F462959

General Info

Members Datasets Scaffolds Average Seq Length
554 276 1108 118

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100068142|Ga0070699_1000681423
Length 130
Sequence MTPLPVSIAAAVASFLLLVVVFELIRSRRLRERYALLWLLTGAVLLALSVWRDGLNTIAGWFGVETYPPAILGAVGALFILMVLLHYSTVISRLSDQNTILAQRLALLEQQQREGDDNQGTVTLTGGLTT

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
169 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 12.09
Rhizosphere 86.1
Stem 0
Stem Tuber 0
Unclassified 9.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100068142 3300005518 Bacteria 3090
2 JGI24744J21845_10004720 3300002077 Bacteria 2815
3 JGI24742J22300_10017928 3300002244 Bacteria 1199
4 JGI25407J50210_10002414 3300003373 Bacteria 4392
5 Ga0070658_10035012 3300005327 Bacteria 4042
6 Ga0070683_100569297 3300005329 Bacteria 1083
7 Ga0070690_100106165 3300005330 Bacteria 1868
8 Ga0068869_100560001 3300005334 Bacteria 961
9 Ga0070666_10047741 3300005335 Bacteria 2875
10 Ga0070682_100006677 3300005337 Bacteria 6468
11 Ga0070682_101861028 3300005337 Bacteria 526
12 Ga0068868_100316848 3300005338 Bacteria 1328
13 Ga0070660_100033936 3300005339 Bacteria 3851
14 Ga0070660_100441818 3300005339 Bacteria 1078
15 Ga0070691_10094768 3300005341 Bacteria 1476
16 Ga0070661_100508155 3300005344 Unclassified 965
17 Ga0070692_10255144 3300005345 Bacteria 1052
18 Ga0070668_100004701 3300005347 Bacteria 10118
19 Ga0070669_100069451 3300005353 Bacteria 2602
20 Ga0070675_101679778 3300005354 Bacteria 586
21 Ga0070671_100023236 3300005355 Bacteria 5072
22 Ga0070674_100037241 3300005356 Bacteria 3271
23 Ga0070674_100743823 3300005356 Bacteria 842
24 Ga0070673_100069898 3300005364 Bacteria 2816
25 Ga0070688_100129472 3300005365 Bacteria 1700
26 Ga0070688_101123851 3300005365 Bacteria 629
27 Ga0070659_100171895 3300005366 Bacteria 1775
28 Ga0070659_101141605 3300005366 Bacteria 688
29 Ga0070659_101885958 3300005366 Unclassified 536
30 Ga0070703_10008605 3300005406 Bacteria 2871
31 Ga0070709_10841993 3300005434 Bacteria 722
32 Ga0070713_101663893 3300005436 Bacteria 619
33 Ga0070710_10003203 3300005437 Bacteria 7759
34 Ga0070701_10032588 3300005438 Bacteria 2597
35 Ga0070711_100044276 3300005439 Bacteria 3020
36 Ga0070711_100100009 3300005439 Bacteria 2108
37 Ga0070711_100340546 3300005439 Bacteria 1203
38 Ga0070700_100027653 3300005441 Bacteria 3365
39 Ga0070700_100870219 3300005441 Bacteria 731
40 Ga0070694_100025256 3300005444 Bacteria 3843
41 Ga0070708_100207875 3300005445 Bacteria 1834
42 Ga0070708_100380564 3300005445 Bacteria 1331
43 Ga0070708_100609768 3300005445 Bacteria 1029
44 Ga0070708_100634821 3300005445 Bacteria 1007
45 Ga0070708_101172220 3300005445 Unclassified 719
46 Ga0070708_101485220 3300005445 Unclassified 632
47 Ga0070708_101489632 3300005445 Unclassified 631
48 Ga0070663_100103599 3300005455 Bacteria 2127
49 Ga0070678_100001730 3300005456 Bacteria 11723
50 Ga0070678_100263626 3300005456 Bacteria 1450
51 Ga0070662_100527728 3300005457 Bacteria 987
52 Ga0070681_10038492 3300005458 Bacteria 4795
53 Ga0070681_10211312 3300005458 Bacteria 1856
54 Ga0070681_10358860 3300005458 Bacteria 1367
55 Ga0068867_100001632 3300005459 Bacteria 15598
56 Ga0070685_10003109 3300005466 Bacteria 8434
57 Ga0070706_100009828 3300005467 Bacteria 8890
58 Ga0070706_101985779 3300005467 Bacteria 527
59 Ga0070707_100018574 3300005468 Bacteria 6542
60 Ga0070707_100040652 3300005468 Bacteria 4449
61 Ga0070707_100591578 3300005468 Bacteria 1072
62 Ga0070698_100001402 3300005471 Bacteria 26692
63 Ga0070698_100079238 3300005471 Bacteria 3282
64 Ga0070698_100519831 3300005471 Bacteria 1129
65 Ga0070698_100531937 3300005471 Unclassified 1114
66 Ga0070699_100078230 3300005518 Bacteria 2880
67 Ga0070699_100615406 3300005518 Bacteria 991
68 Ga0070699_101309015 3300005518 Unclassified 665
69 Ga0070679_100278445 3300005530 Bacteria 1626
70 Ga0070697_100287351 3300005536 Bacteria 1412
71 Ga0070697_100838009 3300005536 Bacteria 814
72 Ga0070697_100974211 3300005536 Bacteria 753
73 Ga0070697_102049612 3300005536 Bacteria 512
74 Ga0068853_100012011 3300005539 Bacteria 7044
75 Ga0068853_102161240 3300005539 Unclassified 540
76 Ga0070686_100006620 3300005544 Bacteria 6448
77 Ga0070686_101288297 3300005544 Bacteria 610
78 Ga0070695_100203879 3300005545 Bacteria 1415
79 Ga0070696_100008994 3300005546 Bacteria 6685
80 Ga0070693_100274377 3300005547 Bacteria 1127
81 Ga0070693_100332060 3300005547 Unclassified 1035
82 Ga0070665_100290271 3300005548 Bacteria 1638
83 Ga0070704_100004845 3300005549 Bacteria 7801
84 Ga0070704_100595815 3300005549 Bacteria 971
85 Ga0068855_100591344 3300005563 Bacteria 1198
86 Ga0068855_101587825 3300005563 Bacteria 670
87 Ga0068854_101105827 3300005578 Bacteria 706
88 Ga0068856_100031153 3300005614 Bacteria 5217
89 Ga0068856_101042434 3300005614 Bacteria 836
90 Ga0068856_101723712 3300005614 Bacteria 639
91 Ga0068852_100018773 3300005616 Bacteria 5454
92 Ga0068859_100508736 3300005617 Bacteria 1299
93 Ga0068859_102016554 3300005617 Unclassified 637
