F462953

General Info

Members Datasets Scaffolds Average Seq Length
554 198 554 228

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100406710|Ga0070675_1004067101
Length 256
Sequence MAPGRALRQNDSKGTTGMKTPFLGALALAALAWTAPADAQQASITQTIAGTRLDVTATGEVTRVPDVAIISAGVVSRAPTATAALQDSANRMGQVLAALKRAGVEDRDIQTSNVSLNPEYRYVENQPPQLVGYTASNTVTVRFRDVRNSGKILDALVAQGSNQINGPTLSVDKPESALDEARNKAIAIGRARAELYARSLGLRVVRVVSVNESGGSYPVPPPMPMYARADMAQAKTSIEPGEQKLQVNLAMTFELQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
189 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
190 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 4.15
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10027473 3300001979 Bacteria 1893
2 JGI24739J22299_10009989 3300001989 Bacteria 3528
3 JGI24737J22298_10000256 3300001990 Bacteria 17649
4 JGI24737J22298_10033148 3300001990 Bacteria 1606
5 JGI24737J22298_10037377 3300001990 Bacteria 1497
6 JGI24743J22301_10028966 3300001991 Bacteria 1085
7 JGI24738J21930_10002409 3300002075 Bacteria 4899
8 rootH2_10255869 3300003320 Bacteria 1506
9 Ga0070658_10000117 3300005327 Bacteria 71263
10 Ga0070658_10052786 3300005327 Bacteria 3298
11 Ga0070676_10011013 3300005328 Bacteria 4914
12 Ga0070676_10023528 3300005328 Bacteria 3463
13 Ga0070670_100012210 3300005331 Bacteria 7346
14 Ga0070670_100033493 3300005331 Bacteria 4424
15 Ga0070670_100056804 3300005331 Bacteria 3360
16 Ga0070670_100106430 3300005331 Bacteria 2417
17 Ga0070666_10026669 3300005335 Bacteria 3778
18 Ga0068868_100000162 3300005338 Bacteria 43570
19 Ga0068868_100015735 3300005338 Bacteria 5603
20 Ga0070660_100000530 3300005339 Bacteria 25464
21 Ga0070660_100001623 3300005339 Bacteria 15463
22 Ga0070660_100014349 3300005339 Bacteria 5704
23 Ga0070660_100026115 3300005339 Bacteria 4347
24 Ga0070660_100040861 3300005339 Bacteria 3532
25 Ga0070660_100275997 3300005339 Bacteria 1375
26 Ga0070660_100484157 3300005339 Bacteria 1028
27 Ga0070661_100000079 3300005344 Bacteria 77180
28 Ga0070661_100009904 3300005344 Bacteria 6611
29 Ga0070661_100385882 3300005344 Bacteria 1105
30 Ga0070661_100570173 3300005344 Bacteria 913
31 Ga0070692_10008314 3300005345 Bacteria 4624
32 Ga0070668_100001009 3300005347 Bacteria 19720
33 Ga0070668_100002740 3300005347 Bacteria 12969
34 Ga0070668_100071947 3300005347 Bacteria 2694
35 Ga0070668_100190974 3300005347 Bacteria 1677
36 Ga0070668_100485138 3300005347 Bacteria 1068
37 Ga0070668_100486860 3300005347 Unclassified 1066
38 Ga0070669_100001654 3300005353 Bacteria 16124
39 Ga0070669_100009212 3300005353 Bacteria 7036
40 Ga0070669_100056458 3300005353 Bacteria 2879
41 Ga0070669_100098144 3300005353 Bacteria 2206
42 Ga0070669_100376135 3300005353 Bacteria 1158
43 Ga0070675_100022837 3300005354 Bacteria 4998
44 Ga0070675_100026972 3300005354 Bacteria 4613
45 Ga0070675_100266017 3300005354 Bacteria 1503
46 Ga0070675_100406710 3300005354 Bacteria 1215
47 Ga0070671_100003139 3300005355 Bacteria 12874
48 Ga0070671_100052141 3300005355 Bacteria 3402
49 Ga0070671_100159000 3300005355 Bacteria 1910
50 Ga0070671_100159090 3300005355 Bacteria 1909
51 Ga0070671_100401022 3300005355 Bacteria 1173
52 Ga0070674_100002759 3300005356 Bacteria 9710
53 Ga0070674_100004206 3300005356 Bacteria 8177
54 Ga0070674_100035066 3300005356 Bacteria 3357
55 Ga0070673_100006081 3300005364 Bacteria 7820
56 Ga0070673_100006764 3300005364 Bacteria 7482
57 Ga0070673_100018247 3300005364 Bacteria 5009
58 Ga0070673_100027595 3300005364 Bacteria 4210
59 Ga0070673_100073244 3300005364 Bacteria 2757
60 Ga0070673_100292353 3300005364 Bacteria 1432
61 Ga0070659_100000022 3300005366 Bacteria 154091
62 Ga0070659_100000165 3300005366 Bacteria 51041
63 Ga0070659_100006492 3300005366 Bacteria 8441
64 Ga0070659_100012310 3300005366 Bacteria 6340
65 Ga0070659_100031373 3300005366 Bacteria 4115
66 Ga0070659_100035346 3300005366 Bacteria 3891
67 Ga0070659_100056110 3300005366 Bacteria 3105
68 Ga0070659_100058704 3300005366 Bacteria 3037
69 Ga0070659_100079764 3300005366 Bacteria 2613
70 Ga0070659_100154391 3300005366 Bacteria 1874
71 Ga0070667_100008550 3300005367 Bacteria 8485
72 Ga0070667_100026477 3300005367 Bacteria 4825
73 Ga0070667_100067292 3300005367 Bacteria 3045
74 Ga0070667_100152850 3300005367 Bacteria 2028
75 Ga0070667_100212684 3300005367 Bacteria 1719
76 Ga0070714_100182264 3300005435 Bacteria 1911
77 Ga0070700_100053791 3300005441 Bacteria 2514
78 Ga0070694_100090006 3300005444 Bacteria 2151
79 Ga0070663_100007461 3300005455 Bacteria 6655
80 Ga0070663_100018050 3300005455 Bacteria 4617
81 Ga0070663_100031644 3300005455 Bacteria 3638
82 Ga0070663_100041378 3300005455 Bacteria 3231
83 Ga0070678_100868490 3300005456 Bacteria 823
84 Ga0070662_100000171 3300005457 Bacteria 37981
85 Ga0070662_100000253 3300005457 Bacteria 31619
86 Ga0070662_100006704 3300005457 Bacteria 7440
87 Ga0070662_100013068 3300005457 Bacteria 5518
88 Ga0070662_100028638 3300005457 Bacteria 3878
89 Ga0070681_10600676 3300005458 Bacteria 1015
90 Ga0068867_100010384 3300005459 Bacteria 6570
91 Ga0068867_100014876 3300005459 Bacteria 5515
92 Ga0068867_100027600 3300005459 Bacteria 4082
93 Ga0068867_100141008 3300005459 Bacteria 1884
94 Ga0068867_100427773 3300005459 Bacteria 1123
95 Ga0068853_100001092 3300005539 Bacteria 19210
96 Ga0068853_100045965 3300005539 Bacteria 3742
97 Ga0068853_100130673 3300005539 Bacteria 2248
98 Ga0068853_100415315 3300005539 Bacteria 1261
99 Ga0070672_100031186 3300005543 Bacteria 4010
100 Ga0070672_100173161 3300005543 Bacteria 1796
101 Ga0070672_100260296 3300005543 Bacteria 1463
102 Ga0070693_100000327 3300005547 Bacteria 21813
103 Ga0070693_100405621 3300005547 Bacteria 946
104 Ga0070665_100015947 3300005548 Bacteria 7540
105 Ga0068855_100000447 3300005563 Bacteria 51000
106 Ga0068855_100267377 3300005563 Bacteria 1903
107 Ga0068855_100273311 3300005563 Bacteria 1879
108 Ga0070664_100000311 3300005564 Bacteria 35468
