F462970

General Info

Members Datasets Scaffolds Average Seq Length
554 243 1108 127

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100024130|Ga0075428_1000241305
Length 154
Sequence MGTEVTGVSRDLRPQLLIPVEKSPVPLRLDVWLDVACLFKTRSEAQRACKGGKVDVNGQAAKPHREIRPGDVIEITRPLGRRQRVVVRATAEKHLRKAEARALYEDTTPXXSAEEKAMLDLLKLAGPRRRYATQGVPDRRERRRLRRAKEGDPD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 1.81
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100024130 3300006844 Bacteria 6728
2 Ga0058862_12301982 3300004803 Unclassified 627
3 Ga0065712_10078397 3300005290 Unclassified 3353
4 Ga0065715_10171735 3300005293 Bacteria 1541
5 Ga0065715_10339055 3300005293 Bacteria 970
6 Ga0065715_10546754 3300005293 Bacteria 744
7 Ga0065707_10118375 3300005295 Bacteria 2187
8 Ga0065707_10222003 3300005295 Bacteria 1221
9 Ga0070676_10006787 3300005328 Bacteria 6134
10 Ga0070676_10403180 3300005328 Bacteria 952
11 Ga0070676_11070030 3300005328 Bacteria 608
12 Ga0070683_100076967 3300005329 Unclassified 3119
13 Ga0070683_101026439 3300005329 Bacteria 792
14 Ga0070670_100060518 3300005331 Bacteria 3251
15 Ga0070670_100074384 3300005331 Bacteria 2918
16 Ga0070677_10041198 3300005333 Bacteria 1822
17 Ga0070677_10065536 3300005333 Bacteria 1512
18 Ga0070677_10812389 3300005333 Bacteria 535
19 Ga0068869_100037976 3300005334 Bacteria 3428
20 Ga0070666_10058592 3300005335 Bacteria 2604
21 Ga0070666_10209797 3300005335 Bacteria 1371
22 Ga0070680_100401698 3300005336 Bacteria 1168
23 Ga0070682_100710666 3300005337 Bacteria 807
24 Ga0070682_101129790 3300005337 Unclassified 657
25 Ga0070682_101841488 3300005337 Unclassified 529
26 Ga0068868_100011771 3300005338 Bacteria 6377
27 Ga0068868_100655717 3300005338 Bacteria 935
28 Ga0068868_100734946 3300005338 Bacteria 886
29 Ga0070689_100421749 3300005340 Unclassified 1131
30 Ga0070689_101045507 3300005340 Unclassified 728
31 Ga0070691_10085791 3300005341 Bacteria 1547
32 Ga0070687_100064061 3300005343 Bacteria 1952
33 Ga0070687_100246845 3300005343 Bacteria 1107
34 Ga0070687_100285421 3300005343 Bacteria 1041
35 Ga0070661_100733023 3300005344 Unclassified 807
36 Ga0070692_10653695 3300005345 Bacteria 702
37 Ga0070669_100072285 3300005353 Bacteria 2553
38 Ga0070675_100071763 3300005354 Bacteria 2873
39 Ga0070675_100172082 3300005354 Unclassified 1868
40 Ga0070675_100391085 3300005354 Bacteria 1239
41 Ga0070671_100155474 3300005355 Bacteria 1932
42 Ga0070674_100397916 3300005356 Bacteria 1125
43 Ga0070674_100677703 3300005356 Bacteria 879
44 Ga0070674_100756973 3300005356 Bacteria 835
45 Ga0070674_100851106 3300005356 Bacteria 791
46 Ga0070673_100662766 3300005364 Bacteria 956
47 Ga0070688_100099922 3300005365 Bacteria 1911
48 Ga0070688_100162196 3300005365 Unclassified 1537
49 Ga0070659_100315980 3300005366 Bacteria 1305
50 Ga0070659_100336437 3300005366 Unclassified 1264
51 Ga0070667_100815583 3300005367 Bacteria 866
52 Ga0070667_100840794 3300005367 Unclassified 853
53 Ga0070667_100873946 3300005367 Bacteria 836
54 Ga0070703_10046355 3300005406 Bacteria 1374
55 Ga0070709_11018262 3300005434 Bacteria 659
56 Ga0070714_100097587 3300005435 Bacteria 2583
57 Ga0070713_100655588 3300005436 Bacteria 1000
58 Ga0070701_10166052 3300005438 Bacteria 1282
59 Ga0070705_100006406 3300005440 Bacteria 5771
60 Ga0070705_100077327 3300005440 Bacteria 2032
61 Ga0070700_100008958 3300005441 Bacteria 5476
62 Ga0070700_100216596 3300005441 Bacteria 1354
63 Ga0070694_100350967 3300005444 Bacteria 1143
64 Ga0070694_101002337 3300005444 Bacteria 693
65 Ga0070694_101240022 3300005444 Unclassified 626
66 Ga0070708_101217586 3300005445 Unclassified 704
67 Ga0070663_100331877 3300005455 Bacteria 1226
68 Ga0070678_100404984 3300005456 Bacteria 1186
69 Ga0070681_10627814 3300005458 Bacteria 989
70 Ga0070681_10658751 3300005458 Unclassified 962
71 Ga0070681_10844866 3300005458 Bacteria 833
72 Ga0068867_100010348 3300005459 Bacteria 6582
73 Ga0068867_100091138 3300005459 Bacteria 2314
74 Ga0068867_100140066 3300005459 Bacteria 1890
75 Ga0068867_100184608 3300005459 Unclassified 1660
76 Ga0070706_100126044 3300005467 Bacteria 2388
77 Ga0070698_100371130 3300005471 Bacteria 1363
78 Ga0070699_100014248 3300005518 Bacteria 6840
79 Ga0070697_100102277 3300005536 Bacteria 2381
80 Ga0070697_100157120 3300005536 Bacteria 1920
81 Ga0070672_100270456 3300005543 Bacteria 1435
82 Ga0070672_100368500 3300005543 Bacteria 1227
83 Ga0070686_100676997 3300005544 Bacteria 820
84 Ga0070696_100452521 3300005546 Bacteria 1013
85 Ga0070696_100894667 3300005546 Bacteria 736
86 Ga0070693_100015799 3300005547 Bacteria 3895
87 Ga0070665_100000621 3300005548 Bacteria 48400
88 Ga0070665_100021280 3300005548 Bacteria 6522
89 Ga0070665_100073256 3300005548 Unclassified 3432
90 Ga0070665_101121060 3300005548 Unclassified 798
91 Ga0070704_100190287 3300005549 Bacteria 1649
92 Ga0070704_100445494 3300005549 Bacteria 1114
93 Ga0068855_100596887 3300005563 Bacteria 1191
94 Ga0070664_100042066 3300005564 Bacteria 3858
95 Ga0070664_100060609 3300005564 Bacteria 3222
96 Ga0070664_100429265 3300005564 Bacteria 1211
97 Ga0068854_100037763 3300005578 Bacteria 3392
98 Ga0070702_100922025 3300005615 Bacteria 686
99 Ga0068852_100154294 3300005616 Bacteria 2138
100 Ga0068859_100035511 3300005617 Bacteria 5002