94 Ga0068864_100217051 3300005618 Bacteria 1763
95 Ga0068866_10000367 3300005718 Bacteria 21182
96 Ga0068866_10723537 3300005718 Bacteria 685
97 Ga0068858_100771745 3300005842 Bacteria 937
98 Ga0068862_100752990 3300005844 Bacteria 948
99 Ga0081538_10014054 3300005981 Bacteria 6294
100 Ga0081539_10001497 3300005985 Bacteria 39539
101 Ga0081539_10009136 3300005985 Bacteria 8375
102 Ga0081539_10012688 3300005985 Bacteria 6454
103 Ga0081539_10069477 3300005985 Bacteria 1895
104 Ga0070717_10036706 3300006028 Bacteria 3977
105 Ga0075365_10010945 3300006038 Bacteria 5313
106 Ga0075363_100308931 3300006048 Bacteria 919
107 Ga0070715_10334455 3300006163 Bacteria 822
108 Ga0070712_100010988 3300006175 Bacteria 5728
109 Ga0070712_100026378 3300006175 Bacteria 3870
110 Ga0070712_100513548 3300006175 Bacteria 1006
111 Ga0070712_101869760 3300006175 Bacteria 526
112 Ga0097621_100013753 3300006237 Bacteria 6042
113 Ga0068871_100006279 3300006358 Bacteria 8387
114 Ga0075428_100275586 3300006844 Bacteria 1810
115 Ga0075428_100933270 3300006844 Bacteria 920
116 Ga0075431_100119626 3300006847 Bacteria 2718
117 Ga0075431_100238609 3300006847 Bacteria 1850
118 Ga0075431_100333658 3300006847 Bacteria 1527
119 Ga0075433_10085691 3300006852 Bacteria 2781
120 Ga0075433_11157656 3300006852 Unclassified 672
121 Ga0075434_100002180 3300006871 Bacteria 17076
122 Ga0075434_100104889 3300006871 Bacteria 2836
123 Ga0075434_100357231 3300006871 Bacteria 1482
124 Ga0075434_100643033 3300006871 Unclassified 1079
125 Ga0075434_102133342 3300006871 Bacteria 565
126 Ga0075429_100990231 3300006880 Bacteria 735
127 Ga0068865_100001537 3300006881 Bacteria 13461
128 Ga0075436_100002713 3300006914 Bacteria 12181
129 Ga0075436_100091379 3300006914 Bacteria 2116
130 Ga0075436_101329984 3300006914 Bacteria 544
131 Ga0097620_100508728 3300006931 Bacteria 1299
132 Ga0097620_102016784 3300006931 Unclassified 637
133 Ga0075435_100003253 3300007076 Bacteria 11005
134 Ga0075435_100377412 3300007076 Bacteria 1218
135 Ga0099795_10378412 3300007788 Bacteria 639
136 Ga0111539_10141967 3300009094 Bacteria 2811
137 Ga0111539_10291538 3300009094 Bacteria 1899
138 Ga0105245_10000687 3300009098 Bacteria 30520
139 Ga0105245_10432889 3300009098 Bacteria 1320
140 Ga0105247_10110196 3300009101 Bacteria 1771
141 Ga0114129_10003155 3300009147 Bacteria 23125
142 Ga0114129_10024795 3300009147 Bacteria 8502
143 Ga0114129_10109144 3300009147 Bacteria 3820
144 Ga0114129_10147250 3300009147 Bacteria 3225
145 Ga0114129_10351926 3300009147 Bacteria 1951
146 Ga0114129_10707114 3300009147 Bacteria 1294
147 Ga0114129_10913659 3300009147 Bacteria 1111
148 Ga0105243_10446591 3300009148 Bacteria 1212
149 Ga0105243_11973797 3300009148 Unclassified 617
150 Ga0105241_10048536 3300009174 Bacteria 3231
151 Ga0105242_10032092 3300009176 Bacteria 4199
152 Ga0105248_10007823 3300009177 Bacteria 11735
153 Ga0105248_13143155 3300009177 Bacteria 525
154 Ga0105249_10000455 3300009553 Bacteria 38320
155 Ga0105249_10460907 3300009553 Bacteria 1311
156 Ga0105246_10207546 3300011119 Bacteria 1527
157 Ga0105246_10950657 3300011119 Bacteria 774
158 Ga0157373_10026417 3300013100 Bacteria 4193
159 Ga0157371_10806918 3300013102 Bacteria 707
160 Ga0157370_10081605 3300013104 Unclassified 3042
161 Ga0157370_10985019 3300013104 Bacteria 764
162 Ga0157369_10137398 3300013105 Unclassified 2587
163 Ga0157369_11024605 3300013105 Bacteria 845
164 Ga0157374_10006638 3300013296 Bacteria 9829
165 Ga0157374_11507999 3300013296 Unclassified 696
166 Ga0157378_10008722 3300013297 Bacteria 8825
167 Ga0157372_10481390 3300013307 Bacteria 1447
168 Ga0157375_10099517 3300013308 Bacteria 2987
169 Ga0157375_11076968 3300013308 Unclassified 940
170 Ga0157380_10036024 3300014326 Bacteria 3826
171 Ga0157379_10494241 3300014968 Bacteria 1133
172 Ga0157379_11645388 3300014968 Bacteria 628
173 Ga0157376_10004112 3300014969 Bacteria 10077
174 Ga0157376_10711660 3300014969 Bacteria 1010
175 Ga0157376_11252177 3300014969 Bacteria 771
176 Ga0157376_11310339 3300014969 Bacteria 754
177 Ga0206356_11631190 3300020070 Bacteria 815
178 Ga0207692_10022641 3300025898 Bacteria 2895
179 Ga0207642_10007562 3300025899 Bacteria 3678
180 Ga0207688_10050242 3300025901 Bacteria 2334
181 Ga0207680_10042147 3300025903 Bacteria 2668
182 Ga0207699_10918784 3300025906 Bacteria 646
183 Ga0207645_11227468 3300025907 Bacteria 503
184 Ga0207705_10127698 3300025909 Bacteria 1890
185 Ga0207684_10318596 3300025910 Bacteria 1340
186 Ga0207684_10334640 3300025910 Bacteria 1304
187 Ga0207654_10030413 3300025911 Bacteria 2964
188 Ga0207707_10130210 3300025912 Bacteria 2201
189 Ga0207707_10152106 3300025912 Bacteria 2023
190 Ga0207707_11465959 3300025912 Bacteria 542
191 Ga0207707_11637314 3300025912 Bacteria 506
192 Ga0207693_10011146 3300025915 Bacteria 7282
193 Ga0207693_10431749 3300025915 Bacteria 1030
194 Ga0207663_10079678 3300025916 Bacteria 2139
195 Ga0207660_10929425 3300025917 Bacteria 710
196 Ga0207657_10006085 3300025919 Bacteria 12551