109 Ga0070664_100022241 3300005564 Bacteria 5229
110 Ga0070664_100113607 3300005564 Bacteria 2365
111 Ga0070664_100137627 3300005564 Bacteria 2148
112 Ga0068857_100004848 3300005577 Bacteria 11406
113 Ga0068857_100046399 3300005577 Bacteria 3856
114 Ga0068857_100644456 3300005577 Bacteria 1004
115 Ga0068854_100060863 3300005578 Bacteria 2733
116 Ga0068856_100000979 3300005614 Bacteria 30480
117 Ga0068856_100155548 3300005614 Bacteria 2296
118 Ga0068852_100014704 3300005616 Bacteria 6037
119 Ga0068852_100019975 3300005616 Bacteria 5318
120 Ga0068852_100081041 3300005616 Bacteria 2880
121 Ga0068859_100043189 3300005617 Bacteria 4530
122 Ga0068859_100060304 3300005617 Bacteria 3823
123 Ga0068859_101218123 3300005617 Unclassified 829
124 Ga0068864_100001149 3300005618 Bacteria 22090
125 Ga0068864_100053531 3300005618 Bacteria 3482
126 Ga0068864_100337337 3300005618 Bacteria 1419
127 Ga0068866_10143621 3300005718 Bacteria 1373
128 Ga0068851_10018904 3300005834 Bacteria 3326
129 Ga0068851_10047309 3300005834 Bacteria 2178
130 Ga0068870_10108321 3300005840 Bacteria 1582
131 Ga0068863_100014929 3300005841 Bacteria 7460
132 Ga0068863_100026693 3300005841 Bacteria 5507
133 Ga0068863_100027356 3300005841 Bacteria 5439
134 Ga0068863_100194035 3300005841 Bacteria 1952
135 Ga0068858_100135351 3300005842 Bacteria 2312
136 Ga0068858_100627391 3300005842 Bacteria 1044
137 Ga0068860_100035978 3300005843 Bacteria 4747
138 Ga0068860_100042969 3300005843 Bacteria 4313
139 Ga0068860_100047112 3300005843 Bacteria 4109
140 Ga0068860_100228579 3300005843 Bacteria 1808
141 Ga0068862_100007045 3300005844 Bacteria 9335
142 Ga0068862_100013194 3300005844 Bacteria 6834
143 Ga0068862_100042851 3300005844 Bacteria 3857
144 Ga0068862_100058923 3300005844 Bacteria 3295
145 Ga0068862_100210524 3300005844 Bacteria 1756
146 Ga0068862_100229165 3300005844 Bacteria 1685
147 Ga0068862_100278795 3300005844 Bacteria 1531
148 Ga0075364_10296469 3300006051 Bacteria 1100
149 Ga0070712_100005180 3300006175 Bacteria 8066
150 Ga0068871_100006414 3300006358 Bacteria 8323
151 Ga0068871_100025963 3300006358 Bacteria 4565
152 Ga0075431_100009192 3300006847 Bacteria 9912
153 Ga0068865_100025294 3300006881 Bacteria 3903
154 Ga0068865_100201117 3300006881 Bacteria 1546
155 Ga0075436_100300782 3300006914 Bacteria 1150
156 Ga0097620_100043189 3300006931 Bacteria 4530
157 Ga0097620_100060305 3300006931 Bacteria 3823
158 Ga0097620_101218017 3300006931 Unclassified 829
159 Ga0105240_10384092 3300009093 Bacteria 1585
160 Ga0111539_10069019 3300009094 Bacteria 4174
161 Ga0111539_10145385 3300009094 Bacteria 2776
162 Ga0105243_10166104 3300009148 Bacteria 1907
163 Ga0105248_10000117 3300009177 Bacteria 90169
164 Ga0105248_10000928 3300009177 Bacteria 32626
165 Ga0105248_10006712 3300009177 Bacteria 12623
166 Ga0105248_10125180 3300009177 Bacteria 2899
167 Ga0105248_10837797 3300009177 Bacteria 1038
168 Ga0105238_10015311 3300009551 Bacteria 7768
169 Ga0105238_10309523 3300009551 Bacteria 1564
170 Ga0105238_10539521 3300009551 Bacteria 1170
171 Ga0105249_10032492 3300009553 Bacteria 4722
172 Ga0105249_10038321 3300009553 Bacteria 4349
173 Ga0105239_10017550 3300010375 Bacteria 7916
174 Ga0105246_10035537 3300011119 Bacteria 3331
175 Ga0105246_10088849 3300011119 Bacteria 2222
176 Ga0157373_10082994 3300013100 Bacteria 2259
177 Ga0157371_10004956 3300013102 Bacteria 11437
178 Ga0157369_10086797 3300013105 Bacteria 3341
179 Ga0157369_10452068 3300013105 Bacteria 1330
180 Ga0157374_10029106 3300013296 Bacteria 4997
181 Ga0163162_10087711 3300013306 Bacteria 3190
182 Ga0157372_10654130 3300013307 Bacteria 1224
183 Ga0157375_10101296 3300013308 Bacteria 2963
184 Ga0157375_10167626 3300013308 Bacteria 2342
185 Ga0163163_10000380 3300014325 Bacteria 42243
186 Ga0163163_10014693 3300014325 Bacteria 7200
187 Ga0163163_10030233 3300014325 Bacteria 5216
188 Ga0157380_10002494 3300014326 Bacteria 12406
189 Ga0157380_10029210 3300014326 Bacteria 4213
190 Ga0157380_10057165 3300014326 Bacteria 3105
191 Ga0157376_10007563 3300014969 Bacteria 7768
192 Ga0206354_10716655 3300020081 Bacteria 958
193 Ga0206353_10924924 3300020082 Bacteria 1299
194 Ga0213875_10013162 3300021388 Bacteria 4067
195 Ga0207697_10002570 3300025315 Bacteria 9339
196 Ga0207656_10009797 3300025321 Bacteria 3564
197 Ga0207682_10004776 3300025893 Bacteria 5615
198 Ga0207688_10041625 3300025901 Bacteria 2556
199 Ga0207680_10016496 3300025903 Bacteria 3879
200 Ga0207680_10026175 3300025903 Bacteria 3230
201 Ga0207647_10000181 3300025904 Bacteria 50570
202 Ga0207647_10026057 3300025904 Bacteria 3829
203 Ga0207647_10092346 3300025904 Bacteria 1805
204 Ga0207645_10006348 3300025907 Bacteria 8500
205 Ga0207645_10018567 3300025907 Bacteria 4571
206 Ga0207705_10000222 3300025909 Bacteria 56707
207 Ga0207705_10035082 3300025909 Bacteria 3588
208 Ga0207705_10035559 3300025909 Bacteria 3564
209 Ga0207695_10334209 3300025913 Bacteria 1403
210 Ga0207693_10011907 3300025915 Bacteria 7031
211 Ga0207657_10000378 3300025919 Bacteria 47118
212 Ga0207657_10000790 3300025919 Bacteria 33637
213 Ga0207657_10004380 3300025919 Bacteria 14945
214 Ga0207657_10018581 3300025919 Bacteria 6626
215 Ga0207657_10057392 3300025919 Bacteria 3355
216 Ga0207657_10525522 3300025919 Bacteria 926
217 Ga0207649_10000135 3300025920 Bacteria 63197
218 Ga0207649_10106955 3300025920 Bacteria 1862
219 Ga0207649_10329268 3300025920 Bacteria 1124
220 Ga0207649_10331455 3300025920 Bacteria 1121
221 Ga0207681_10003715 3300025923 Bacteria 9486
222 Ga0207681_10044392 3300025923 Bacteria 2978
223 Ga0207681_10078045 3300025923 Bacteria 2330
224 Ga0207681_10089373 3300025923 Bacteria 2196
225 Ga0207681_10209039 3300025923 Bacteria 1503
226 Ga0207681_10257677 3300025923 Bacteria 1364
227 Ga0207681_10316489 3300025923 Bacteria 1239
228 Ga0207650_10000907 3300025925 Bacteria 22318
229 Ga0207650_10016481 3300025925 Bacteria 5166
230 Ga0207650_10075443 3300025925 Bacteria 2545