101 Ga0068859_100049876 3300005617 Bacteria 4204
102 Ga0068859_100170100 3300005617 Unclassified 2260
103 Ga0068859_100243264 3300005617 Bacteria 1889
104 Ga0068859_102764142 3300005617 Unclassified 539
105 Ga0068864_101655051 3300005618 Unclassified 644
106 Ga0068866_10019856 3300005718 Bacteria 3067
107 Ga0068866_10098064 3300005718 Bacteria 1611
108 Ga0068866_10138921 3300005718 Bacteria 1392
109 Ga0068861_100238255 3300005719 Bacteria 1546
110 Ga0068861_100846824 3300005719 Bacteria 862
111 Ga0068861_101033707 3300005719 Unclassified 786
112 Ga0068851_10235982 3300005834 Bacteria 1032
113 Ga0068851_10537533 3300005834 Bacteria 705
114 Ga0068870_10010446 3300005840 Bacteria 4269
115 Ga0068870_10106950 3300005840 Bacteria 1591
116 Ga0068870_10161479 3300005840 Bacteria 1329
117 Ga0068863_100114584 3300005841 Bacteria 2568
118 Ga0068863_100393809 3300005841 Bacteria 1354
119 Ga0068863_100404362 3300005841 Bacteria 1336
120 Ga0068863_101464707 3300005841 Bacteria 691
121 Ga0068858_100532056 3300005842 Bacteria 1137
122 Ga0068858_100819820 3300005842 Bacteria 908
123 Ga0068860_100096030 3300005843 Bacteria 2825
124 Ga0068860_100252394 3300005843 Bacteria 1718
125 Ga0068860_100448148 3300005843 Unclassified 1283
126 Ga0068860_100754179 3300005843 Bacteria 985
127 Ga0068860_101038614 3300005843 Bacteria 838
128 Ga0068860_101777817 3300005843 Unclassified 638
129 Ga0068862_100243939 3300005844 Bacteria 1635
130 Ga0068862_100351271 3300005844 Bacteria 1368
131 Ga0081455_10374148 3300005937 Unclassified 997
132 Ga0070717_11554600 3300006028 Unclassified 600
133 Ga0075368_10080628 3300006042 Bacteria 1324
134 Ga0075368_10099173 3300006042 Unclassified 1195
135 Ga0075362_10703478 3300006177 Unclassified 527
136 Ga0075367_10023346 3300006178 Bacteria 3479
137 Ga0075367_10166926 3300006178 Unclassified 1370
138 Ga0075366_10001425 3300006195 Bacteria 11924
139 Ga0097621_100021831 3300006237 Bacteria 4961
140 Ga0097621_100067255 3300006237 Bacteria 2953
141 Ga0097621_100359373 3300006237 Bacteria 1297
142 Ga0075370_10123541 3300006353 Unclassified 1508
143 Ga0075370_10369624 3300006353 Bacteria 858
144 Ga0068871_100002095 3300006358 Bacteria 13503
145 Ga0068871_100047268 3300006358 Bacteria 3470
146 Ga0068871_100321138 3300006358 Bacteria 1363
147 Ga0068871_101217421 3300006358 Bacteria 707
148 Ga0075428_100006565 3300006844 Bacteria 12936
149 Ga0075428_100009823 3300006844 Bacteria 10639
150 Ga0075428_100070094 3300006844 Bacteria 3833
151 Ga0075428_100217638 3300006844 Unclassified 2063
152 Ga0075430_100006194 3300006846 Bacteria 10085
153 Ga0075430_100019604 3300006846 Bacteria 5753
154 Ga0075430_100683382 3300006846 Bacteria 846
155 Ga0075430_100722518 3300006846 Bacteria 821
156 Ga0075431_100071863 3300006847 Bacteria 3570
157 Ga0075431_100129512 3300006847 Bacteria 2603
158 Ga0075433_10000807 3300006852 Bacteria 21762
159 Ga0075433_10060674 3300006852 Bacteria 3312
160 Ga0075433_10108971 3300006852 Bacteria 2457
161 Ga0075433_10162398 3300006852 Bacteria 1988
162 Ga0075433_10404542 3300006852 Archaea 1204
163 Ga0075433_10430332 3300006852 Bacteria 1164
164 Ga0075433_10654478 3300006852 Unclassified 921
165 Ga0075434_100005568 3300006871 Bacteria 11477
166 Ga0075434_100185134 3300006871 Bacteria 2103
167 Ga0075434_100186552 3300006871 Unclassified 2094
168 Ga0075434_100289190 3300006871 Bacteria 1659
169 Ga0075434_100860604 3300006871 Unclassified 922
170 Ga0075434_100981710 3300006871 Bacteria 859
171 Ga0075434_101017717 3300006871 Bacteria 842
172 Ga0075429_100002126 3300006880 Bacteria 16535
173 Ga0075429_100016409 3300006880 Bacteria 6421
174 Ga0075429_100194459 3300006880 Bacteria 1777
175 Ga0075429_100352769 3300006880 Bacteria 1288
176 Ga0068865_100012291 3300006881 Bacteria 5385
177 Ga0068865_100101781 3300006881 Bacteria 2104
178 Ga0068865_100111419 3300006881 Bacteria 2019
179 Ga0068865_100117189 3300006881 Bacteria 1974
180 Ga0068865_100136413 3300006881 Bacteria 1845
181 Ga0068865_100376411 3300006881 Bacteria 1157
182 Ga0068865_100495001 3300006881 Unclassified 1018
183 Ga0075436_100079047 3300006914 Bacteria 2278
184 Ga0097620_100035511 3300006931 Bacteria 5002
185 Ga0097620_100049875 3300006931 Bacteria 4204
186 Ga0097620_100170086 3300006931 Unclassified 2260
187 Ga0097620_100243271 3300006931 Bacteria 1889
188 Ga0097620_102765312 3300006931 Unclassified 539
189 Ga0075435_100033842 3300007076 Bacteria 4044
190 Ga0075435_100321441 3300007076 Unclassified 1325
191 Ga0075435_100346541 3300007076 Unclassified 1273
192 Ga0105240_10114102 3300009093 Bacteria 3264
193 Ga0105240_10247681 3300009093 Unclassified 2063
194 Ga0111539_10001311 3300009094 Bacteria 33232
195 Ga0111539_10015122 3300009094 Bacteria 9618
196 Ga0111539_10206144 3300009094 Bacteria 2291
197 Ga0111539_10269314 3300009094 Bacteria 1983
198 Ga0111539_10416727 3300009094 Bacteria 1564
199 Ga0111539_10478479 3300009094 Bacteria 1450
200 Ga0111539_10536987 3300009094 Bacteria 1362
201 Ga0111539_10616608 3300009094 Bacteria 1263
202 Ga0111539_11389958 3300009094 Unclassified 814
203 Ga0111539_11447313 3300009094 Bacteria 797
204 Ga0111539_11468570 3300009094 Unclassified 791
205 Ga0111539_11760654 3300009094 Unclassified 718
206 Ga0111539_11887598 3300009094 Bacteria 693