197 Ga0207657_10218671 3300025919 Bacteria 1527
198 Ga0207657_10506473 3300025919 Unclassified 945
199 Ga0207652_10170972 3300025921 Bacteria 1950
200 Ga0207646_10001907 3300025922 Bacteria 25107
201 Ga0207646_10014733 3300025922 Bacteria 7408
202 Ga0207646_10084634 3300025922 Bacteria 2838
203 Ga0207646_10580328 3300025922 Bacteria 1007
204 Ga0207646_10608897 3300025922 Bacteria 980
205 Ga0207681_10505439 3300025923 Bacteria 990
206 Ga0207659_11373870 3300025926 Unclassified 606
207 Ga0207687_10033383 3300025927 Bacteria 3491
208 Ga0207700_10717150 3300025928 Bacteria 893
209 Ga0207664_10603713 3300025929 Unclassified 986
210 Ga0207664_11561514 3300025929 Unclassified 582
211 Ga0207690_10094128 3300025932 Bacteria 2125
212 Ga0207690_11231930 3300025932 Unclassified 625
213 Ga0207706_10147624 3300025933 Bacteria 2069
214 Ga0207706_10866130 3300025933 Bacteria 764
215 Ga0207686_10034260 3300025934 Bacteria 3038
216 Ga0207670_10060886 3300025936 Bacteria 2573
217 Ga0207669_10160011 3300025937 Bacteria 1589
218 Ga0207704_10000598 3300025938 Bacteria 15955
219 Ga0207665_10601712 3300025939 Bacteria 858
220 Ga0207691_10042773 3300025940 Bacteria 4175
221 Ga0207711_10156865 3300025941 Bacteria 2057
222 Ga0207661_10381938 3300025944 Bacteria 1275
223 Ga0207679_10844173 3300025945 Bacteria 836
224 Ga0207667_10900158 3300025949 Bacteria 877
225 Ga0207667_11439667 3300025949 Bacteria 662
226 Ga0207651_10399905 3300025960 Bacteria 1168
227 Ga0207651_12147044 3300025960 Unclassified 501
228 Ga0207712_10041604 3300025961 Bacteria 3159
229 Ga0207668_10067460 3300025972 Bacteria 2540
230 Ga0207668_10644515 3300025972 Bacteria 927
231 Ga0207640_11016180 3300025981 Bacteria 730
232 Ga0207640_12115788 3300025981 Bacteria 510
233 Ga0207658_10878493 3300025986 Bacteria 816
234 Ga0207677_10054268 3300026023 Bacteria 2734
235 Ga0207703_10537815 3300026035 Bacteria 1101
236 Ga0207639_10066501 3300026041 Bacteria 2802
237 Ga0207639_11842595 3300026041 Unclassified 566
238 Ga0207678_10004642 3300026067 Bacteria 12336
239 Ga0207678_11169061 3300026067 Bacteria 681
240 Ga0207708_10012961 3300026075 Bacteria 6217
241 Ga0207702_10090329 3300026078 Bacteria 2680
242 Ga0207702_10509157 3300026078 Bacteria 1174
243 Ga0207702_11446420 3300026078 Bacteria 681
244 Ga0207648_10000545 3300026089 Bacteria 42051
245 Ga0207676_10251270 3300026095 Bacteria 1592
246 Ga0207675_100026223 3300026118 Bacteria 5426
247 Ga0207683_10001146 3300026121 Bacteria 24099
248 Ga0207683_10765601 3300026121 Bacteria 896
249 Ga0207683_11584185 3300026121 Bacteria 604
250 Ga0207698_10022696 3300026142 Bacteria 4369
251 Ga0207428_10144701 3300027907 Bacteria 1812
252 Ga0207428_10279020 3300027907 Bacteria 1241
253 Ga0268266_10030962 3300028379 Bacteria 4544
254 Ga0268265_10970116 3300028380 Bacteria 838
255 Ga0265338_10395190 3300028800 Bacteria 986
256 Ga0307405_11606761 3300031731 Unclassified 574
257 Ga0307409_100835960 3300031995 Bacteria 931
258 Ga0373938_0225402 3300034957 Bacteria 528
259 Ga0373943_0018612 3300035170 Bacteria 3193
260 Ga0373943_0089062 3300035170 Bacteria 1596
261 Ga0373935_0251099 3300035692 Bacteria 1238
262 Ga0373925_0156990 3300037068 Bacteria 1790
263 Ga0373925_0271179 3300037068 Bacteria 1365
264 Ga0395899_0008922 3300037312 Bacteria 7718
265 Ga0395899_0008953 3300037312 Bacteria 7702
266 Ga0395899_0036773 3300037312 Bacteria 3671
267 Ga0395899_0059299 3300037312 Bacteria 2821
268 Ga0395899_0064984 3300037312 Bacteria 2682
269 Ga0395899_0136787 3300037312 Bacteria 1746
270 Ga0395899_0249652 3300037312 Bacteria 1218
271 Ga0395899_0332605 3300037312 Bacteria 1020
272 Ga0395899_0351896 3300037312 Bacteria 985
273 Ga0395899_0595582 3300037312 Bacteria 705
274 Ga0395900_0008212 3300037418 Bacteria 10746
275 Ga0395900_0010968 3300037418 Bacteria 9267
276 Ga0395900_0012907 3300037418 Bacteria 8533
277 Ga0395900_0019303 3300037418 Bacteria 6952
278 Ga0395900_0020120 3300037418 Bacteria 6808
279 Ga0395900_0021019 3300037418 Bacteria 6670
280 Ga0395900_0046389 3300037418 Bacteria 4474
281 Ga0395900_0099789 3300037418 Bacteria 2982
282 Ga0395900_0211048 3300037418 Bacteria 1960
283 Ga0395900_0280566 3300037418 Bacteria 1658
284 Ga0395900_0301412 3300037418 Bacteria 1589
285 Ga0395900_0464823 3300037418 Unclassified 1219
286 Ga0395900_0473087 3300037418 Bacteria 1206
287 Ga0395900_0542194 3300037418 Bacteria 1109
288 Ga0395900_0608798 3300037418 Bacteria 1032
289 Ga0395900_1137419 3300037418 Bacteria 697
290 Ga0395900_1733816 3300037418 Unclassified 535
291 Ga0395898_0005318 3300037466 Bacteria 13917
292 Ga0395898_0009930 3300037466 Bacteria 9970
293 Ga0395898_0010636 3300037466 Bacteria 9611
294 Ga0395898_0012785 3300037466 Bacteria 8666
295 Ga0395898_0018457 3300037466 Bacteria 7112
296 Ga0395898_0109279 3300037466 Bacteria 2651
297 Ga0395898_0125276 3300037466 Bacteria 2461
298 Ga0395898_0183816 3300037466 Bacteria 1997
299 Ga0395898_0193075 3300037466 Bacteria 1945
300 Ga0395898_0211131 3300037466 Bacteria 1852
301 Ga0395898_0408436 3300037466 Bacteria 1294