231 Ga0207659_10026580 3300025926 Bacteria 3906
232 Ga0207664_10017539 3300025929 Bacteria 5252
233 Ga0207664_10041554 3300025929 Bacteria 3582
234 Ga0207644_10000166 3300025931 Bacteria 47729
235 Ga0207644_10000514 3300025931 Bacteria 25001
236 Ga0207644_10042812 3300025931 Bacteria 3211
237 Ga0207644_10045670 3300025931 Bacteria 3117
238 Ga0207644_10091273 3300025931 Bacteria 2271
239 Ga0207644_10239006 3300025931 Bacteria 1445
240 Ga0207690_10000003 3300025932 Bacteria 783011
241 Ga0207690_10000559 3300025932 Bacteria 24291
242 Ga0207690_10002755 3300025932 Bacteria 10616
243 Ga0207690_10013123 3300025932 Bacteria 4971
244 Ga0207690_10027445 3300025932 Bacteria 3598
245 Ga0207690_10106829 3300025932 Bacteria 2009
246 Ga0207690_10112499 3300025932 Bacteria 1963
247 Ga0207690_10215684 3300025932 Bacteria 1465
248 Ga0207690_10456123 3300025932 Bacteria 1028
249 Ga0207706_10000513 3300025933 Bacteria 41181
250 Ga0207706_10001038 3300025933 Bacteria 28181
251 Ga0207706_10003711 3300025933 Bacteria 14568
252 Ga0207706_10009897 3300025933 Bacteria 8742
253 Ga0207706_10011763 3300025933 Bacteria 7968
254 Ga0207706_10119580 3300025933 Bacteria 2316
255 Ga0207706_10192418 3300025933 Bacteria 1790
256 Ga0207686_10369322 3300025934 Bacteria 1085
257 Ga0207709_10398004 3300025935 Bacteria 1052
258 Ga0207669_10003132 3300025937 Bacteria 7129
259 Ga0207669_10006194 3300025937 Bacteria 5446
260 Ga0207669_10059624 3300025937 Bacteria 2335
261 Ga0207669_10240389 3300025937 Bacteria 1342
262 Ga0207704_10042031 3300025938 Bacteria 2687
263 Ga0207704_10054235 3300025938 Bacteria 2443
264 Ga0207704_10326324 3300025938 Bacteria 1186
265 Ga0207691_10017883 3300025940 Bacteria 6718
266 Ga0207691_10053931 3300025940 Bacteria 3669
267 Ga0207691_10128306 3300025940 Bacteria 2242
268 Ga0207691_10198305 3300025940 Bacteria 1748
269 Ga0207711_10000243 3300025941 Bacteria 58447
270 Ga0207711_10000558 3300025941 Bacteria 37953
271 Ga0207711_10080899 3300025941 Bacteria 2838
272 Ga0207711_10085477 3300025941 Bacteria 2764
273 Ga0207711_10416116 3300025941 Bacteria 1250
274 Ga0207711_10727484 3300025941 Bacteria 925
275 Ga0207689_10114597 3300025942 Bacteria 2216
276 Ga0207679_10001067 3300025945 Bacteria 17441
277 Ga0207679_10169041 3300025945 Bacteria 1798
278 Ga0207667_10001204 3300025949 Bacteria 32354
279 Ga0207667_10007180 3300025949 Bacteria 13438
280 Ga0207667_10033020 3300025949 Bacteria 5569
281 Ga0207651_10005049 3300025960 Bacteria 6731
282 Ga0207651_10054333 3300025960 Bacteria 2744
283 Ga0207651_10144519 3300025960 Bacteria 1842
284 Ga0207712_10003124 3300025961 Bacteria 10557
285 Ga0207712_10030694 3300025961 Bacteria 3615
286 Ga0207668_10000252 3300025972 Bacteria 35699
287 Ga0207668_10014035 3300025972 Bacteria 4952
288 Ga0207668_10072511 3300025972 Bacteria 2464
289 Ga0207668_10073396 3300025972 Bacteria 2452
290 Ga0207640_10048196 3300025981 Bacteria 2753
291 Ga0207640_10090864 3300025981 Bacteria 2114
292 Ga0207640_10114619 3300025981 Unclassified 1918
293 Ga0207658_10042391 3300025986 Bacteria 3301
294 Ga0207658_10043335 3300025986 Bacteria 3271
295 Ga0207658_10058609 3300025986 Bacteria 2866
296 Ga0207658_10128921 3300025986 Bacteria 2029
297 Ga0207658_10163980 3300025986 Bacteria 1824
298 Ga0207677_10000154 3300026023 Bacteria 54637
299 Ga0207703_10189765 3300026035 Bacteria 1819
300 Ga0207703_10495847 3300026035 Bacteria 1146
301 Ga0207639_10000412 3300026041 Bacteria 29612
302 Ga0207639_10097991 3300026041 Bacteria 2362
303 Ga0207639_10236145 3300026041 Bacteria 1587
304 Ga0207639_10239065 3300026041 Bacteria 1578
305 Ga0207639_10444629 3300026041 Bacteria 1176
306 Ga0207678_10001952 3300026067 Bacteria 18797
307 Ga0207678_10017289 3300026067 Bacteria 6331
308 Ga0207678_10087193 3300026067 Bacteria 2667
309 Ga0207678_10218774 3300026067 Bacteria 1630
310 Ga0207678_10816270 3300026067 Bacteria 824
311 Ga0207708_10107898 3300026075 Bacteria 2159
312 Ga0207702_10002993 3300026078 Bacteria 15727
313 Ga0207702_10044398 3300026078 Bacteria 3736
314 Ga0207641_10006216 3300026088 Bacteria 10102
315 Ga0207641_10048397 3300026088 Bacteria 3588
316 Ga0207641_10064413 3300026088 Bacteria 3133
317 Ga0207648_10003551 3300026089 Bacteria 16308
318 Ga0207648_10009982 3300026089 Bacteria 9036
319 Ga0207648_10012736 3300026089 Bacteria 7859
320 Ga0207648_10102788 3300026089 Bacteria 2505
321 Ga0207676_10028386 3300026095 Bacteria 4179
322 Ga0207676_10113963 3300026095 Bacteria 2267
323 Ga0207676_10171129 3300026095 Bacteria 1893
324 Ga0207674_10000082 3300026116 Bacteria 101650
325 Ga0207674_10028418 3300026116 Bacteria 5903
326 Ga0207674_10070455 3300026116 Bacteria 3515
327 Ga0207674_10125739 3300026116 Bacteria 2530
328 Ga0207674_10253174 3300026116 Bacteria 1708
329 Ga0207683_10013498 3300026121 Bacteria 6970
330 Ga0207683_10122851 3300026121 Bacteria 2332
331 Ga0207683_10608435 3300026121 Bacteria 1012
332 Ga0207683_10833346 3300026121 Bacteria 856
333 Ga0207698_10028377 3300026142 Bacteria 3990
334 Ga0207698_10030784 3300026142 Bacteria 3864
335 Ga0209974_10019008 3300027876 Bacteria 2278
336 Ga0209974_10035024 3300027876 Unclassified 1667
337 Ga0268266_10006447 3300028379 Bacteria 10746
338 Ga0268265_10003198 3300028380 Bacteria 11897
339 Ga0268265_10006550 3300028380 Bacteria 7882
340 Ga0268265_10007068 3300028380 Bacteria 7590
341 Ga0268265_10018945 3300028380 Bacteria 4779
342 Ga0268265_10074342 3300028380 Bacteria 2658
343 Ga0268265_10127552 3300028380 Bacteria 2108
344 Ga0268265_10131669 3300028380 Bacteria 2079
345 Ga0268264_10001868 3300028381 Bacteria 19146
346 Ga0268264_10016505 3300028381 Bacteria 6045
347 Ga0268264_10146195 3300028381 Bacteria 2114
348 Ga0268264_10174044 3300028381 Bacteria 1949
349 Ga0316182_1296768 3300030745 Bacteria 1186
350 Ga0307408_100014066 3300031548 Bacteria 5315
351 Ga0307408_100020009 3300031548 Bacteria 4511
352 Ga0307408_100112937 3300031548 Bacteria 2090