207 Ga0105245_10064501 3300009098 Bacteria 3310
208 Ga0105245_10091509 3300009098 Bacteria 2799
209 Ga0105245_10731449 3300009098 Bacteria 1024
210 Ga0114129_10000006 3300009147 Bacteria 157531
211 Ga0114129_10026050 3300009147 Bacteria 8281
212 Ga0114129_10034602 3300009147 Bacteria 7136
213 Ga0114129_10042247 3300009147 Bacteria 6418
214 Ga0114129_10058577 3300009147 Bacteria 5388
215 Ga0114129_10073642 3300009147 Unclassified 4758
216 Ga0114129_10475033 3300009147 Bacteria 1637
217 Ga0114129_10475930 3300009147 Bacteria 1635
218 Ga0114129_11720373 3300009147 Bacteria 765
219 Ga0105243_10016993 3300009148 Bacteria 5501
220 Ga0105243_10118345 3300009148 Bacteria 2229
221 Ga0105243_10252924 3300009148 Bacteria 1574
222 Ga0105243_10396104 3300009148 Bacteria 1281
223 Ga0105243_10456868 3300009148 Bacteria 1200
224 Ga0105243_10860632 3300009148 Bacteria 898
225 Ga0105243_11577435 3300009148 Unclassified 682
226 Ga0105243_11688742 3300009148 Unclassified 662
227 Ga0105243_11802909 3300009148 Bacteria 643
228 Ga0105241_10117161 3300009174 Bacteria 2140
229 Ga0105241_10196914 3300009174 Bacteria 1680
230 Ga0105242_10002420 3300009176 Bacteria 14667
231 Ga0105242_10006169 3300009176 Bacteria 9233
232 Ga0105242_10036821 3300009176 Bacteria 3928
233 Ga0105242_10343012 3300009176 Unclassified 1377
234 Ga0105242_10870517 3300009176 Bacteria 898
235 Ga0105242_12001739 3300009176 Bacteria 621
236 Ga0105248_10013363 3300009177 Bacteria 9035
237 Ga0105248_10042827 3300009177 Bacteria 5076
238 Ga0105248_10047014 3300009177 Bacteria 4839
239 Ga0105248_10195424 3300009177 Bacteria 2279
240 Ga0105248_10270855 3300009177 Bacteria 1912
241 Ga0105248_10958098 3300009177 Unclassified 966
242 Ga0105248_11644431 3300009177 Unclassified 728
243 Ga0105248_12119209 3300009177 Bacteria 639
244 Ga0105237_12275600 3300009545 Unclassified 552
245 Ga0105249_10265145 3300009553 Bacteria 1709
246 Ga0105249_10552443 3300009553 Bacteria 1202
247 Ga0105249_10771016 3300009553 Bacteria 1025
248 Ga0105246_10273252 3300011119 Bacteria 1352
249 Ga0157328_1026081 3300012478 Bacteria 526
250 Ga0157370_10274395 3300013104 Bacteria 1558
251 Ga0157369_10426485 3300013105 Bacteria 1375
252 Ga0157374_10017163 3300013296 Bacteria 6371
253 Ga0157378_10463143 3300013297 Bacteria 1260
254 Ga0157378_10687652 3300013297 Bacteria 1041
255 Ga0163162_10909146 3300013306 Unclassified 993
256 Ga0163162_11642119 3300013306 Bacteria 733
257 Ga0157372_10107745 3300013307 Bacteria 3189
258 Ga0157375_10128834 3300013308 Bacteria 2649
259 Ga0157375_10399071 3300013308 Bacteria 1542
260 Ga0157375_10496745 3300013308 Bacteria 1384
261 Ga0157375_11376354 3300013308 Unclassified 831
262 Ga0163163_10000022 3300014325 Bacteria 187289
263 Ga0157380_10051845 3300014326 Bacteria 3247
264 Ga0157380_10089286 3300014326 Bacteria 2538
265 Ga0157380_10398038 3300014326 Bacteria 1306
266 Ga0157380_10416870 3300014326 Bacteria 1279
267 Ga0157377_10003924 3300014745 Bacteria 6778
268 Ga0157377_10838165 3300014745 Bacteria 681
269 Ga0157377_11407605 3300014745 Unclassified 550
270 Ga0157379_10254537 3300014968 Bacteria 1595
271 Ga0157379_11613298 3300014968 Unclassified 634
272 Ga0157376_10002731 3300014969 Bacteria 12035
273 Ga0157376_10135263 3300014969 Unclassified 2205
274 Ga0157376_10243931 3300014969 Unclassified 1675
275 Ga0163161_10630412 3300017792 Bacteria 887
276 Ga0206356_11824222 3300020070 Bacteria 1161
277 Ga0207682_10016300 3300025893 Bacteria 2899
278 Ga0207688_10115179 3300025901 Bacteria 1564
279 Ga0207688_10167845 3300025901 Unclassified 1304
280 Ga0207645_10003946 3300025907 Bacteria 11077
281 Ga0207645_10477813 3300025907 Bacteria 843
282 Ga0207643_10014431 3300025908 Unclassified 4291
283 Ga0207643_10160833 3300025908 Bacteria 1351
284 Ga0207643_10212615 3300025908 Bacteria 1181
285 Ga0207684_10517778 3300025910 Unclassified 1022
286 Ga0207707_10845656 3300025912 Unclassified 760
287 Ga0207695_10219458 3300025913 Bacteria 1809
288 Ga0207662_10308450 3300025918 Bacteria 1054
289 Ga0207662_10704667 3300025918 Bacteria 708
290 Ga0207649_11281865 3300025920 Bacteria 579
291 Ga0207646_11179257 3300025922 Unclassified 672
292 Ga0207646_11279271 3300025922 Unclassified 641
293 Ga0207681_10097169 3300025923 Bacteria 2116
294 Ga0207681_10287864 3300025923 Bacteria 1296
295 Ga0207650_10157051 3300025925 Bacteria 1799
296 Ga0207650_10736461 3300025925 Unclassified 834
297 Ga0207659_10042440 3300025926 Bacteria 3189
298 Ga0207659_10297213 3300025926 Bacteria 1325
299 Ga0207659_10603917 3300025926 Bacteria 936
300 Ga0207687_10002164 3300025927 Bacteria 13401
301 Ga0207690_10296577 3300025932 Unclassified 1264
302 Ga0207690_10971673 3300025932 Bacteria 706
303 Ga0207706_11218526 3300025933 Bacteria 625
304 Ga0207686_10010057 3300025934 Bacteria 5146
305 Ga0207686_10098584 3300025934 Bacteria 1946
306 Ga0207686_10583880 3300025934 Bacteria 877
307 Ga0207686_11198013 3300025934 Bacteria 622
308 Ga0207709_10115607 3300025935 Bacteria 1802
309 Ga0207709_10134721 3300025935 Unclassified 1689
310 Ga0207709_10438389 3300025935 Bacteria 1007
311 Ga0207709_10678770 3300025935 Bacteria 823
312 Ga0207670_10294570 3300025936 Unclassified 1269
313 Ga0207669_10059593 3300025937 Bacteria 2336
314 Ga0207669_10081974 3300025937 Bacteria 2069
315 Ga0207669_10661311 3300025937 Bacteria 855