302 Ga0395898_0484042 3300037466 Bacteria 1177
303 Ga0395898_0575672 3300037466 Unclassified 1068
304 Ga0395898_0606825 3300037466 Bacteria 1037
305 Ga0395898_0612713 3300037466 Bacteria 1031
306 Ga0395898_0800414 3300037466 Bacteria 883
307 Ga0395898_1641368 3300037466 Bacteria 566
308 Ga0395898_1931151 3300037466 Bacteria 510
309 Ga0395905_0002931 3300037471 Bacteria 18573
310 Ga0395905_0003978 3300037471 Bacteria 15547
311 Ga0395905_0033750 3300037471 Bacteria 4806
312 Ga0395905_0038046 3300037471 Bacteria 4513
313 Ga0395905_0038930 3300037471 Bacteria 4460
314 Ga0395905_0082833 3300037471 Bacteria 3006
315 Ga0395905_0095712 3300037471 Bacteria 2787
316 Ga0395905_0125501 3300037471 Bacteria 2413
317 Ga0395905_0131266 3300037471 Unclassified 2356
318 Ga0395905_0196513 3300037471 Bacteria 1891
319 Ga0395905_0348569 3300037471 Unclassified 1372
320 Ga0395905_0537063 3300037471 Bacteria 1070
321 Ga0395905_1632677 3300037471 Bacteria 549
322 Ga0395901_0003419 3300038443 Bacteria 15998
323 Ga0395901_0006911 3300038443 Bacteria 11466
324 Ga0395901_0008395 3300038443 Bacteria 10439
325 Ga0395901_0009813 3300038443 Bacteria 9707
326 Ga0395901_0015779 3300038443 Bacteria 7697
327 Ga0395901_0030808 3300038443 Bacteria 5527
328 Ga0395901_0037401 3300038443 Bacteria 5020
329 Ga0395901_0056368 3300038443 Bacteria 4087
330 Ga0395901_0211007 3300038443 Bacteria 2032
331 Ga0395901_0270915 3300038443 Bacteria 1766
332 Ga0395901_0272241 3300038443 Bacteria 1761
333 Ga0395901_0321323 3300038443 Unclassified 1601
334 Ga0395901_0400521 3300038443 Bacteria 1410
335 Ga0395901_0409892 3300038443 Bacteria 1391
336 Ga0395901_0473423 3300038443 Unclassified 1278
337 Ga0395901_0558159 3300038443 Bacteria 1160
338 Ga0395901_0642535 3300038443 Bacteria 1065
339 Ga0395901_0792873 3300038443 Bacteria 937
340 Ga0395901_0978528 3300038443 Bacteria 823
341 Ga0395901_1183093 3300038443 Bacteria 731
342 Ga0395901_1405559 3300038443 Bacteria 656
343 Ga0395901_1436608 3300038443 Bacteria 647
344 Ga0395901_1776718 3300038443 Unclassified 566
345 Ga0242420_053886 3300038996 Bacteria 791
346 Ga0451802_0617512 3300041460 Bacteria 641
347 Ga0451807_1510738 3300041486 Bacteria 661
348 Ga0451835_1122178 3300041492 Bacteria 577
349 Ga0451847_0424063 3300041503 Bacteria 627
350 Ga0451849_1323997 3300041505 Bacteria 617
351 Ga0451853_2381125 3300041512 Bacteria 580
352 Ga0451853_2389444 3300041512 Bacteria 1102
353 Ga0450898_094630 3300042134 Archaea 619
354 Ga0450907_058585 3300042146 Bacteria 664
355 Ga0439459_0063685 3300042438 Bacteria 838
356 Ga0450918_068456 3300042531 Bacteria 664
357 Ga0466972_0087090 3300044658 Bacteria 1484
358 Ga0466964_0696801 3300044706 Bacteria 566
359 Ga0453684_0369853 3300044712 Bacteria 1612
360 Ga0466968_0056719 3300044735 Bacteria 1683
361 Ga0466960_0062969 3300044901 Bacteria 1824
362 Ga0466967_0035833 3300045976 Bacteria 4228
363 Ga0466967_0791742 3300045976 Bacteria 941
364 Ga0495603_0005016 3300046455 Bacteria 7918
365 Ga0495629_0350024 3300046459 Unclassified 1008
366 Ga0495641_0082415 3300046461 Bacteria 1440
367 Ga0495641_0094898 3300046461 Bacteria 1332
368 Ga0495580_0926021 3300046472 Bacteria 559
369 Ga0495582_0015194 3300046473 Bacteria 4234
370 Ga0495582_0065008 3300046473 Bacteria 2015
371 Ga0495605_0067470 3300046474 Bacteria 1697
372 Ga0495639_0093319 3300046475 Bacteria 1415
373 Ga0495584_0031824 3300046491 Bacteria 2670
374 Ga0495584_0043136 3300046491 Unclassified 2277
375 Ga0495594_0003934 3300046499 Bacteria 7643
376 Ga0495594_0270768 3300046499 Bacteria 967
377 Ga0495596_0154664 3300046500 Bacteria 891
378 Ga0495630_1246406 3300046517 Bacteria 561
379 Ga0495631_0219618 3300046518 Unclassified 811
380 Ga0495637_0300980 3300046520 Bacteria 569
381 Ga0495644_0031922 3300046523 Bacteria 1991
382 Ga0495663_0079963 3300046525 Unclassified 1052
383 Ga0495666_0049334 3300046526 Bacteria 2025
384 Ga0495642_0212685 3300046528 Bacteria 844
385 Ga0495642_0225609 3300046528 Bacteria 818
386 Ga0495652_0777085 3300046529 Bacteria 639
387 Ga0495640_0651482 3300046533 Unclassified 634
388 Ga0495609_0231396 3300046538 Bacteria 765
389 Ga0495621_0445387 3300046539 Bacteria 554
390 Ga0495622_0300206 3300046557 Bacteria 700
391 Ga0495656_0011634 3300046615 Bacteria 3232
392 Ga0495656_0408572 3300046615 Bacteria 711
393 Ga0495611_0288828 3300046648 Bacteria 757
394 Ga0495659_0229427 3300046664 Bacteria 769
395 Ga0495661_0087666 3300046665 Bacteria 1779
396 Ga0495588_0042687 3300046674 Bacteria 2319
397 Ga0495647_0049693 3300046681 Bacteria 1625
398 Ga0495647_0095370 3300046681 Bacteria 1225
399 Ga0495613_0064108 3300046689 Bacteria 2688
400 Ga0495624_0389974 3300046690 Bacteria 836
401 Ga0495589_0052724 3300046794 Bacteria 2009
402 Ga0495589_0057017 3300046794 Unclassified 1922
403 Ga0495581_0015717 3300047315 Bacteria 4394
404 Ga0495581_0043607 3300047315 Bacteria 2594
405 Ga0495676_0004108 3300047321 Bacteria 13268
406 Ga0495680_0791129 3300047322 Bacteria 620
407 Ga0495677_0114994 3300047445 Bacteria 1024
