_10000467
918 Ga0207641_10086236
919 Ga0207641_10168910
920 Ga0207648_10031304
921 Ga0207648_10407968
922 Ga0207676_10017905
923 Ga0207676_10176165
924 Ga0207676_10524107
925 Ga0207674_10003180
926 Ga0207675_100000299
927 Ga0207675_100205800
928 Ga0207675_100308952
929 Ga0207675_101028266
930 Ga0207683_10155017
931 Ga0207698_10753171
932 Ga0209588_1000202
933 Ga0209588_1003286
934 Ga0207428_10043138
935 Ga0207428_10135883
936 Ga0207428_10148039
937 Ga0207428_10383608
938 Ga0207428_10781662
939 Ga0268265_10028813
940 Ga0268265_10228365
941 Ga0268265_11278350
942 Ga0268265_11409966
943 Ga0268264_10282397
944 Ga0307408_101894362
945 Ga0316576_10007772
946 Ga0316578_10127318
947 Ga0307405_10009318
948 Ga0316577_10038066
949 Ga0307413_10729486
950 Ga0307410_10086671
951 Ga0307406_10456634
952 Ga0307407_10002547
953 Ga0307412_10003150
954 Ga0307409_100455084
955 Ga0307416_100018583
956 Ga0307416_100072544
957 Ga0307414_10052480
958 Ga0307411_10000879
959 Ga0307411_10158758
960 Ga0307415_100007727
961 Ga0307415_100389232
962 Ga0373926_0175118
963 Ga0373940_0155942
964 Ga0373932_0332830
965 Ga0373956_0251129
966 Ga0373943_0128688
967 Ga0373946_0451871
968 Ga0373942_0008855
969 Ga0373961_0002701
970 Ga0316574_0206095
971 Ga0373935_1051708
972 Ga0373947_0381843
973 Ga0373937_0097898
974 Ga0395898_0930674
975 Ga0451800_0818037
976 Ga0451843_0781955
977 Ga0439441_031243
978 Ga0439445_0016842
979 Ga0439445_0082450
980 Ga0439444_0028166
981 Ga0451577_0044384
982 Ga0453683_0072496
983 Ga0453683_0464403
984 Ga0453683_1169307
985 Ga0453684_0825487
986 Ga0451576_0003131
987 Ga0451576_0009663
988 Ga0451576_0052021
989 Ga0451576_0124866
990 Ga0451576_0435148
991 Ga0451576_0554143
992 Ga0466967_0803844
993 Ga0495627_001593
994 Ga0495603_0063318
995 Ga0495629_0834605
996 Ga0495580_0233579
997 Ga0495605_0134240
998 Ga0495639_0026741
999 Ga0495584_0229946
1000 Ga0495594_0520702
1001 Ga0495596_0255523
1002 Ga0495644_0159487
1003 Ga0495663_0023367
1004 Ga0495642_0169940
1005 Ga0495642_0338774
1006 Ga0495598_0007728
1007 Ga0495598_0069337
1008 Ga0495609_0034840
1009 Ga0495621_0004188
1010 Ga0495621_0065617
1011 Ga0495621_0100819
1012 Ga0495621_0111077
1013 Ga0495622_0010974
1014 Ga0495633_0000036
1015 Ga0495633_0125417
1016 Ga0495659_0107867
1017 Ga0495658_0920191
1018 Ga0495624_0105993
1019 Ga0495624_0256141
1020 Ga0495670_0125293
1021 Ga0495670_0708540
1022 Ga0495649_0104464
1023 Ga0495589_0084375
1024 Ga0495672_0029182
1025 Ga0495672_0035861
1026 Ga0495676_0132325
1027 Ga0495677_0021142
1028 Ga0495626_0114981
1029 Ga0501031_0600678
1030 Ga0501032_0004687
1031 Ga0501032_0027679
1032 Ga0501034_0029202
1033 Ga0501034_0094207
1034 Ga0501034_0595746
1035 Ga0501034_1039295
1036 Ga0501036_0003416
1037 Ga0501036_0014802
1038 Ga0501037_0017762
1039 Ga0501037_0148621
1040 Ga0501038_0010673
1041 Ga0501038_0035197
1042 Ga0501039_0016906