316 Ga0207704_10056615 3300025938 Bacteria 2403
317 Ga0207704_10098624 3300025938 Bacteria 1941
318 Ga0207704_10130357 3300025938 Bacteria 1740
319 Ga0207704_10343453 3300025938 Bacteria 1159
320 Ga0207704_10365612 3300025938 Bacteria 1128
321 Ga0207704_10472033 3300025938 Bacteria 1005
322 Ga0207665_10349940 3300025939 Bacteria 1115
323 Ga0207691_10158131 3300025940 Bacteria 1989
324 Ga0207691_10424275 3300025940 Bacteria 1133
325 Ga0207711_10132462 3300025941 Bacteria 2236
326 Ga0207711_10133464 3300025941 Bacteria 2228
327 Ga0207711_10176293 3300025941 Bacteria 1942
328 Ga0207711_10483190 3300025941 Unclassified 1154
329 Ga0207711_11414952 3300025941 Bacteria 638
330 Ga0207689_11046773 3300025942 Unclassified 688
331 Ga0207679_10116253 3300025945 Bacteria 2120
332 Ga0207679_11393119 3300025945 Bacteria 643
333 Ga0207651_10041942 3300025960 Bacteria 3042
334 Ga0207651_10079447 3300025960 Bacteria 2357
335 Ga0207712_10516591 3300025961 Bacteria 1023
336 Ga0207712_10798769 3300025961 Bacteria 829
337 Ga0207668_10291065 3300025972 Bacteria 1344
338 Ga0207668_10775715 3300025972 Bacteria 847
339 Ga0207640_10112323 3300025981 Bacteria 1934
340 Ga0207658_10251262 3300025986 Bacteria 1503
341 Ga0207658_10721128 3300025986 Bacteria 902
342 Ga0207658_11250604 3300025986 Unclassified 679
343 Ga0207677_10320527 3300026023 Bacteria 1288
344 Ga0207677_10377882 3300026023 Bacteria 1195
345 Ga0207677_10654888 3300026023 Bacteria 927
346 Ga0207703_10810728 3300026035 Unclassified 894
347 Ga0207678_10377097 3300026067 Bacteria 1226
348 Ga0207708_10018004 3300026075 Bacteria 5316
349 Ga0207708_10070437 3300026075 Unclassified 2677
350 Ga0207708_10265848 3300026075 Bacteria 1385
351 Ga0207641_10374617 3300026088 Bacteria 1362
352 Ga0207648_10003160 3300026089 Bacteria 17361
353 Ga0207648_10128535 3300026089 Bacteria 2229
354 Ga0207648_10204630 3300026089 Bacteria 1751
355 Ga0207648_10277578 3300026089 Bacteria 1498
356 Ga0207648_10390999 3300026089 Bacteria 1259
357 Ga0207648_10686628 3300026089 Bacteria 948
358 Ga0207676_10202245 3300026095 Bacteria 1756
359 Ga0207676_10367279 3300026095 Bacteria 1336
360 Ga0207676_12435965 3300026095 Unclassified 520
361 Ga0207674_10762852 3300026116 Bacteria 934
362 Ga0207674_11847614 3300026116 Unclassified 571
363 Ga0207675_100329260 3300026118 Bacteria 1493
364 Ga0207675_101421718 3300026118 Bacteria 714
365 Ga0207683_10151923 3300026121 Bacteria 2090
366 Ga0207683_10271046 3300026121 Bacteria 1550
367 Ga0207683_10504467 3300026121 Bacteria 1117
368 Ga0207683_10882202 3300026121 Unclassified 831
369 Ga0207698_10041142 3300026142 Bacteria 3441
370 Ga0207428_10004739 3300027907 Bacteria 12864
371 Ga0207428_10199899 3300027907 Bacteria 1504
372 Ga0207428_10337929 3300027907 Bacteria 1110
373 Ga0268266_10155424 3300028379 Unclassified 2065
374 Ga0268266_10274996 3300028379 Bacteria 1564
375 Ga0268265_10152352 3300028380 Bacteria 1952
376 Ga0268265_10590010 3300028380 Bacteria 1060
377 Ga0268265_10624075 3300028380 Bacteria 1033
378 Ga0268265_12122651 3300028380 Bacteria 569
379 Ga0268264_10056325 3300028381 Bacteria 3287
380 Ga0268264_10913372 3300028381 Bacteria 882
381 Ga0268264_11198361 3300028381 Bacteria 769
382 Ga0268264_11867609 3300028381 Unclassified 611
383 Ga0307408_101167370 3300031548 Unclassified 717
384 Ga0307405_10144733 3300031731 Bacteria 1663
385 Ga0307413_10034521 3300031824 Bacteria 2892
386 Ga0307413_10206357 3300031824 Bacteria 1423
387 Ga0307406_10053495 3300031901 Bacteria 2572
388 Ga0307412_10237864 3300031911 Bacteria 1407
389 Ga0307412_11814648 3300031911 Unclassified 561
390 Ga0307416_100052560 3300032002 Bacteria 3263
391 Ga0307416_100139239 3300032002 Unclassified 2202
392 Ga0307416_100836530 3300032002 Bacteria 1018
393 Ga0307411_10296381 3300032005 Bacteria 1295
394 Ga0373934_0451725 3300035086 Unclassified 539
395 Ga0373936_0088849 3300035113 Bacteria 1294
396 Ga0373936_0170292 3300035113 Unclassified 952
397 Ga0373956_0201754 3300035119 Unclassified 943
398 Ga0373943_0167296 3300035170 Bacteria 1201
399 Ga0373955_0195850 3300035172 Bacteria 1202
400 Ga0373955_0364065 3300035172 Bacteria 877
401 Ga0373924_0028840 3300035410 Bacteria 2214
402 Ga0373935_0476333 3300035692 Bacteria 904
403 Ga0395901_0977699 3300038443 Unclassified 824
404 Ga0451800_0366605 3300041459 Unclassified 719
405 Ga0451807_0208678 3300041486 Unclassified 884
406 Ga0451849_0400402 3300041505 Unclassified 870
407 Ga0439431_0230301 3300041997 Bacteria 546
408 Ga0450923_024614 3300042125 Bacteria 1195
409 Ga0439435_0019324 3300042436 Bacteria 1745
410 Ga0439435_0030590 3300042436 Unclassified 1460
411 Ga0439435_0138224 3300042436 Bacteria 774
412 Ga0439444_0037634 3300042437 Bacteria 937
413 Ga0439464_0158680 3300042439 Bacteria 710
414 Ga0439460_0037198 3300042461 Unclassified 1415
415 Ga0450916_023550 3300042530 Bacteria 860
416 Ga0453684_0587922 3300044712 Unclassified 1222
417 Ga0451576_0016001 3300045051 Bacteria 8291
418 Ga0451576_0771324 3300045051 Bacteria 1010
419 Ga0451576_0812395 3300045051 Bacteria 982
420 Ga0495603_0381782 3300046455 Bacteria 808
421 Ga0495653_0702202 3300046463 Unclassified 614
422 Ga0495664_0196473 3300046477 Unclassified 1223
423 Ga0495618_0909512 3300046514 Unclassified 508