408 Ga0495615_0025880 3300048090 Bacteria 1366
409 Ga0496100_0057838 3300048903 Bacteria 2542
410 Ga0496100_0260885 3300048903 Bacteria 1285
411 Ga0496101_0490144 3300048904 Bacteria 971
412 Ga0496101_0665713 3300048904 Bacteria 822
413 Ga0496101_0730412 3300048904 Bacteria 782
414 Ga0496101_1185963 3300048904 Unclassified 598
415 Ga0496101_1245577 3300048904 Bacteria 582
416 Ga0496102_0001468 3300048905 Bacteria 20840
417 Ga0496102_0001796 3300048905 Bacteria 18599
418 Ga0496102_0045388 3300048905 Bacteria 3990
419 Ga0496102_0728099 3300048905 Bacteria 915
420 Ga0496102_0804845 3300048905 Bacteria 862
421 Ga0496103_0009701 3300048906 Bacteria 5698
422 Ga0496103_0029601 3300048906 Bacteria 3329
423 Ga0496103_0202723 3300048906 Bacteria 1276
424 Ga0496103_0519150 3300048906 Bacteria 761
425 Ga0496104_0109741 3300048907 Bacteria 2644
426 Ga0496104_0399083 3300048907 Bacteria 1287
427 Ga0496105_0790308 3300048908 Bacteria 722
428 Ga0496106_0005910 3300048909 Bacteria 9045
429 Ga0496106_0274498 3300048909 Bacteria 1350
430 Ga0496106_0383795 3300048909 Bacteria 1129
431 Ga0496107_0001701 3300048910 Bacteria 13784
432 Ga0496107_0004774 3300048910 Bacteria 9206
433 Ga0496107_0183922 3300048910 Bacteria 1552
434 Ga0496107_1284335 3300048910 Unclassified 524
435 Ga0496108_0013368 3300048911 Bacteria 6693
436 Ga0496108_0025745 3300048911 Bacteria 4851
437 Ga0496108_0030781 3300048911 Bacteria 4447
438 Ga0496108_0037266 3300048911 Bacteria 4049
439 Ga0496108_1074216 3300048911 Bacteria 685
440 Ga0496109_0001552 3300048912 Bacteria 19115
441 Ga0496109_0003818 3300048912 Bacteria 12582
442 Ga0496109_0006655 3300048912 Bacteria 9730
443 Ga0496109_1805414 3300048912 Bacteria 544
444 Ga0496110_0052932 3300048913 Bacteria 3567
445 Ga0496110_0122977 3300048913 Bacteria 2339
446 Ga0496110_0328363 3300048913 Bacteria 1393
447 Ga0496110_0329119 3300048913 Bacteria 1392
448 Ga0496110_1308578 3300048913 Bacteria 634
449 Ga0496111_0063132 3300048914 Bacteria 2686
450 Ga0496111_0097393 3300048914 Bacteria 2159
451 Ga0496111_0149698 3300048914 Bacteria 1731
452 Ga0496111_0337257 3300048914 Unclassified 1116
453 Ga0496111_0996373 3300048914 Bacteria 600
454 Ga0496112_0000503 3300048915 Bacteria 26461
455 Ga0496112_0002099 3300048915 Bacteria 15821
456 Ga0496112_0008408 3300048915 Bacteria 9243
457 Ga0496112_0013331 3300048915 Bacteria 7587
458 Ga0496112_0068511 3300048915 Bacteria 3504
459 Ga0496112_0151758 3300048915 Bacteria 2284
460 Ga0496112_0188380 3300048915 Bacteria 2026
461 Ga0496112_0560758 3300048915 Bacteria 1076
462 Ga0496112_0602008 3300048915 Unclassified 1031
463 Ga0496112_0651492 3300048915 Unclassified 983
464 Ga0496112_1392363 3300048915 Bacteria 616
465 Ga0496113_0001382 3300048916 Bacteria 13467
466 Ga0496113_0105201 3300048916 Bacteria 2191
467 Ga0496113_0173479 3300048916 Bacteria 1708
468 Ga0496113_0356836 3300048916 Bacteria 1173
469 Ga0496114_0014998 3300048917 Bacteria 6230
470 Ga0496114_0247903 3300048917 Bacteria 1567
471 Ga0496114_0258821 3300048917 Bacteria 1532
472 Ga0496115_0004912 3300048918 Bacteria 9706
473 Ga0496115_0033999 3300048918 Bacteria 4029
474 Ga0501031_0002697 3300049568 Bacteria 11293
475 Ga0501036_0004068 3300049572 Bacteria 11763
476 Ga0501036_0121050 3300049572 Bacteria 2210
477 Ga0501036_0868273 3300049572 Bacteria 741
478 Ga0501037_0333720 3300049573 Unclassified 1048
479 Ga0501037_0370567 3300049573 Bacteria 985
480 Ga0501038_0029004 3300049574 Bacteria 4909
481 Ga0501039_0000815 3300049575 Bacteria 22501
482 Ga0501039_0039722 3300049575 Bacteria 3634
483 Ga0501040_0001567 3300049576 Bacteria 14546
484 Ga0501040_0002389 3300049576 Bacteria 12067
485 Ga0501040_0476763 3300049576 Bacteria 899
486 Ga0501041_0001477 3300049577 Bacteria 13009
487 Ga0501042_0002962 3300049578 Bacteria 10555
488 Ga0501042_0125312 3300049578 Bacteria 1849
489 Ga0501042_0205383 3300049578 Bacteria 1421
490 Ga0501046_0010865 3300049580 Bacteria 7803
491 Ga0501048_0003390 3300049582 Bacteria 12113
492 Ga0501048_0533617 3300049582 Bacteria 842
493 Ga0501067_0315464 3300049583 Bacteria 871
494 Ga0501068_0000971 3300049584 Bacteria 15052
495 Ga0501069_0387929 3300049585 Bacteria 825
496 Ga0501069_0580960 3300049585 Bacteria 672
497 Ga0501070_0125946 3300049586 Bacteria 2117
498 Ga0501070_0566673 3300049586 Unclassified 908
499 Ga0501071_0000642 3300049587 Bacteria 18195
500 Ga0501071_0000708 3300049587 Bacteria 17510
501 Ga0501072_0001538 3300049588 Bacteria 17245
502 Ga0501072_0014875 3300049588 Bacteria 5964
503 Ga0501073_0399479 3300049589 Bacteria 949
504 Ga0501074_0005087 3300049590 Bacteria 9441
505 Ga0501074_0124135 3300049590 Bacteria 1846
506 Ga0501074_0378809 3300049590 Bacteria 1004
507 Ga0501075_0000576 3300049591 Bacteria 22397
508 Ga0501075_0171732 3300049591 Bacteria 1654
509 Ga0501076_0002053 3300049592 Bacteria 13794
510 Ga0501076_0004574 3300049592 Bacteria 9845
511 Ga0501077_0000130 3300049593 Bacteria 41229
512 Ga0501077_0007104 3300049593 Bacteria 6904
513 Ga0501079_0003128 3300049741 Bacteria 12123