353 Ga0307408_100295187 3300031548 Bacteria 1355
354 Ga0307405_10005612 3300031731 Bacteria 6068
355 Ga0307405_10428953 3300031731 Unclassified 1042
356 Ga0307413_10000961 3300031824 Bacteria 10325
357 Ga0307413_10008900 3300031824 Bacteria 4770
358 Ga0307413_10013753 3300031824 Bacteria 4083
359 Ga0307413_10036927 3300031824 Bacteria 2817
360 Ga0307413_10173859 3300031824 Bacteria 1527
361 Ga0307410_10001040 3300031852 Bacteria 12033
362 Ga0307410_10010829 3300031852 Bacteria 5189
363 Ga0307410_10040338 3300031852 Bacteria 3072
364 Ga0307410_10139777 3300031852 Bacteria 1790
365 Ga0307410_10314471 3300031852 Bacteria 1240
366 Ga0307410_10385251 3300031852 Bacteria 1129
367 Ga0307410_10716673 3300031852 Bacteria 844
368 Ga0307406_10011848 3300031901 Bacteria 4955
369 Ga0307406_10022885 3300031901 Bacteria 3712
370 Ga0307406_10121627 3300031901 Bacteria 1816
371 Ga0307406_10158536 3300031901 Bacteria 1624
372 Ga0307406_10279028 3300031901 Bacteria 1273
373 Ga0307407_10000729 3300031903 Bacteria 10732
374 Ga0307407_10027575 3300031903 Bacteria 3025
375 Ga0307407_10094647 3300031903 Bacteria 1839
376 Ga0307407_10207631 3300031903 Bacteria 1316
377 Ga0307412_10008969 3300031911 Bacteria 5728
378 Ga0307412_10049232 3300031911 Bacteria 2775
379 Ga0307412_10073634 3300031911 Bacteria 2337
380 Ga0307412_10154507 3300031911 Bacteria 1697
381 Ga0307412_10230614 3300031911 Bacteria 1425
382 Ga0307412_10815321 3300031911 Bacteria 811
383 Ga0307409_100009982 3300031995 Bacteria 5867
384 Ga0307409_100011022 3300031995 Bacteria 5668
385 Ga0307409_100012781 3300031995 Bacteria 5366
386 Ga0307409_100074952 3300031995 Bacteria 2706
387 Ga0307409_100256496 3300031995 Bacteria 1602
388 Ga0307409_100297297 3300031995 Bacteria 1500
389 Ga0307409_100610903 3300031995 Bacteria 1079
390 Ga0307409_101007069 3300031995 Bacteria 851
391 Ga0307416_100011077 3300032002 Bacteria 5993
392 Ga0307416_100019447 3300032002 Bacteria 4815
393 Ga0307416_100064507 3300032002 Bacteria 3005
394 Ga0307416_100158962 3300032002 Bacteria 2085
395 Ga0307416_100360262 3300032002 Bacteria 1476
396 Ga0307416_100702613 3300032002 Bacteria 1100
397 Ga0307416_101113428 3300032002 Bacteria 894
398 Ga0307414_10001136 3300032004 Bacteria 13614
399 Ga0307414_10007306 3300032004 Bacteria 6206
400 Ga0307414_10041628 3300032004 Bacteria 3114
401 Ga0307414_10044350 3300032004 Bacteria 3036
402 Ga0307414_10280543 3300032004 Bacteria 1400
403 Ga0307414_10796496 3300032004 Bacteria 861
404 Ga0307411_10000914 3300032005 Bacteria 11223
405 Ga0307411_10006086 3300032005 Bacteria 5998
406 Ga0307411_10009911 3300032005 Bacteria 5044
407 Ga0307411_10014900 3300032005 Bacteria 4345
408 Ga0307411_10045427 3300032005 Bacteria 2825
409 Ga0307411_10069460 3300032005 Bacteria 2379
410 Ga0307411_10104871 3300032005 Bacteria 2008
411 Ga0307411_10229980 3300032005 Bacteria 1445
412 Ga0307411_10618728 3300032005 Bacteria 933
413 Ga0307415_100008679 3300032126 Bacteria 5651
414 Ga0307415_100014202 3300032126 Bacteria 4673
415 Ga0307415_100018963 3300032126 Bacteria 4167
416 Ga0307415_100026442 3300032126 Bacteria 3661
417 Ga0307415_100148924 3300032126 Bacteria 1798
418 Ga0307415_100176295 3300032126 Bacteria 1673
419 Ga0307415_100569803 3300032126 Bacteria 1002
420 Ga0373931_0012374 3300035691 Bacteria 4133
421 Ga0395899_0010126 3300037312 Bacteria 7229
422 Ga0395899_0022418 3300037312 Bacteria 4789
423 Ga0395899_0048521 3300037312 Bacteria 3160
424 Ga0395899_0059933 3300037312 Bacteria 2805
425 Ga0395899_0118776 3300037312 Bacteria 1896
426 Ga0395899_0290096 3300037312 Bacteria 1110
427 Ga0395900_0001090 3300037418 Bacteria 34516
428 Ga0395900_0004128 3300037418 Bacteria 15465
429 Ga0395900_0025406 3300037418 Bacteria 6064
430 Ga0395900_0027249 3300037418 Bacteria 5851
431 Ga0395900_0126487 3300037418 Bacteria 2621
432 Ga0395900_0148964 3300037418 Bacteria 2391
433 Ga0395900_0244643 3300037418 Bacteria 1798
434 Ga0395900_0341624 3300037418 Bacteria 1472
435 Ga0395900_0424685 3300037418 Bacteria 1289
436 Ga0395900_0485561 3300037418 Bacteria 1187
437 Ga0395898_0022960 3300037466 Bacteria 6307
438 Ga0395898_0039903 3300037466 Bacteria 4645
439 Ga0395898_0072124 3300037466 Bacteria 3336
440 Ga0395898_0078705 3300037466 Bacteria 3181
441 Ga0395898_0222727 3300037466 Bacteria 1799
442 Ga0395898_0320765 3300037466 Bacteria 1478
443 Ga0395905_0001328 3300037471 Bacteria 30188
444 Ga0395905_0001412 3300037471 Bacteria 29029
445 Ga0395905_0001650 3300037471 Bacteria 26378
446 Ga0395905_0003967 3300037471 Bacteria 15569
447 Ga0395905_0004150 3300037471 Bacteria 15150
448 Ga0395905_0009388 3300037471 Bacteria 9568
449 Ga0395905_0021349 3300037471 Bacteria 6124
450 Ga0395905_0025368 3300037471 Bacteria 5590
451 Ga0395905_0039058 3300037471 Bacteria 4453
452 Ga0395905_0042935 3300037471 Bacteria 4242
453 Ga0395905_0065300 3300037471 Bacteria 3407
454 Ga0395905_0081447 3300037471 Bacteria 3034
455 Ga0395905_0130207 3300037471 Bacteria 2366
456 Ga0395905_0141641 3300037471 Bacteria 2261
457 Ga0395905_0148208 3300037471 Bacteria 2208
458 Ga0395905_0160519 3300037471 Unclassified 2113
459 Ga0395905_0174940 3300037471 Bacteria 2015
460 Ga0395905_0222927 3300037471 Bacteria 1764
461 Ga0395905_0237501 3300037471 Bacteria 1703
462 Ga0395905_0293647 3300037471 Bacteria 1512
463 Ga0395905_0325718 3300037471 Bacteria 1426
464 Ga0395905_0356328 3300037471 Bacteria 1356
465 Ga0395905_0394398 3300037471 Bacteria 1279
466 Ga0395905_0404240 3300037471 Bacteria 1261
467 Ga0395905_0523070 3300037471 Bacteria 1087
468 Ga0436364_0792321 3300037853 Bacteria 31271
469 Ga0395901_0028350 3300038443 Bacteria 5757
470 Ga0395901_0031697 3300038443 Bacteria 5450
471 Ga0395901_0037553 3300038443 Bacteria 5010
472 Ga0395901_0057438 3300038443 Bacteria 4047
473 Ga0395901_0163680 3300038443 Bacteria 2336
474 Ga0395901_0178722 3300038443 Bacteria 2225
475 Ga0395901_0342522 3300038443 Bacteria 1544