424 Ga0495645_0014922 3300046543 Bacteria 5520
425 Ga0495667_0468002 3300046559 Unclassified 791
426 Ga0495599_0082747 3300046678 Bacteria 2005
427 Ga0495647_0201829 3300046681 Unclassified 872
428 Ga0495658_0126357 3300046683 Unclassified 1552
429 Ga0495658_0481408 3300046683 Bacteria 794
430 Ga0495674_0059024 3300047319 Bacteria 3352
431 Ga0495676_0186230 3300047321 Bacteria 1451
432 Ga0496102_0614629 3300048905 Bacteria 1010
433 Ga0496104_0154751 3300048907 Bacteria 2201
434 Ga0496106_1066705 3300048909 Unclassified 634
435 Ga0496107_0759489 3300048910 Unclassified 711
436 Ga0496109_0974347 3300048912 Bacteria 786
437 Ga0496109_1912781 3300048912 Bacteria 526
438 Ga0496109_2037629 3300048912 Bacteria 506
439 Ga0496114_0442360 3300048917 Bacteria 1151
440 Ga0501031_0752624 3300049568 Unclassified 625
441 Ga0501032_0830994 3300049569 Bacteria 583
442 Ga0501033_0834161 3300049570 Bacteria 622
443 Ga0501036_0032151 3300049572 Bacteria 4433
444 Ga0501036_0120029 3300049572 Bacteria 2220
445 Ga0501036_0966840 3300049572 Bacteria 698
446 Ga0501036_0980010 3300049572 Unclassified 692
447 Ga0501036_1520611 3300049572 Bacteria 541
448 Ga0501038_0921459 3300049574 Bacteria 644
449 Ga0501038_1335864 3300049574 Bacteria 517
450 Ga0501038_1360767 3300049574 Unclassified 511
451 Ga0501039_0205080 3300049575 Unclassified 1550
452 Ga0501039_0305051 3300049575 Bacteria 1252
453 Ga0501039_1210963 3300049575 Bacteria 584
454 Ga0501040_0041403 3300049576 Bacteria 3138
455 Ga0501040_0413550 3300049576 Bacteria 969
456 Ga0501040_1062961 3300049576 Unclassified 587
457 Ga0501041_0496421 3300049577 Bacteria 776
458 Ga0501042_0020482 3300049578 Bacteria 4603
459 Ga0501042_0067116 3300049578 Bacteria 2564
460 Ga0501042_0205551 3300049578 Bacteria 1420
461 Ga0501042_0310315 3300049578 Bacteria 1140
462 Ga0501043_0428940 3300049579 Unclassified 996
463 Ga0501046_0984328 3300049580 Bacteria 586
464 Ga0501048_0028013 3300049582 Bacteria 4092
465 Ga0501048_0085813 3300049582 Bacteria 2220
466 Ga0501048_0205445 3300049582 Bacteria 1397
467 Ga0501048_0387983 3300049582 Unclassified 998
468 Ga0501067_0039346 3300049583 Bacteria 2626
469 Ga0501067_0537957 3300049583 Unclassified 654
470 Ga0501069_0277596 3300049585 Unclassified 980
471 Ga0501071_0027392 3300049587 Bacteria 4008
472 Ga0501071_0052658 3300049587 Bacteria 2935
473 Ga0501071_0316476 3300049587 Unclassified 1185
474 Ga0501071_0454995 3300049587 Bacteria 980
475 Ga0501071_0832292 3300049587 Unclassified 712
476 Ga0501071_1093882 3300049587 Bacteria 616
477 Ga0501072_0038225 3300049588 Bacteria 3766
478 Ga0501072_0055151 3300049588 Bacteria 3133
479 Ga0501072_0125495 3300049588 Unclassified 2045
480 Ga0501073_0000724 3300049589 Bacteria 23293
481 Ga0501073_0122678 3300049589 Bacteria 1801
482 Ga0501073_0170531 3300049589 Bacteria 1506
483 Ga0501073_0815851 3300049589 Bacteria 643
484 Ga0501074_1062732 3300049590 Bacteria 569
485 Ga0501075_0061533 3300049591 Bacteria 2829
486 Ga0501075_0171934 3300049591 Bacteria 1654
487 Ga0501075_0356209 3300049591 Bacteria 1115
488 Ga0501076_0024927 3300049592 Bacteria 4627
489 Ga0501076_0046143 3300049592 Bacteria 3442
490 Ga0501079_0318218 3300049741 Bacteria 1218
491 Ga0501080_0084602 3300049742 Bacteria 2947
492 Ga0501080_0171667 3300049742 Bacteria 2000
493 Ga0501279_090402 3300049775 Unclassified 540
494 Ga0501035_0601285 3300049822 Bacteria 896
495 Ga0501035_0934783 3300049822 Bacteria 685
496 Ga0501045_0156562 3300049824 Bacteria 1695
497 Ga0501045_0217989 3300049824 Bacteria 1421
498 nmdc:mga03683_405490_c1 3300050489 Unclassified 651
499 nmdc:mga0k408_54575_c1 3300050493 Bacteria 2316
500 nmdc:mga0k408_548774_c1 3300050493 Bacteria 683
501 nmdc:mga04h51_90558_c1 3300050495 Bacteria 1100
502 nmdc:mga07m45_109076_c1 3300050496 Unclassified 1593
503 nmdc:mga05p37_127432_c1 3300050507 Bacteria 3125
504 nmdc:mga05p37_34711_c1 3300050507 Bacteria 6179
505 nmdc:mga05p37_35250_c1 3300050507 Bacteria 6133
506 nmdc:mga05p37_506641_c1 3300050507 Bacteria 1384
507 nmdc:mga05p37_75965_c1 3300050507 Bacteria 4136
508 nmdc:mga09592_172264_c1 3300050508 Bacteria 1871
509 nmdc:mga09592_1976_c1 3300050508 Bacteria 16534
510 nmdc:mga09592_232548_c1 3300050508 Bacteria 1597
511 nmdc:mga09592_298598_c1 3300050508 Bacteria 1396
512 nmdc:mga09592_34422_c1 3300050508 Bacteria 4234
513 nmdc:mga09592_4292_c1 3300050508 Bacteria 11514
514 nmdc:mga0qj67_121408_c1 3300050509 Bacteria 2114
515 nmdc:mga0qj67_228689_c1 3300050509 Unclassified 587
516 nmdc:mga0qj67_52203_c1 3300050509 Bacteria 3235
517 nmdc:mga06r32_2054_c1 3300050510 Bacteria 18012
518 nmdc:mga06r32_330073_c1 3300050510 Bacteria 1510
519 nmdc:mga08y16_1065145_c1 3300050511 Unclassified 785
520 nmdc:mga08y16_1110133_c1 3300050511 Bacteria 765
521 nmdc:mga08y16_1268568_c1 3300050511 Bacteria 705
522 nmdc:mga08y16_128950_c1 3300050511 Bacteria 2631
523 nmdc:mga08y16_142323_c1 3300050511 Bacteria 2493
524 nmdc:mga08y16_15789_c1 3300050511 Bacteria 7940
525 nmdc:mga08y16_233594_c1 3300050511 Bacteria 1902
526 nmdc:mga08y16_29781_c1 3300050511 Bacteria 5748
527 nmdc:mga08y16_304744_c1 3300050511 Bacteria 1641
528 nmdc:mga08y16_4038_c1 3300050511 Bacteria 15313
529 nmdc:mga08y16_509088_c1 3300050511 Bacteria 1222
530 nmdc:mga08y16_573915_c1 3300050511 Bacteria 1139