514 Ga0501079_0024142 3300049741 Bacteria 4666
515 Ga0501080_0009186 3300049742 Bacteria 9006
516 Ga0501080_0132820 3300049742 Bacteria 2304
517 Ga0501081_0000891 3300049743 Bacteria 17663
518 Ga0501083_0053575 3300049744 Bacteria 2708
519 Ga0501035_0018119 3300049822 Bacteria 6488
520 Ga0501044_1214163 3300049823 Unclassified 622
521 Ga0501045_0007612 3300049824 Bacteria 7528
522 Ga0501045_0188646 3300049824 Bacteria 1536
523 Ga0501045_0784847 3300049824 Unclassified 702
524 nmdc:mga03n38_594862_c1 3300050490 Bacteria 629
525 nmdc:mga00v17_293277_c1 3300050491 Bacteria 1056
526 nmdc:mga0yw44_18713_c1 3300050492 Bacteria 3801
527 nmdc:mga05p37_114328_c1 3300050507 Unclassified 3318
528 nmdc:mga05p37_128898_c1 3300050507 Bacteria 3105
529 nmdc:mga05p37_829142_c1 3300050507 Bacteria 1007
530 nmdc:mga05p37_8376_c1 3300050507 Bacteria 12226
531 nmdc:mga05p37_927901_c1 3300050507 Unclassified 935
532 nmdc:mga06r32_1228977_c1 3300050510 Bacteria 695
533 nmdc:mga06r32_260352_c1 3300050510 Bacteria 1722
534 nmdc:mga08y16_231547_c1 3300050511 Bacteria 1911
535 nmdc:mga0n895_1499839_c1 3300050512 Bacteria 641
536 nmdc:mga0n895_1649830_c1 3300050512 Bacteria 604
537 nmdc:mga0n895_321142_c1 3300050512 Bacteria 1569
538 nmdc:mga0rr50_534211_c1 3300050513 Bacteria 998
539 nmdc:mga0rr50_810776_c1 3300050513 Bacteria 799
540 nmdc:mga08x19_1277459_c1 3300050514 Bacteria 520
541 nmdc:mga08x19_230417_c1 3300050514 Bacteria 1275
542 nmdc:mga08x19_569164_c1 3300050514 Bacteria 802
543 nmdc:mga08x19_679744_c1 3300050514 Bacteria 730
544 nmdc:mga0a205_346575_c2 3300050515 Bacteria 768
545 nmdc:mga0a205_51796_c1 3300050515 Bacteria 3963
546 Ga0495655_0120135 3300053083 Unclassified 799
547 Ga0501084_0004792 3300054114 Bacteria 11059
548 Ga0501084_0110330 3300054114 Bacteria 2311
549 Ga0590077_097277 3300059426 Bacteria 686
550 Ga0501082_0003027 3300060353 Bacteria 14691
551 Ga0530510_0002483 3300061734 Bacteria 12660
552 Ga0530510_0023234 3300061734 Bacteria 4416
553 Ga0530510_0102416 3300061734 Bacteria 2094
554 Ga0530510_0382854 3300061734 Bacteria 1059
555 Ga0070699_100068142
556 JGI24744J21845_10004720
557 JGI24742J22300_10017928
558 JGI25407J50210_10002414
559 Ga0070658_10035012
560 Ga0070683_100569297
561 Ga0070690_100106165
562 Ga0068869_100560001
563 Ga0070666_10047741
564 Ga0070682_100006677
565 Ga0070682_101861028
566 Ga0068868_100316848
567 Ga0070660_100033936
568 Ga0070660_100441818
569 Ga0070691_10094768
570 Ga0070661_100508155
571 Ga0070692_10255144
572 Ga0070668_100004701
573 Ga0070669_100069451
574 Ga0070675_101679778
575 Ga0070671_100023236
576 Ga0070674_100037241
577 Ga0070674_100743823
578 Ga0070673_100069898
579 Ga0070688_100129472
580 Ga0070688_101123851
581 Ga0070659_100171895
582 Ga0070659_101141605
583 Ga0070659_101885958
584 Ga0070703_10008605
585 Ga0070709_10841993
586 Ga0070713_101663893
587 Ga0070710_10003203
588 Ga0070701_10032588
589 Ga0070711_100044276
590 Ga0070711_100100009
591 Ga0070711_100340546
592 Ga0070700_100027653
593 Ga0070700_100870219
594 Ga0070694_100025256
595 Ga0070708_100207875
596 Ga0070708_100380564
597 Ga0070708_100609768
598 Ga0070708_100634821
599 Ga0070708_101172220
600 Ga0070708_101485220
601 Ga0070708_101489632
602 Ga0070663_100103599
603 Ga0070678_100001730
604 Ga0070678_100263626
605 Ga0070662_100527728
606 Ga0070681_10038492
607 Ga0070681_10211312
608 Ga0070681_10358860
609 Ga0068867_100001632
610 Ga0070685_10003109
611 Ga0070706_100009828
612 Ga0070706_101985779
613 Ga0070707_100018574
614 Ga0070707_100040652
615 Ga0070707_100591578
616 Ga0070698_100001402
617 Ga0070698_100079238
618 Ga0070698_100519831
619 Ga0070698_100531937
620 Ga0070699_100078230
621 Ga0070699_100615406
622 Ga0070699_101309015
623 Ga0070679_100278445
624 Ga0070697_100287351
625 Ga0070697_100838009
626 Ga0070697_100974211
627 Ga0070697_102049612
628 Ga0068853_100012011
629 Ga0068853_102161240
630 Ga0070686_100006620
631 Ga0070686_101288297
632 Ga0070695_100203879
633 Ga0070696_100008994
634 Ga0070693_100274377
635 Ga0070693_100332060
636 Ga0070665_100290271
637 Ga0070704_100004845
638 Ga0070704_100595815
639 Ga0068855_100591344
640 Ga0068855_101587825
641 Ga0068854_101105827
642 Ga0068856_100031153
643 Ga0068856_101042434
644 Ga0068856_101723712
645 Ga0068852_100018773
646 Ga0068859_100508736
647 Ga0068859_102016554
648 Ga0068864_100217051
649 Ga0068866_10000367
650 Ga0068866_10723537
651 Ga0068858_100771745
652 Ga0068862_100752990
653 Ga0081538_10014054
654 Ga0081539_10001497
655 Ga0081539_10009136
656 Ga0081539_10012688
657 Ga0081539_10069477
658 Ga0070717_10036706
659 Ga0075365_10010945
660 Ga0075363_100308931
661 Ga0070715_10334455
662 Ga0070712_100010988
663 Ga0070712_100026378
664 Ga0070712_100513548
665 Ga0070712_101869760
666 Ga0097621_100013753
667 Ga0068871_100006279
668 Ga0075428_100275586
669 Ga0075428_100933270
670 Ga0075431_100119626
671 Ga0075431_100238609
672 Ga0075431_100333658
673 Ga0075433_10085691
674 Ga0075433_11157656
675 Ga0075434_100002180
676 Ga0075434_100104889
677 Ga0075434_100357231