476 Ga0395901_0381047 3300038443 Bacteria 1451
477 Ga0395901_0444136 3300038443 Unclassified 1327
478 Ga0395901_0493448 3300038443 Bacteria 1247
479 Ga0436365_0414380 3300039437 Bacteria 12800
480 Ga0439445_0000339 3300042004 Bacteria 9216
481 Ga0439432_009869 3300042006 Bacteria 3321
482 Ga0439449_0010608 3300042007 Bacteria 3480
483 Ga0439452_043194 3300042010 Bacteria 1055
484 Ga0439458_0000025 3300042157 Bacteria 23156
485 Ga0439458_0001657 3300042157 Bacteria 5558
486 Ga0451577_0476009 3300042876 Bacteria 1134
487 Ga0466969_0227059 3300044656 Unclassified 848
488 Ga0466965_0041054 3300044683 Bacteria 2279
489 Ga0466961_0084884 3300044693 Bacteria 2002
490 Ga0466961_0176968 3300044693 Bacteria 1325
491 Ga0466963_0013361 3300044694 Bacteria 5040
492 Ga0453684_0833012 3300044712 Bacteria 993
493 Ga0466971_0041121 3300044719 Bacteria 2076
494 Ga0466957_0002232 3300044842 Bacteria 10386
495 Ga0466957_0123834 3300044842 Bacteria 1650
496 Ga0466958_0034431 3300045836 Bacteria 3021
497 Ga0466958_0239378 3300045836 Bacteria 1159
498 Ga0466958_0404641 3300045836 Unclassified 881
499 Ga0466967_0186730 3300045976 Bacteria 1957
500 Ga0466967_0552401 3300045976 Bacteria 1133
501 Ga0495596_0022459 3300046500 Bacteria 2569
502 Ga0495663_0006439 3300046525 Bacteria 3244
503 Ga0495663_0015883 3300046525 Bacteria 2125
504 Ga0495621_0000121 3300046539 Bacteria 16597
505 Ga0495621_0010523 3300046539 Bacteria 2833
506 Ga0495621_0033975 3300046539 Bacteria 1760
507 Ga0495621_0037482 3300046539 Bacteria 1686
508 Ga0495633_0014199 3300046558 Bacteria 4173
509 Ga0495659_0072825 3300046664 Bacteria 1290
510 Ga0495670_0021115 3300046691 Bacteria 3211
511 Ga0495670_0024112 3300046691 Bacteria 3005
512 Ga0495677_0014366 3300047445 Bacteria 2884
513 Ga0496102_0784094 3300048905 Bacteria 875
514 Ga0496103_0230774 3300048906 Bacteria 1191
515 Ga0496104_0144473 3300048907 Bacteria 2285
516 Ga0496106_0029090 3300048909 Bacteria 4117
517 Ga0496107_0000181 3300048910 Bacteria 32803
518 Ga0496108_0020241 3300048911 Bacteria 5468
519 Ga0496108_0455884 3300048911 Bacteria 1117
520 Ga0496109_0013551 3300048912 Bacteria 7078
521 Ga0496109_0021711 3300048912 Bacteria 5681
522 Ga0496109_0052339 3300048912 Bacteria 3721
523 Ga0496109_0112670 3300048912 Bacteria 2530
524 Ga0496110_0000647 3300048913 Bacteria 23828
525 Ga0496110_0001880 3300048913 Bacteria 15501
526 Ga0496110_0057924 3300048913 Bacteria 3412
527 Ga0496111_0002948 3300048914 Bacteria 10412
528 Ga0496112_0025113 3300048915 Bacteria 5717
529 Ga0496112_0059671 3300048915 Bacteria 3759
530 Ga0496112_0079830 3300048915 Bacteria 3236
531 Ga0496112_0162893 3300048915 Bacteria 2196
532 Ga0496112_0581968 3300048915 Bacteria 1052
533 Ga0496113_0000485 3300048916 Bacteria 19549
534 Ga0496113_0011581 3300048916 Bacteria 5893
535 Ga0496113_0130066 3300048916 Bacteria 1975
536 Ga0501071_0156854 3300049587 Bacteria 1700
537 Ga0501202_003892 3300049652 Bacteria 2582
538 Ga0501209_006101 3300049656 Bacteria 2225
539 Ga0501224_007049 3300049664 Bacteria 1635
540 Ga0501249_009132 3300049679 Bacteria 2061
541 Ga0501253_024278 3300049683 Bacteria 1099
542 Ga0501080_0025769 3300049742 Bacteria 5462
543 Ga0501263_002763 3300049760 Bacteria 1823
544 Ga0501268_006751 3300049765 Bacteria 1694
545 Ga0501273_004637 3300049770 Bacteria 1518
546 Ga0501044_0378050 3300049823 Bacteria 1332
547 nmdc:mga00v17_116410_c1 3300050491 Bacteria 1699
548 nmdc:mga0yw44_326918_c1 3300050492 Bacteria 1030
549 nmdc:mga08y16_220675_c1 3300050511 Bacteria 1963
550 nmdc:mga08y16_48195_c1 3300050511 Bacteria 4458
551 nmdc:mga0n895_186287_c1 3300050512 Bacteria 2106
552 Ga0500658_0000022 3300053134 Bacteria 129341
553 Ga0500616_0000375 3300053153 Bacteria 62773
554 Ga0500587_013204 3300053739 Bacteria 1043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0025769 Ga0501080_0025769_2378_3094 141
2 3300049823 Ga0501044_0378050 Ga0501044_0378050_361_1077 141
3 3300042876 Ga0451577_0476009 Ga0451577_0476009_39_677 157
4 3300048916 Ga0496113_0130066 Ga0496113_0130066_28_666 157
5 3300048911 Ga0496108_0455884 Ga0496108_0455884_467_1102 160
6 3300031824 Ga0307413_10036927 Ga0307413_100369274 161
7 3300031852 Ga0307410_10716673 Ga0307410_107166731 161
8 3300031901 Ga0307406_10279028 Ga0307406_102790281 161
9 3300031903 Ga0307407_10207631 Ga0307407_102076312 161
10 3300031911 Ga0307412_10230614 Ga0307412_102306142 161
11 3300031995 Ga0307409_100074952 Ga0307409_1000749522 161
12 3300032005 Ga0307411_10104871 Ga0307411_101048713 161
13 3300032126 Ga0307415_100014202 Ga0307415_1000142022 161
14 3300042006 Ga0439432_009869 Ga0439432_009869_362_1081 161
15 3300042007 Ga0439449_0010608 Ga0439449_0010608_1725_2444 161
16 3300042010 Ga0439452_043194 Ga0439452_043194_310_1029 161
17 3300049656 Ga0501209_006101 Ga0501209_006101_1013_1732 161
18 3300049683 Ga0501253_024278 Ga0501253_024278_231_950 161
19 3300049760 Ga0501263_002763 Ga0501263_002763_635_1354 161
20 3300049765 Ga0501268_006751 Ga0501268_006751_82_801 161
21 3300049770 Ga0501273_004637 Ga0501273_004637_439_1158 161
22 3300027876 Ga0209974_10035024 Ga0209974_100350243 165
23 3300009094 Ga0111539_10069019 Ga0111539_100690196 169
24 3300037312 Ga0395899_0118776 Ga0395899_0118776_194_913 169
25 3300037418 Ga0395900_0244643 Ga0395900_0244643_357_1076 169
26 3300037466 Ga0395898_0039903 Ga0395898_0039903_1934_2653 169
27 3300037471 Ga0395905_0025368 Ga0395905_0025368_4271_4990 169
28 3300038443 Ga0395901_0444136 Ga0395901_0444136_478_1197 169
29 3300050511 nmdc:mga08y16_220675_c1 nmdc:mga08y16_220675_c1_1276_1941 169
30 3300005327 Ga0070658_10052786 Ga0070658_100527863 170
31 3300005355 Ga0070671_100052141 Ga0070671_1000521414 170
32 3300005366 Ga0070659_100079764 Ga0070659_1000797642 170
33 3300005367 Ga0070667_100067292 Ga0070667_1000672923 170
34 3300005455 Ga0070663_100018050 Ga0070663_1000180502 170
35 3300005616 Ga0068852_100019975 Ga0068852_1000199754 170