531 nmdc:mga0n895_1093261_c1 3300050512 Unclassified 775
532 nmdc:mga0n895_1148573_c1 3300050512 Unclassified 752
533 nmdc:mga0n895_188356_c1 3300050512 Unclassified 2094
534 nmdc:mga0n895_192631_c1 3300050512 Unclassified 2070
535 nmdc:mga0rr50_590096_c1 3300050513 Bacteria 947
536 nmdc:mga0rr50_810557_c1 3300050513 Unclassified 799
537 nmdc:mga08x19_264357_c1 3300050514 Bacteria 1190
538 nmdc:mga0a205_254346_c1 3300050515 Bacteria 1635
539 nmdc:mga0a205_3052_c1 3300050515 Bacteria 14851
540 nmdc:mga0a205_307332_c1 3300050515 Bacteria 1458
541 nmdc:mga0a205_368177_c1 3300050515 Bacteria 1303
542 nmdc:mga0a205_63657_c1 3300050515 Bacteria 3563
543 nmdc:mga0a205_99963_c1 3300050515 Bacteria 2799
544 Ga0495601_0018166 3300053077 Bacteria 4277
545 Ga0495601_0785433 3300053077 Unclassified 605
546 Ga0495595_0105556 3300053084 Bacteria 1362
547 Ga0495619_0017741 3300053085 Bacteria 4510
548 Ga0501084_0332948 3300054114 Bacteria 1282
549 Ga0501084_0632729 3300054114 Bacteria 903
550 Ga0501084_1827909 3300054114 Unclassified 507
551 Ga0501082_0098092 3300060353 Bacteria 2534
552 Ga0501082_0315722 3300060353 Unclassified 1361
553 Ga0501082_1948349 3300060353 Unclassified 512
554 Ga0530510_0064186 3300061734 Unclassified 2660
555 Ga0075428_100024130
556 Ga0058862_12301982
557 Ga0065712_10078397
558 Ga0065715_10171735
559 Ga0065715_10339055
560 Ga0065715_10546754
561 Ga0065707_10118375
562 Ga0065707_10222003
563 Ga0070676_10006787
564 Ga0070676_10403180
565 Ga0070676_11070030
566 Ga0070683_100076967
567 Ga0070683_101026439
568 Ga0070670_100060518
569 Ga0070670_100074384
570 Ga0070677_10041198
571 Ga0070677_10065536
572 Ga0070677_10812389
573 Ga0068869_100037976
574 Ga0070666_10058592
575 Ga0070666_10209797
576 Ga0070680_100401698
577 Ga0070682_100710666
578 Ga0070682_101129790
579 Ga0070682_101841488
580 Ga0068868_100011771
581 Ga0068868_100655717
582 Ga0068868_100734946
583 Ga0070689_100421749
584 Ga0070689_101045507
585 Ga0070691_10085791
586 Ga0070687_100064061
587 Ga0070687_100246845
588 Ga0070687_100285421
589 Ga0070661_100733023
590 Ga0070692_10653695
591 Ga0070669_100072285
592 Ga0070675_100071763
593 Ga0070675_100172082
594 Ga0070675_100391085
595 Ga0070671_100155474
596 Ga0070674_100397916
597 Ga0070674_100677703
598 Ga0070674_100756973
599 Ga0070674_100851106
600 Ga0070673_100662766
601 Ga0070688_100099922
602 Ga0070688_100162196
603 Ga0070659_100315980
604 Ga0070659_100336437
605 Ga0070667_100815583
606 Ga0070667_100840794
607 Ga0070667_100873946
608 Ga0070703_10046355
609 Ga0070709_11018262
610 Ga0070714_100097587
611 Ga0070713_100655588
612 Ga0070701_10166052
613 Ga0070705_100006406
614 Ga0070705_100077327
615 Ga0070700_100008958
616 Ga0070700_100216596
617 Ga0070694_100350967
618 Ga0070694_101002337
619 Ga0070694_101240022
620 Ga0070708_101217586
621 Ga0070663_100331877
622 Ga0070678_100404984
623 Ga0070681_10627814
624 Ga0070681_10658751
625 Ga0070681_10844866
626 Ga0068867_100010348
627 Ga0068867_100091138
628 Ga0068867_100140066
629 Ga0068867_100184608
630 Ga0070706_100126044
631 Ga0070698_100371130
632 Ga0070699_100014248
633 Ga0070697_100102277
634 Ga0070697_100157120
635 Ga0070672_100270456
636 Ga0070672_100368500
637 Ga0070686_100676997
638 Ga0070696_100452521
639 Ga0070696_100894667
640 Ga0070693_100015799
641 Ga0070665_100000621
642 Ga0070665_100021280
643 Ga0070665_100073256
644 Ga0070665_101121060
645 Ga0070704_100190287
646 Ga0070704_100445494
647 Ga0068855_100596887
648 Ga0070664_100042066
649 Ga0070664_100060609
650 Ga0070664_100429265
651 Ga0068854_100037763
652 Ga0070702_100922025
653 Ga0068852_100154294
654 Ga0068859_100035511
655 Ga0068859_100049876
656 Ga0068859_100170100
657 Ga0068859_100243264
658 Ga0068859_102764142
659 Ga0068864_101655051
660 Ga0068866_10019856
661 Ga0068866_10098064
662 Ga0068866_10138921
663 Ga0068861_100238255
664 Ga0068861_100846824
665 Ga0068861_101033707
666 Ga0068851_10235982
667 Ga0068851_10537533
668 Ga0068870_10010446
669 Ga0068870_10106950
670 Ga0068870_10161479
671 Ga0068863_100114584
672 Ga0068863_100393809
673 Ga0068863_100404362
674 Ga0068863_101464707
675 Ga0068858_100532056
676 Ga0068858_100819820
677 Ga0068860_100096030
678 Ga0068860_100252394
679 Ga0068860_100448148
680 Ga0068860_100754179
681 Ga0068860_101038614
682 Ga0068860_101777817
683 Ga0068862_100243939
684 Ga0068862_100351271
685 Ga0081455_10374148
686 Ga0070717_11554600
687 Ga0075368_10080628
688 Ga0075368_10099173
689 Ga0075362_10703478
690 Ga0075367_10023346
691 Ga0075367_10166926
692 Ga0075366_10001425
693 Ga0097621_100021831
694 Ga0097621_100067255
695 Ga0097621_100359373
696 Ga0075370_10123541
697 Ga0075370_10369624
698 Ga0068871_100002095
699 Ga0068871_100047268
700 Ga0068871_100321138
701 Ga0068871_101217421
702 Ga0075428_100006565
703 Ga0075428_100009823
704 Ga0075428_100070094
705 Ga0075428_100217638
706 Ga0075430_100006194
707 Ga0075430_100019604
708 Ga0075430_100683382
709 Ga0075430_100722518
710 Ga0075431_100071863
711 Ga0075431_100129512
712 Ga0075433_10000807
713 Ga0075433_10060674
714 Ga0075433_10108971
715 Ga0075433_10162398
716 Ga0075433_10404542
717 Ga0075433_10430332
718 Ga0075433_10654478
719 Ga0075434_100005568
720 Ga0075434_100185134
721 Ga0075434_100186552
722 Ga0075434_100289190
723 Ga0075434_100860604
724 Ga0075434_100981710