678 Ga0075434_100643033
679 Ga0075434_102133342
680 Ga0075429_100990231
681 Ga0068865_100001537
682 Ga0075436_100002713
683 Ga0075436_100091379
684 Ga0075436_101329984
685 Ga0097620_100508728
686 Ga0097620_102016784
687 Ga0075435_100003253
688 Ga0075435_100377412
689 Ga0099795_10378412
690 Ga0111539_10141967
691 Ga0111539_10291538
692 Ga0105245_10000687
693 Ga0105245_10432889
694 Ga0105247_10110196
695 Ga0114129_10003155
696 Ga0114129_10024795
697 Ga0114129_10109144
698 Ga0114129_10147250
699 Ga0114129_10351926
700 Ga0114129_10707114
701 Ga0114129_10913659
702 Ga0105243_10446591
703 Ga0105243_11973797
704 Ga0105241_10048536
705 Ga0105242_10032092
706 Ga0105248_10007823
707 Ga0105248_13143155
708 Ga0105249_10000455
709 Ga0105249_10460907
710 Ga0105246_10207546
711 Ga0105246_10950657
712 Ga0157373_10026417
713 Ga0157371_10806918
714 Ga0157370_10081605
715 Ga0157370_10985019
716 Ga0157369_10137398
717 Ga0157369_11024605
718 Ga0157374_10006638
719 Ga0157374_11507999
720 Ga0157378_10008722
721 Ga0157372_10481390
722 Ga0157375_10099517
723 Ga0157375_11076968
724 Ga0157380_10036024
725 Ga0157379_10494241
726 Ga0157379_11645388
727 Ga0157376_10004112
728 Ga0157376_10711660
729 Ga0157376_11252177
730 Ga0157376_11310339
731 Ga0206356_11631190
732 Ga0207692_10022641
733 Ga0207642_10007562
734 Ga0207688_10050242
735 Ga0207680_10042147
736 Ga0207699_10918784
737 Ga0207645_11227468
738 Ga0207705_10127698
739 Ga0207684_10318596
740 Ga0207684_10334640
741 Ga0207654_10030413
742 Ga0207707_10130210
743 Ga0207707_10152106
744 Ga0207707_11465959
745 Ga0207707_11637314
746 Ga0207693_10011146
747 Ga0207693_10431749
748 Ga0207663_10079678
749 Ga0207660_10929425
750 Ga0207657_10006085
751 Ga0207657_10218671
752 Ga0207657_10506473
753 Ga0207652_10170972
754 Ga0207646_10001907
755 Ga0207646_10014733
756 Ga0207646_10084634
757 Ga0207646_10580328
758 Ga0207646_10608897
759 Ga0207681_10505439
760 Ga0207659_11373870
761 Ga0207687_10033383
762 Ga0207700_10717150
763 Ga0207664_10603713
764 Ga0207664_11561514
765 Ga0207690_10094128
766 Ga0207690_11231930
767 Ga0207706_10147624
768 Ga0207706_10866130
769 Ga0207686_10034260
770 Ga0207670_10060886
771 Ga0207669_10160011
772 Ga0207704_10000598
773 Ga0207665_10601712
774 Ga0207691_10042773
775 Ga0207711_10156865
776 Ga0207661_10381938
777 Ga0207679_10844173
778 Ga0207667_10900158
779 Ga0207667_11439667
780 Ga0207651_10399905
781 Ga0207651_12147044
782 Ga0207712_10041604
783 Ga0207668_10067460
784 Ga0207668_10644515
785 Ga0207640_11016180
786 Ga0207640_12115788
787 Ga0207658_10878493
788 Ga0207677_10054268
789 Ga0207703_10537815
790 Ga0207639_10066501
791 Ga0207639_11842595
792 Ga0207678_10004642
793 Ga0207678_11169061
794 Ga0207708_10012961
795 Ga0207702_10090329
796 Ga0207702_10509157
797 Ga0207702_11446420
798 Ga0207648_10000545
799 Ga0207676_10251270
800 Ga0207675_100026223
801 Ga0207683_10001146
802 Ga0207683_10765601
803 Ga0207683_11584185
804 Ga0207698_10022696
805 Ga0207428_10144701
806 Ga0207428_10279020
807 Ga0268266_10030962
808 Ga0268265_10970116
809 Ga0265338_10395190
810 Ga0307405_11606761
811 Ga0307409_100835960
812 Ga0373938_0225402
813 Ga0373943_0018612
814 Ga0373943_0089062
815 Ga0373935_0251099
816 Ga0373925_0156990
817 Ga0373925_0271179
818 Ga0395899_0008922
819 Ga0395899_0008953
820 Ga0395899_0036773
821 Ga0395899_0059299
822 Ga0395899_0064984
823 Ga0395899_0136787
824 Ga0395899_0249652
825 Ga0395899_0332605
826 Ga0395899_0351896
827 Ga0395899_0595582
828 Ga0395900_0008212
829 Ga0395900_0010968
830 Ga0395900_0012907
831 Ga0395900_0019303
832 Ga0395900_0020120
833 Ga0395900_0021019
834 Ga0395900_0046389
835 Ga0395900_0099789
836 Ga0395900_0211048
837 Ga0395900_0280566
838 Ga0395900_0301412
839 Ga0395900_0464823
840 Ga0395900_0473087
841 Ga0395900_0542194
842 Ga0395900_0608798
843 Ga0395900_1137419
844 Ga0395900_1733816
845 Ga0395898_0005318
846 Ga0395898_0009930
847 Ga0395898_0010636
848 Ga0395898_0012785
849 Ga0395898_0018457
850 Ga0395898_0109279
851 Ga0395898_0125276
852 Ga0395898_0183816
853 Ga0395898_0193075
854 Ga0395898_0211131
855 Ga0395898_0408436
856 Ga0395898_0484042
857 Ga0395898_0575672
858 Ga0395898_0606825
859 Ga0395898_0612713
860 Ga0395898_0800414
861 Ga0395898_1641368
862 Ga0395898_1931151
863 Ga0395905_0002931
864 Ga0395905_0003978
865 Ga0395905_0033750
866 Ga0395905_0038046
867 Ga0395905_0038930
868 Ga0395905_0082833
869 Ga0395905_0095712
870 Ga0395905_0125501
871 Ga0395905_0131266
872 Ga0395905_0196513
873 Ga0395905_0348569
874 Ga0395905_0537063
875 Ga0395905_1632677
876 Ga0395901_0003419
877 Ga0395901_0006911
878 Ga0395901_0008395
879 Ga0395901_0009813
880 Ga0395901_0015779
881 Ga0395901_0030808
882 Ga0395901_0037401
883 Ga0395901_0056368
884 Ga0395901_0211007
885 Ga0395901_0270915
886 Ga0395901_0272241
887 Ga0395901_0321323
888 Ga0395901_0400521
889 Ga0395901_0409892
890 Ga0395901_0473423
891 Ga0395901_0558159
892 Ga0395901_0642535
893 Ga0395901_0792873
894 Ga0395901_0978528
895 Ga0395901_1183093
896 Ga0395901_1405559
897 Ga0395901_1436608