36 3300005618 Ga0068864_100053531 Ga0068864_1000535311 170
37 3300005841 Ga0068863_100194035 Ga0068863_1001940352 170
38 3300009177 Ga0105248_10000928 Ga0105248_1000092837 170
39 3300009551 Ga0105238_10309523 Ga0105238_103095232 170
40 3300025920 Ga0207649_10106955 Ga0207649_101069553 170
41 3300025931 Ga0207644_10000514 Ga0207644_1000051427 170
42 3300025941 Ga0207711_10000243 Ga0207711_1000024317 170
43 3300025986 Ga0207658_10043335 Ga0207658_100433352 170
44 3300026088 Ga0207641_10064413 Ga0207641_100644133 170
45 3300026095 Ga0207676_10113963 Ga0207676_101139633 170
46 3300048909 Ga0496106_0029090 Ga0496106_0029090_284_1000 170
47 3300048910 Ga0496107_0000181 Ga0496107_0000181_30994_31710 170
48 3300048912 Ga0496109_0013551 Ga0496109_0013551_1866_2582 170
49 3300048913 Ga0496110_0000647 Ga0496110_0000647_20199_20915 170
50 3300048914 Ga0496111_0002948 Ga0496111_0002948_3480_4196 170
51 3300048915 Ga0496112_0025113 Ga0496112_0025113_3650_4366 170
52 3300005339 Ga0070660_100026115 Ga0070660_1000261152 171
53 3300005344 Ga0070661_100009904 Ga0070661_1000099042 171
54 3300005366 Ga0070659_100012310 Ga0070659_1000123109 171
55 3300005539 Ga0068853_100130673 Ga0068853_1001306733 171
56 3300005564 Ga0070664_100137627 Ga0070664_1001376273 171
57 3300005834 Ga0068851_10047309 Ga0068851_100473093 171
58 3300021388 Ga0213875_10013162 Ga0213875_100131623 171
59 3300025909 Ga0207705_10035082 Ga0207705_100350825 171
60 3300025919 Ga0207657_10004380 Ga0207657_100043804 171
61 3300025932 Ga0207690_10112499 Ga0207690_101124991 171
62 3300025945 Ga0207679_10169041 Ga0207679_101690412 171
63 3300026041 Ga0207639_10097991 Ga0207639_100979913 171
64 3300026067 Ga0207678_10001952 Ga0207678_100019523 171
65 3300026142 Ga0207698_10028377 Ga0207698_100283776 171
66 3300005344 Ga0070661_100570173 Ga0070661_1005701731 172
67 3300026078 Ga0207702_10044398 Ga0207702_100443986 172
68 3300005366 Ga0070659_100058704 Ga0070659_1000587045 173
69 3300005577 Ga0068857_100644456 Ga0068857_1006444561 173
70 3300014326 Ga0157380_10057165 Ga0157380_100571655 173
71 3300025932 Ga0207690_10456123 Ga0207690_104561232 173
72 3300026116 Ga0207674_10070455 Ga0207674_100704553 173
73 3300044656 Ga0466969_0227059 Ga0466969_0227059_20_742 174
74 3300044693 Ga0466961_0176968 Ga0466961_0176968_32_754 174
75 3300044694 Ga0466963_0013361 Ga0466963_0013361_3482_4204 174
76 3300044719 Ga0466971_0041121 Ga0466971_0041121_55_777 174
77 3300044842 Ga0466957_0002232 Ga0466957_0002232_6266_6988 174
78 3300046539 Ga0495621_0037482 Ga0495621_0037482_671_1402 174
79 3300005331 Ga0070670_100056804 Ga0070670_1000568043 176
80 3300005577 Ga0068857_100004848 Ga0068857_1000048482 176
81 3300013308 Ga0157375_10101296 Ga0157375_101012963 176
82 3300014325 Ga0163163_10014693 Ga0163163_100146935 176
83 3300025923 Ga0207681_10209039 Ga0207681_102090392 176
84 3300025925 Ga0207650_10016481 Ga0207650_100164817 176
85 3300026116 Ga0207674_10000082 Ga0207674_1000008290 176
86 3300031852 Ga0307410_10385251 Ga0307410_103852512 176
87 3300053739 Ga0500587_013204 Ga0500587_013204_157_885 176
88 3300005338 Ga0068868_100000162 Ga0068868_10000016244 177
89 3300005339 Ga0070660_100001623 Ga0070660_1000016237 177
90 3300005366 Ga0070659_100000022 Ga0070659_10000002243 177
91 3300025919 Ga0207657_10000790 Ga0207657_1000079038 177
92 3300025932 Ga0207690_10000003 Ga0207690_10000003688 177
93 3300025933 Ga0207706_10192418 Ga0207706_101924182 177
94 3300026023 Ga0207677_10000154 Ga0207677_1000015445 177
95 3300031824 Ga0307413_10008900 Ga0307413_100089004 177
96 3300031901 Ga0307406_10011848 Ga0307406_100118485 177
97 3300031911 Ga0307412_10049232 Ga0307412_100492324 177
98 3300032004 Ga0307414_10044350 Ga0307414_100443503 177
99 3300032126 Ga0307415_100148924 Ga0307415_1001489241 177
100 3300044683 Ga0466965_0041054 Ga0466965_0041054_1020_1739 177
101 3300005328 Ga0070676_10023528 Ga0070676_100235282 178
102 3300005347 Ga0070668_100001009 Ga0070668_10000100920 178
103 3300005347 Ga0070668_100486860 Ga0070668_1004868602 178
104 3300005353 Ga0070669_100009212 Ga0070669_1000092124 178
105 3300005356 Ga0070674_100002759 Ga0070674_1000027598 178
106 3300005364 Ga0070673_100027595 Ga0070673_1000275952 178
107 3300005367 Ga0070667_100152850 Ga0070667_1001528503 178
108 3300005459 Ga0068867_100014876 Ga0068867_1000148766 178
109 3300005543 Ga0070672_100031186 Ga0070672_1000311863 178
110 3300005617 Ga0068859_100043189 Ga0068859_1000431892 178
111 3300005843 Ga0068860_100035978 Ga0068860_1000359786 178
112 3300006881 Ga0068865_100201117 Ga0068865_1002011173 178
113 3300006931 Ga0097620_100043189 Ga0097620_1000431892 178
114 3300025907 Ga0207645_10006348 Ga0207645_100063489 178
115 3300025923 Ga0207681_10044392 Ga0207681_100443922 178
116 3300025923 Ga0207681_10257677 Ga0207681_102576772 178
117 3300025934 Ga0207686_10369322 Ga0207686_103693222 178
118 3300025937 Ga0207669_10006194 Ga0207669_100061943 178
119 3300025938 Ga0207704_10042031 Ga0207704_100420312 178
120 3300025940 Ga0207691_10128306 Ga0207691_101283061 178
121 3300025941 Ga0207711_10416116 Ga0207711_104161162 178
122 3300025942 Ga0207689_10114597 Ga0207689_101145974 178
123 3300025960 Ga0207651_10005049 Ga0207651_100050494 178
124 3300025972 Ga0207668_10000252 Ga0207668_1000025231 178
125 3300025986 Ga0207658_10042391 Ga0207658_100423914 178
126 3300026041 Ga0207639_10239065 Ga0207639_102390652 178
127 3300026089 Ga0207648_10012736 Ga0207648_100127369 178
128 3300026121 Ga0207683_10013498 Ga0207683_100134984 178
129 3300028380 Ga0268265_10006550 Ga0268265_100065503 178
130 3300028381 Ga0268264_10016505 Ga0268264_100165056 178
131 3300001990 JGI24737J22298_10037377 JGI24737J22298_100373773 179
132 3300005356 Ga0070674_100035066 Ga0070674_1000350664 179
133 3300005366 Ga0070659_100035346 Ga0070659_1000353463 179
134 3300025932 Ga0207690_10027445 Ga0207690_100274455 179
135 3300025937 Ga0207669_10059624 Ga0207669_100596243 179