725 Ga0075434_101017717
726 Ga0075429_100002126
727 Ga0075429_100016409
728 Ga0075429_100194459
729 Ga0075429_100352769
730 Ga0068865_100012291
731 Ga0068865_100101781
732 Ga0068865_100111419
733 Ga0068865_100117189
734 Ga0068865_100136413
735 Ga0068865_100376411
736 Ga0068865_100495001
737 Ga0075436_100079047
738 Ga0097620_100035511
739 Ga0097620_100049875
740 Ga0097620_100170086
741 Ga0097620_100243271
742 Ga0097620_102765312
743 Ga0075435_100033842
744 Ga0075435_100321441
745 Ga0075435_100346541
746 Ga0105240_10114102
747 Ga0105240_10247681
748 Ga0111539_10001311
749 Ga0111539_10015122
750 Ga0111539_10206144
751 Ga0111539_10269314
752 Ga0111539_10416727
753 Ga0111539_10478479
754 Ga0111539_10536987
755 Ga0111539_10616608
756 Ga0111539_11389958
757 Ga0111539_11447313
758 Ga0111539_11468570
759 Ga0111539_11760654
760 Ga0111539_11887598
761 Ga0105245_10064501
762 Ga0105245_10091509
763 Ga0105245_10731449
764 Ga0114129_10000006
765 Ga0114129_10026050
766 Ga0114129_10034602
767 Ga0114129_10042247
768 Ga0114129_10058577
769 Ga0114129_10073642
770 Ga0114129_10475033
771 Ga0114129_10475930
772 Ga0114129_11720373
773 Ga0105243_10016993
774 Ga0105243_10118345
775 Ga0105243_10252924
776 Ga0105243_10396104
777 Ga0105243_10456868
778 Ga0105243_10860632
779 Ga0105243_11577435
780 Ga0105243_11688742
781 Ga0105243_11802909
782 Ga0105241_10117161
783 Ga0105241_10196914
784 Ga0105242_10002420
785 Ga0105242_10006169
786 Ga0105242_10036821
787 Ga0105242_10343012
788 Ga0105242_10870517
789 Ga0105242_12001739
790 Ga0105248_10013363
791 Ga0105248_10042827
792 Ga0105248_10047014
793 Ga0105248_10195424
794 Ga0105248_10270855
795 Ga0105248_10958098
796 Ga0105248_11644431
797 Ga0105248_12119209
798 Ga0105237_12275600
799 Ga0105249_10265145
800 Ga0105249_10552443
801 Ga0105249_10771016
802 Ga0105246_10273252
803 Ga0157328_1026081
804 Ga0157370_10274395
805 Ga0157369_10426485
806 Ga0157374_10017163
807 Ga0157378_10463143
808 Ga0157378_10687652
809 Ga0163162_10909146
810 Ga0163162_11642119
811 Ga0157372_10107745
812 Ga0157375_10128834
813 Ga0157375_10399071
814 Ga0157375_10496745
815 Ga0157375_11376354
816 Ga0163163_10000022
817 Ga0157380_10051845
818 Ga0157380_10089286
819 Ga0157380_10398038
820 Ga0157380_10416870
821 Ga0157377_10003924
822 Ga0157377_10838165
823 Ga0157377_11407605
824 Ga0157379_10254537
825 Ga0157379_11613298
826 Ga0157376_10002731
827 Ga0157376_10135263
828 Ga0157376_10243931
829 Ga0163161_10630412
830 Ga0206356_11824222
831 Ga0207682_10016300
832 Ga0207688_10115179
833 Ga0207688_10167845
834 Ga0207645_10003946
835 Ga0207645_10477813
836 Ga0207643_10014431
837 Ga0207643_10160833
838 Ga0207643_10212615
839 Ga0207684_10517778
840 Ga0207707_10845656
841 Ga0207695_10219458
842 Ga0207662_10308450
843 Ga0207662_10704667
844 Ga0207649_11281865
845 Ga0207646_11179257
846 Ga0207646_11279271
847 Ga0207681_10097169
848 Ga0207681_10287864
849 Ga0207650_10157051
850 Ga0207650_10736461
851 Ga0207659_10042440
852 Ga0207659_10297213
853 Ga0207659_10603917
854 Ga0207687_10002164
855 Ga0207690_10296577
856 Ga0207690_10971673
857 Ga0207706_11218526
858 Ga0207686_10010057
859 Ga0207686_10098584
860 Ga0207686_10583880
861 Ga0207686_11198013
862 Ga0207709_10115607
863 Ga0207709_10134721
864 Ga0207709_10438389
865 Ga0207709_10678770
866 Ga0207670_10294570
867 Ga0207669_10059593
868 Ga0207669_10081974
869 Ga0207669_10661311
870 Ga0207704_10056615
871 Ga0207704_10098624
872 Ga0207704_10130357
873 Ga0207704_10343453
874 Ga0207704_10365612
875 Ga0207704_10472033
876 Ga0207665_10349940
877 Ga0207691_10158131
878 Ga0207691_10424275
879 Ga0207711_10132462
880 Ga0207711_10133464
881 Ga0207711_10176293
882 Ga0207711_10483190
883 Ga0207711_11414952
884 Ga0207689_11046773
885 Ga0207679_10116253
886 Ga0207679_11393119
887 Ga0207651_10041942
888 Ga0207651_10079447
889 Ga0207712_10516591
890 Ga0207712_10798769
891 Ga0207668_10291065
892 Ga0207668_10775715
893 Ga0207640_10112323
894 Ga0207658_10251262
895 Ga0207658_10721128
896 Ga0207658_11250604
897 Ga0207677_10320527
898 Ga0207677_10377882
899 Ga0207677_10654888
900 Ga0207703_10810728
901 Ga0207678_10377097
902 Ga0207708_10018004
903 Ga0207708_10070437
904 Ga0207708_10265848
905 Ga0207641_10374617
906 Ga0207648_10003160
907 Ga0207648_10128535
908 Ga0207648_10204630
909 Ga0207648_10277578
910 Ga0207648_10390999
911 Ga0207648_10686628
912 Ga0207676_10202245
913 Ga0207676_10367279
914 Ga0207676_12435965
915 Ga0207674_10762852
916 Ga0207674_11847614
917 Ga0207675_100329260
918 Ga0207675_101421718
919 Ga0207683_10151923
920 Ga0207683_10271046
921 Ga0207683_10504467
922 Ga0207683_10882202
923 Ga0207698_10041142
924 Ga0207428_10004739
925 Ga0207428_10199899
926 Ga0207428_10337929
927 Ga0268266_10155424
928 Ga0268266_10274996
929 Ga0268265_10152352
930 Ga0268265_10590010
931 Ga0268265_10624075
932 Ga0268265_12122651
933 Ga0268264_10056325
934 Ga0268264_10913372
935 Ga0268264_11198361
936 Ga0268264_11867609
937 Ga0307408_101167370
938 Ga0307405_10144733
939 Ga0307413_10034521
940 Ga0307413_10206357
941 Ga0307406_10053495
942 Ga0307412_10237864
943 Ga0307412_11814648
944 Ga0307416_100052560
945 Ga0307416_100139239
946 Ga0307416_100836530
947 Ga0307411_10296381
948 Ga0373934_0451725
949 Ga0373936_0088849
950 Ga0373936_0170292
951 Ga0373956_0201754