898 Ga0395901_1776718
899 Ga0242420_053886
900 Ga0451802_0617512
901 Ga0451807_1510738
902 Ga0451835_1122178
903 Ga0451847_0424063
904 Ga0451849_1323997
905 Ga0451853_2381125
906 Ga0451853_2389444
907 Ga0450898_094630
908 Ga0450907_058585
909 Ga0439459_0063685
910 Ga0450918_068456
911 Ga0466972_0087090
912 Ga0466964_0696801
913 Ga0453684_0369853
914 Ga0466968_0056719
915 Ga0466960_0062969
916 Ga0466967_0035833
917 Ga0466967_0791742
918 Ga0495603_0005016
919 Ga0495629_0350024
920 Ga0495641_0082415
921 Ga0495641_0094898
922 Ga0495580_0926021
923 Ga0495582_0015194
924 Ga0495582_0065008
925 Ga0495605_0067470
926 Ga0495639_0093319
927 Ga0495584_0031824
928 Ga0495584_0043136
929 Ga0495594_0003934
930 Ga0495594_0270768
931 Ga0495596_0154664
932 Ga0495630_1246406
933 Ga0495631_0219618
934 Ga0495637_0300980
935 Ga0495644_0031922
936 Ga0495663_0079963
937 Ga0495666_0049334
938 Ga0495642_0212685
939 Ga0495642_0225609
940 Ga0495652_0777085
941 Ga0495640_0651482
942 Ga0495609_0231396
943 Ga0495621_0445387
944 Ga0495622_0300206
945 Ga0495656_0011634
946 Ga0495656_0408572
947 Ga0495611_0288828
948 Ga0495659_0229427
949 Ga0495661_0087666
950 Ga0495588_0042687
951 Ga0495647_0049693
952 Ga0495647_0095370
953 Ga0495613_0064108
954 Ga0495624_0389974
955 Ga0495589_0052724
956 Ga0495589_0057017
957 Ga0495581_0015717
958 Ga0495581_0043607
959 Ga0495676_0004108
960 Ga0495680_0791129
961 Ga0495677_0114994
962 Ga0495615_0025880
963 Ga0496100_0057838
964 Ga0496100_0260885
965 Ga0496101_0490144
966 Ga0496101_0665713
967 Ga0496101_0730412
968 Ga0496101_1185963
969 Ga0496101_1245577
970 Ga0496102_0001468
971 Ga0496102_0001796
972 Ga0496102_0045388
973 Ga0496102_0728099
974 Ga0496102_0804845
975 Ga0496103_0009701
976 Ga0496103_0029601
977 Ga0496103_0202723
978 Ga0496103_0519150
979 Ga0496104_0109741
980 Ga0496104_0399083
981 Ga0496105_0790308
982 Ga0496106_0005910
983 Ga0496106_0274498
984 Ga0496106_0383795
985 Ga0496107_0001701
986 Ga0496107_0004774
987 Ga0496107_0183922
988 Ga0496107_1284335
989 Ga0496108_0013368
990 Ga0496108_0025745
991 Ga0496108_0030781
992 Ga0496108_0037266
993 Ga0496108_1074216
994 Ga0496109_0001552
995 Ga0496109_0003818
996 Ga0496109_0006655
997 Ga0496109_1805414
998 Ga0496110_0052932
999 Ga0496110_0122977
1000 Ga0496110_0328363
1001 Ga0496110_0329119
1002 Ga0496110_1308578
1003 Ga0496111_0063132
1004 Ga0496111_0097393
1005 Ga0496111_0149698
1006 Ga0496111_0337257
1007 Ga0496111_0996373
1008 Ga0496112_0000503
1009 Ga0496112_0002099
1010 Ga0496112_0008408
1011 Ga0496112_0013331
1012 Ga0496112_0068511
1013 Ga0496112_0151758
1014 Ga0496112_0188380
1015 Ga0496112_0560758
1016 Ga0496112_0602008
1017 Ga0496112_0651492
1018 Ga0496112_1392363
1019 Ga0496113_0001382
1020 Ga0496113_0105201
1021 Ga0496113_0173479
1022 Ga0496113_0356836
1023 Ga0496114_0014998
1024 Ga0496114_0247903
1025 Ga0496114_0258821
1026 Ga0496115_0004912
1027 Ga0496115_0033999
1028 Ga0501031_0002697
1029 Ga0501036_0004068
1030 Ga0501036_0121050
1031 Ga0501036_0868273
1032 Ga0501037_0333720
1033 Ga0501037_0370567
1034 Ga0501038_0029004
1035 Ga0501039_0000815
1036 Ga0501039_0039722
1037 Ga0501040_0001567
1038 Ga0501040_0002389
1039 Ga0501040_0476763
1040 Ga0501041_0001477
1041 Ga0501042_0002962
1042 Ga0501042_0125312
1043 Ga0501042_0205383
1044 Ga0501046_0010865
1045 Ga0501048_0003390
1046 Ga0501048_0533617
1047 Ga0501067_0315464
1048 Ga0501068_0000971
1049 Ga0501069_0387929
1050 Ga0501069_0580960
1051 Ga0501070_0125946
1052 Ga0501070_0566673
1053 Ga0501071_0000642
1054 Ga0501071_0000708
1055 Ga0501072_0001538
1056 Ga0501072_0014875
1057 Ga0501073_0399479
1058 Ga0501074_0005087
1059 Ga0501074_0124135
1060 Ga0501074_0378809
1061 Ga0501075_0000576
1062 Ga0501075_0171732
1063 Ga0501076_0002053
1064 Ga0501076_0004574
1065 Ga0501077_0000130
1066 Ga0501077_0007104
1067 Ga0501079_0003128
1068 Ga0501079_0024142
1069 Ga0501080_0009186
1070 Ga0501080_0132820
1071 Ga0501081_0000891
1072 Ga0501083_0053575
1073 Ga0501035_0018119
1074 Ga0501044_1214163
1075 Ga0501045_0007612
1076 Ga0501045_0188646
1077 Ga0501045_0784847
1078 nmdc:mga03n38_594862_c1
1079 nmdc:mga00v17_293277_c1
1080 nmdc:mga0yw44_18713_c1
1081 nmdc:mga05p37_114328_c1
1082 nmdc:mga05p37_128898_c1
1083 nmdc:mga05p37_829142_c1
1084 nmdc:mga05p37_8376_c1
1085 nmdc:mga05p37_927901_c1
1086 nmdc:mga06r32_1228977_c1
1087 nmdc:mga06r32_260352_c1
1088 nmdc:mga08y16_231547_c1
1089 nmdc:mga0n895_1499839_c1
1090 nmdc:mga0n895_1649830_c1
1091 nmdc:mga0n895_321142_c1
1092 nmdc:mga0rr50_534211_c1
1093 nmdc:mga0rr50_810776_c1
1094 nmdc:mga08x19_1277459_c1
1095 nmdc:mga08x19_230417_c1
1096 nmdc:mga08x19_569164_c1
1097 nmdc:mga08x19_679744_c1
1098 nmdc:mga0a205_346575_c2
1099 nmdc:mga0a205_51796_c1
1100 Ga0495655_0120135
1101 Ga0501084_0004792
1102 Ga0501084_0110330
1103 Ga0590077_097277
1104 Ga0501082_0003027
1105 Ga0530510_0002483
1106 Ga0530510_0023234
1107 Ga0530510_0102416
1108 Ga0530510_0382854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10066

DUF2304

Uncharacterized conserved protein (DUF2304)

5

111

0.93

Map