136 3300037471 Ga0395905_0404240 Ga0395905_0404240_326_1048 179
137 3300053153 Ga0500616_0000375 Ga0500616_0000375_24664_25392 179
138 3300005331 Ga0070670_100033493 Ga0070670_1000334934 180
139 3300031903 Ga0307407_10027575 Ga0307407_100275752 180
140 3300037471 Ga0395905_0065300 Ga0395905_0065300_2080_2772 180
141 3300039437 Ga0436365_0414380 Ga0436365_0414380_6578_7330 180
142 3300005455 Ga0070663_100041378 Ga0070663_1000413785 181
143 3300005618 Ga0068864_100337337 Ga0068864_1003373372 181
144 3300025981 Ga0207640_10114619 Ga0207640_101146192 181
145 3300026067 Ga0207678_10017289 Ga0207678_100172894 181
146 3300048912 Ga0496109_0052339 Ga0496109_0052339_1837_2532 181
147 3300001990 JGI24737J22298_10000256 JGI24737J22298_100002564 182
148 3300005339 Ga0070660_100040861 Ga0070660_1000408616 182
149 3300005841 Ga0068863_100014929 Ga0068863_1000149293 182
150 3300011119 Ga0105246_10035537 Ga0105246_100355373 182
151 3300025904 Ga0207647_10026057 Ga0207647_100260574 182
152 3300025919 Ga0207657_10525522 Ga0207657_105255221 182
153 3300026088 Ga0207641_10048397 Ga0207641_100483977 182
154 3300005354 Ga0070675_100266017 Ga0070675_1002660172 183
155 3300005458 Ga0070681_10600676 Ga0070681_106006761 183
156 3300005459 Ga0068867_100427773 Ga0068867_1004277731 183
157 3300005564 Ga0070664_100113607 Ga0070664_1001136073 183
158 3300005617 Ga0068859_101218123 Ga0068859_1012181231 183
159 3300005840 Ga0068870_10108321 Ga0068870_101083211 183
160 3300006931 Ga0097620_101218017 Ga0097620_1012180171 183
161 3300025933 Ga0207706_10119580 Ga0207706_101195802 183
162 3300025972 Ga0207668_10072511 Ga0207668_100725112 183
163 3300026095 Ga0207676_10171129 Ga0207676_101711293 183
164 3300026116 Ga0207674_10028418 Ga0207674_100284185 183
165 3300031901 Ga0307406_10121627 Ga0307406_101216274 183
166 3300031911 Ga0307412_10815321 Ga0307412_108153211 183
167 3300031995 Ga0307409_100297297 Ga0307409_1002972973 183
168 3300032002 Ga0307416_100702613 Ga0307416_1007026132 183
169 3300032004 Ga0307414_10280543 Ga0307414_102805432 183
170 3300044712 Ga0453684_0833012 Ga0453684_0833012_199_921 183
171 3300048906 Ga0496103_0230774 Ga0496103_0230774_319_1041 183
172 3300005331 Ga0070670_100012210 Ga0070670_1000122108 184
173 3300005618 Ga0068864_100001149 Ga0068864_1000011493 184
174 3300005841 Ga0068863_100026693 Ga0068863_1000266934 184
175 3300009177 Ga0105248_10006712 Ga0105248_100067123 184
176 3300025931 Ga0207644_10000166 Ga0207644_1000016619 184
177 3300025941 Ga0207711_10080899 Ga0207711_100808993 184
178 3300026095 Ga0207676_10028386 Ga0207676_100283864 184
179 3300031995 Ga0307409_100610903 Ga0307409_1006109031 184
180 3300042004 Ga0439445_0000339 Ga0439445_0000339_283_1002 184
181 3300048911 Ga0496108_0020241 Ga0496108_0020241_1341_2060 184
182 3300048912 Ga0496109_0021711 Ga0496109_0021711_1494_2213 184
183 3300048913 Ga0496110_0057924 Ga0496110_0057924_1062_1781 184
184 3300037466 Ga0395898_0072124 Ga0395898_0072124_2249_2962 185
185 3300037471 Ga0395905_0130207 Ga0395905_0130207_51_764 185
186 3300005435 Ga0070714_100182264 Ga0070714_1001822642 186
187 3300005564 Ga0070664_100022241 Ga0070664_1000222414 186
188 3300013307 Ga0157372_10654130 Ga0157372_106541302 186
189 3300025929 Ga0207664_10017539 Ga0207664_100175392 186
190 3300025949 Ga0207667_10033020 Ga0207667_100330204 186
191 3300025981 Ga0207640_10090864 Ga0207640_100908642 186
192 3300031852 Ga0307410_10139777 Ga0307410_101397771 186
193 3300032005 Ga0307411_10014900 Ga0307411_100149003 186
194 3300037418 Ga0395900_0148964 Ga0395900_0148964_223_930 186
195 3300037471 Ga0395905_0141641 Ga0395905_0141641_360_1067 186
196 3300037471 Ga0395905_0160519 Ga0395905_0160519_1387_2103 186
197 3300037853 Ga0436364_0792321 Ga0436364_0792321_11380_12096 186
198 3300038443 Ga0395901_0178722 Ga0395901_0178722_360_1067 186
199 3300038443 Ga0395901_0381047 Ga0395901_0381047_316_1023 186
200 3300044842 Ga0466957_0123834 Ga0466957_0123834_292_1011 186
201 3300045976 Ga0466967_0552401 Ga0466967_0552401_401_1120 186
202 3300003320 rootH2_10255869 rootH2_102558692 187
203 3300005338 Ga0068868_100015735 Ga0068868_1000157357 187
204 3300005339 Ga0070660_100275997 Ga0070660_1002759972 187
205 3300005366 Ga0070659_100056110 Ga0070659_1000561103 187
206 3300005459 Ga0068867_100027600 Ga0068867_1000276002 187
207 3300006358 Ga0068871_100006414 Ga0068871_1000064148 187
208 3300006847 Ga0075431_100009192 Ga0075431_1000091924 187
209 3300013105 Ga0157369_10086797 Ga0157369_100867971 187
210 3300013296 Ga0157374_10029106 Ga0157374_100291064 187
211 3300020081 Ga0206354_10716655 Ga0206354_107166551 187
212 3300020082 Ga0206353_10924924 Ga0206353_109249242 187
213 3300025909 Ga0207705_10035559 Ga0207705_100355593 187
214 3300025919 Ga0207657_10057392 Ga0207657_100573924 187
215 3300025929 Ga0207664_10041554 Ga0207664_100415545 187
216 3300025932 Ga0207690_10106829 Ga0207690_101068293 187
217 3300026067 Ga0207678_10087193 Ga0207678_100871935 187
218 3300026089 Ga0207648_10003551 Ga0207648_1000355118 187
219 3300037418 Ga0395900_0126487 Ga0395900_0126487_18_743 187
220 3300045836 Ga0466958_0034431 Ga0466958_0034431_404_1117 187
221 3300045976 Ga0466967_0186730 Ga0466967_0186730_1074_1787 187
222 3300005339 Ga0070660_100484157 Ga0070660_1004841572 188
223 3300005347 Ga0070668_100071947 Ga0070668_1000719472 188
224 3300005355 Ga0070671_100159090 Ga0070671_1001590903 188
225 3300005355 Ga0070671_100401022 Ga0070671_1004010222 188
226 3300005366 Ga0070659_100154391 Ga0070659_1001543913 188
227 3300005367 Ga0070667_100212684 Ga0070667_1002126842 188
228 3300005456 Ga0070678_100868490 Ga0070678_1008684901 188
229 3300005457 Ga0070662_100013068 Ga0070662_1000130684 188
230 3300005459 Ga0068867_100141008 Ga0068867_1001410083 188
231 3300005547 Ga0070693_100405621 Ga0070693_1004056211 188
232 3300005616 Ga0068852_100081041 Ga0068852_1000810415 188
233 3300005718 Ga0068866_10143621 Ga0068866_101436212 188