952 Ga0373943_0167296
953 Ga0373955_0195850
954 Ga0373955_0364065
955 Ga0373924_0028840
956 Ga0373935_0476333
957 Ga0395901_0977699
958 Ga0451800_0366605
959 Ga0451807_0208678
960 Ga0451849_0400402
961 Ga0439431_0230301
962 Ga0450923_024614
963 Ga0439435_0019324
964 Ga0439435_0030590
965 Ga0439435_0138224
966 Ga0439444_0037634
967 Ga0439464_0158680
968 Ga0439460_0037198
969 Ga0450916_023550
970 Ga0453684_0587922
971 Ga0451576_0016001
972 Ga0451576_0771324
973 Ga0451576_0812395
974 Ga0495603_0381782
975 Ga0495653_0702202
976 Ga0495664_0196473
977 Ga0495618_0909512
978 Ga0495645_0014922
979 Ga0495667_0468002
980 Ga0495599_0082747
981 Ga0495647_0201829
982 Ga0495658_0126357
983 Ga0495658_0481408
984 Ga0495674_0059024
985 Ga0495676_0186230
986 Ga0496102_0614629
987 Ga0496104_0154751
988 Ga0496106_1066705
989 Ga0496107_0759489
990 Ga0496109_0974347
991 Ga0496109_1912781
992 Ga0496109_2037629
993 Ga0496114_0442360
994 Ga0501031_0752624
995 Ga0501032_0830994
996 Ga0501033_0834161
997 Ga0501036_0032151
998 Ga0501036_0120029
999 Ga0501036_0966840
1000 Ga0501036_0980010
1001 Ga0501036_1520611
1002 Ga0501038_0921459
1003 Ga0501038_1335864
1004 Ga0501038_1360767
1005 Ga0501039_0205080
1006 Ga0501039_0305051
1007 Ga0501039_1210963
1008 Ga0501040_0041403
1009 Ga0501040_0413550
1010 Ga0501040_1062961
1011 Ga0501041_0496421
1012 Ga0501042_0020482
1013 Ga0501042_0067116
1014 Ga0501042_0205551
1015 Ga0501042_0310315
1016 Ga0501043_0428940
1017 Ga0501046_0984328
1018 Ga0501048_0028013
1019 Ga0501048_0085813
1020 Ga0501048_0205445
1021 Ga0501048_0387983
1022 Ga0501067_0039346
1023 Ga0501067_0537957
1024 Ga0501069_0277596
1025 Ga0501071_0027392
1026 Ga0501071_0052658
1027 Ga0501071_0316476
1028 Ga0501071_0454995
1029 Ga0501071_0832292
1030 Ga0501071_1093882
1031 Ga0501072_0038225
1032 Ga0501072_0055151
1033 Ga0501072_0125495
1034 Ga0501073_0000724
1035 Ga0501073_0122678
1036 Ga0501073_0170531
1037 Ga0501073_0815851
1038 Ga0501074_1062732
1039 Ga0501075_0061533
1040 Ga0501075_0171934
1041 Ga0501075_0356209
1042 Ga0501076_0024927
1043 Ga0501076_0046143
1044 Ga0501079_0318218
1045 Ga0501080_0084602
1046 Ga0501080_0171667
1047 Ga0501279_090402
1048 Ga0501035_0601285
1049 Ga0501035_0934783
1050 Ga0501045_0156562
1051 Ga0501045_0217989
1052 nmdc:mga03683_405490_c1
1053 nmdc:mga0k408_54575_c1
1054 nmdc:mga0k408_548774_c1
1055 nmdc:mga04h51_90558_c1
1056 nmdc:mga07m45_109076_c1
1057 nmdc:mga05p37_127432_c1
1058 nmdc:mga05p37_34711_c1
1059 nmdc:mga05p37_35250_c1
1060 nmdc:mga05p37_506641_c1
1061 nmdc:mga05p37_75965_c1
1062 nmdc:mga09592_172264_c1
1063 nmdc:mga09592_1976_c1
1064 nmdc:mga09592_232548_c1
1065 nmdc:mga09592_298598_c1
1066 nmdc:mga09592_34422_c1
1067 nmdc:mga09592_4292_c1
1068 nmdc:mga0qj67_121408_c1
1069 nmdc:mga0qj67_228689_c1
1070 nmdc:mga0qj67_52203_c1
1071 nmdc:mga06r32_2054_c1
1072 nmdc:mga06r32_330073_c1
1073 nmdc:mga08y16_1065145_c1
1074 nmdc:mga08y16_1110133_c1
1075 nmdc:mga08y16_1268568_c1
1076 nmdc:mga08y16_128950_c1
1077 nmdc:mga08y16_142323_c1
1078 nmdc:mga08y16_15789_c1
1079 nmdc:mga08y16_233594_c1
1080 nmdc:mga08y16_29781_c1
1081 nmdc:mga08y16_304744_c1
1082 nmdc:mga08y16_4038_c1
1083 nmdc:mga08y16_509088_c1
1084 nmdc:mga08y16_573915_c1
1085 nmdc:mga0n895_1093261_c1
1086 nmdc:mga0n895_1148573_c1
1087 nmdc:mga0n895_188356_c1
1088 nmdc:mga0n895_192631_c1
1089 nmdc:mga0rr50_590096_c1
1090 nmdc:mga0rr50_810557_c1
1091 nmdc:mga08x19_264357_c1
1092 nmdc:mga0a205_254346_c1
1093 nmdc:mga0a205_3052_c1
1094 nmdc:mga0a205_307332_c1
1095 nmdc:mga0a205_368177_c1
1096 nmdc:mga0a205_63657_c1
1097 nmdc:mga0a205_99963_c1
1098 Ga0495601_0018166
1099 Ga0495601_0785433
1100 Ga0495595_0105556
1101 Ga0495619_0017741
1102 Ga0501084_0332948
1103 Ga0501084_0632729
1104 Ga0501084_1827909
1105 Ga0501082_0098092
1106 Ga0501082_0315722
1107 Ga0501082_1948349
1108 Ga0530510_0064186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

27

73

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.927 3 83
7ope-assembly1.cif.gz_1 rqch dr variant bound to 50s-peptidyl-trna-rqcp rqc complex (rigid body refinement) 0.9148 3 83
7pah-assembly1.cif.gz_C 70s ribosome with p- and e-site trnas in mycoplasma pneumoniae cells 0.9105 4 51
5wxm-assembly1.cif.gz_A crystal structure of the imp3 and mpp10 complex 0.9105 4 43
7pao-assembly1.cif.gz_C 70s ribosome with ef-g, a*- and p/e-site trnas in mycoplasma pneumoniae cells 0.9063 4 51
ID Description Score Start End Superfamily
af_Q4D8U8_345_395_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9434 17 51 3.10.290.10
af_Q2G0R5_1_87_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9394 3 83 3.10.290.10
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.93 2 51 3.10.290.10
af_Q2FZ78_3_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9203 3 52 3.10.290.10
af_Q2FXH7_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.914 3 51 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A2Z6TBY2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9782 3 83 GO:0003723
AF-A0A6A8MCS5-F1-model_v4 RNA-binding S4 domain-containing protein 0.9739 3 83 GO:0003723
AF-A0A7T8GGZ0-F1-model_v4 deleted 0.9732 3 83
AF-A0A524GND1-F1-model_v4 RNA-binding S4 domain-containing protein 0.9718 2 91 GO:0003723
AF-C2E385-F1-model_v4 S4 domain protein 0.9717 2 83 GO:0003723

Map