1043 Ga0501039_0183254
1044 Ga0501040_1334136
1045 Ga0501043_0020417
1046 Ga0501043_0130860
1047 Ga0501046_0003510
1048 Ga0501046_0036206
1049 Ga0501047_0055611
1050 Ga0501047_0128236
1051 Ga0501047_0875236
1052 Ga0501048_0035118
1053 Ga0501067_0191508
1054 Ga0501068_0035423
1055 Ga0501070_0012717
1056 Ga0501073_0329772
1057 Ga0501074_0003003
1058 Ga0501079_0133957
1059 Ga0501083_0001228
1060 Ga0501283_081036
1061 Ga0501035_0009147
1062 Ga0501035_0117132
1063 Ga0501044_0008422
1064 Ga0501044_0200688
1065 Ga0501044_0232454
1066 nmdc:mga05p37_1010560_c1
1067 nmdc:mga05p37_1721450_c1
1068 nmdc:mga05p37_214160_c1
1069 nmdc:mga09592_155092_c1
1070 nmdc:mga09592_251377_c1
1071 nmdc:mga09592_50342_c1
1072 nmdc:mga09592_594457_c1
1073 nmdc:mga09592_856821_c1
1074 nmdc:mga09592_88102_c1
1075 nmdc:mga0qj67_21761_c1
1076 nmdc:mga06r32_44707_c1
1077 nmdc:mga06r32_71087_c1
1078 nmdc:mga06r32_88897_c1
1079 nmdc:mga08y16_138339_c1
1080 nmdc:mga08y16_2581_c1
1081 nmdc:mga08y16_280677_c1
1082 nmdc:mga08y16_31684_c1
1083 nmdc:mga08y16_390725_c1
1084 nmdc:mga0n895_136554_c1
1085 nmdc:mga0n895_487610_c1
1086 nmdc:mga0n895_49930_c1
1087 nmdc:mga0n895_56595_c1
1088 nmdc:mga0n895_675494_c1
1089 nmdc:mga0n895_997938_c1
1090 nmdc:mga0rr50_43004_c1
1091 nmdc:mga0rr50_46189_c1
1092 nmdc:mga0rr50_72971_c1
1093 nmdc:mga08x19_183293_c1
1094 nmdc:mga08x19_48_c1
1095 nmdc:mga08x19_65414_c1
1096 nmdc:mga08x19_88852_c1
1097 nmdc:mga0a205_26342_c1
1098 nmdc:mga0a205_718405_c1
1099 nmdc:mga0a205_75254_c1
1100 nmdc:mga0a205_80703_c1
1101 Ga0500635_0045680
1102 Ga0500651_0025852
1103 Ga0500641_0142595
1104 Ga0500556_0029813
1105 Ga0500568_0004673
1106 Ga0500616_0406727
1107 Ga0500637_0061091
1108 Ga0530510_0054690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

55

154

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9802 1 136
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9736 1 135
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9732 1 136
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9663 1 135
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9656 1 136
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.958 1 135 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9445 1 135 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9254 6 136 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9173 4 136 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9064 45 136 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A258Y8I4-F1-model_v4 OsmC family peroxiredoxin 1.003 51 136 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 1.001 44 136 GO:0004601
GO:0006979
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.9994 42 136 GO:0004601
GO:0006979
AF-A0A522GH03-F1-model_v4 OsmC family peroxiredoxin 0.9969 41 136 GO:0004601
GO:0006979
AF-A0A4P5TX77-F1-model_v4 Peroxiredoxin 0.9967 1 136 GO:0004601
GO:0006979

Map