234 3300005844 Ga0068862_100013194 Ga0068862_1000131941 188
235 3300006881 Ga0068865_100025294 Ga0068865_1000252943 188
236 3300009177 Ga0105248_10125180 Ga0105248_101251805 188
237 3300013100 Ga0157373_10082994 Ga0157373_100829942 188
238 3300014326 Ga0157380_10002494 Ga0157380_100024949 188
239 3300025923 Ga0207681_10089373 Ga0207681_100893733 188
240 3300025931 Ga0207644_10042812 Ga0207644_100428125 188
241 3300025932 Ga0207690_10215684 Ga0207690_102156841 188
242 3300025933 Ga0207706_10011763 Ga0207706_100117635 188
243 3300025937 Ga0207669_10240389 Ga0207669_102403892 188
244 3300025938 Ga0207704_10054235 Ga0207704_100542353 188
245 3300025940 Ga0207691_10053931 Ga0207691_100539312 188
246 3300025941 Ga0207711_10085477 Ga0207711_100854773 188
247 3300025960 Ga0207651_10054333 Ga0207651_100543335 188
248 3300025972 Ga0207668_10073396 Ga0207668_100733962 188
249 3300025986 Ga0207658_10163980 Ga0207658_101639802 188
250 3300026067 Ga0207678_10816270 Ga0207678_108162701 188
251 3300026089 Ga0207648_10102788 Ga0207648_101027883 188
252 3300026121 Ga0207683_10833346 Ga0207683_108333461 188
253 3300028380 Ga0268265_10074342 Ga0268265_100743423 188
254 3300031548 Ga0307408_100295187 Ga0307408_1002951872 188
255 3300031911 Ga0307412_10154507 Ga0307412_101545073 188
256 3300031995 Ga0307409_101007069 Ga0307409_1010070691 188
257 3300032002 Ga0307416_100360262 Ga0307416_1003602622 188
258 3300032002 Ga0307416_101113428 Ga0307416_1011134281 188
259 3300037418 Ga0395900_0424685 Ga0395900_0424685_223_936 188
260 3300037466 Ga0395898_0222727 Ga0395898_0222727_781_1503 188
261 3300037471 Ga0395905_0001650 Ga0395905_0001650_6713_7432 188
262 3300037471 Ga0395905_0174940 Ga0395905_0174940_151_864 188
263 3300037471 Ga0395905_0222927 Ga0395905_0222927_1002_1724 188
264 3300037471 Ga0395905_0237501 Ga0395905_0237501_804_1526 188
265 3300037471 Ga0395905_0394398 Ga0395905_0394398_278_997 188
266 3300038443 Ga0395901_0163680 Ga0395901_0163680_403_1122 188
267 3300046525 Ga0495663_0006439 Ga0495663_0006439_285_1013 188
268 3300046539 Ga0495621_0010523 Ga0495621_0010523_1113_1832 188
269 3300047445 Ga0495677_0014366 Ga0495677_0014366_257_985 188
270 3300048912 Ga0496109_0112670 Ga0496109_0112670_1331_2053 188
271 3300049587 Ga0501071_0156854 Ga0501071_0156854_142_861 188
272 3300005328 Ga0070676_10011013 Ga0070676_100110135 189
273 3300005339 Ga0070660_100014349 Ga0070660_1000143497 189
274 3300005345 Ga0070692_10008314 Ga0070692_100083143 189
275 3300005347 Ga0070668_100002740 Ga0070668_1000027403 189
276 3300005347 Ga0070668_100190974 Ga0070668_1001909743 189
277 3300005347 Ga0070668_100485138 Ga0070668_1004851381 189
278 3300005353 Ga0070669_100001654 Ga0070669_1000016543 189
279 3300005353 Ga0070669_100056458 Ga0070669_1000564584 189
280 3300005353 Ga0070669_100098144 Ga0070669_1000981443 189
281 3300005353 Ga0070669_100376135 Ga0070669_1003761352 189
282 3300005354 Ga0070675_100022837 Ga0070675_1000228376 189
283 3300005355 Ga0070671_100003139 Ga0070671_1000031397 189
284 3300005356 Ga0070674_100004206 Ga0070674_1000042066 189
285 3300005364 Ga0070673_100006081 Ga0070673_1000060814 189
286 3300005366 Ga0070659_100006492 Ga0070659_10000649210 189
287 3300005366 Ga0070659_100031373 Ga0070659_1000313735 189
288 3300005367 Ga0070667_100008550 Ga0070667_1000085504 189
289 3300005441 Ga0070700_100053791 Ga0070700_1000537913 189
290 3300005444 Ga0070694_100090006 Ga0070694_1000900065 189
291 3300005455 Ga0070663_100031644 Ga0070663_1000316443 189
292 3300005457 Ga0070662_100000253 Ga0070662_1000002534 189
293 3300005457 Ga0070662_100006704 Ga0070662_1000067045 189
294 3300005457 Ga0070662_100028638 Ga0070662_1000286385 189
295 3300005459 Ga0068867_100010384 Ga0068867_1000103847 189
296 3300005539 Ga0068853_100045965 Ga0068853_1000459653 189
297 3300005539 Ga0068853_100415315 Ga0068853_1004153152 189
298 3300005543 Ga0070672_100173161 Ga0070672_1001731613 189
299 3300005543 Ga0070672_100260296 Ga0070672_1002602962 189
300 3300005563 Ga0068855_100267377 Ga0068855_1002673771 189
301 3300005563 Ga0068855_100273311 Ga0068855_1002733113 189
302 3300005577 Ga0068857_100046399 Ga0068857_1000463994 189
303 3300005614 Ga0068856_100155548 Ga0068856_1001555483 189
304 3300005617 Ga0068859_100060304 Ga0068859_1000603045 189
305 3300005841 Ga0068863_100027356 Ga0068863_1000273565 189
306 3300005842 Ga0068858_100627391 Ga0068858_1006273912 189
307 3300005843 Ga0068860_100042969 Ga0068860_1000429695 189
308 3300005843 Ga0068860_100047112 Ga0068860_1000471126 189
309 3300005843 Ga0068860_100228579 Ga0068860_1002285791 189
310 3300005844 Ga0068862_100007045 Ga0068862_1000070454 189
311 3300005844 Ga0068862_100042851 Ga0068862_1000428514 189
312 3300005844 Ga0068862_100058923 Ga0068862_1000589232 189
313 3300005844 Ga0068862_100210524 Ga0068862_1002105242 189
314 3300005844 Ga0068862_100278795 Ga0068862_1002787953 189
315 3300006931 Ga0097620_100060305 Ga0097620_1000603053 189
316 3300009093 Ga0105240_10384092 Ga0105240_103840923 189
317 3300009094 Ga0111539_10145385 Ga0111539_101453853 189
318 3300009148 Ga0105243_10166104 Ga0105243_101661042 189
319 3300009177 Ga0105248_10837797 Ga0105248_108377972 189
320 3300009553 Ga0105249_10032492 Ga0105249_100324926 189
321 3300009553 Ga0105249_10038321 Ga0105249_100383213 189
322 3300010375 Ga0105239_10017550 Ga0105239_100175503 189
323 3300011119 Ga0105246_10088849 Ga0105246_100888493 189
324 3300013306 Ga0163162_10087711 Ga0163162_100877115 189
325 3300013308 Ga0157375_10167626 Ga0157375_101676265 189
326 3300014326 Ga0157380_10029210 Ga0157380_100292102 189
327 3300025315 Ga0207697_10002570 Ga0207697_100025703 189
328 3300025893 Ga0207682_10004776 Ga0207682_100047762 189
329 3300025901 Ga0207688_10041625 Ga0207688_100416253 189
330 3300025904 Ga0207647_10000181 Ga0207647_1000018113 189
331 3300025907 Ga0207645_10018567 Ga0207645_100185674 189
332 3300025913 Ga0207695_10334209 Ga0207695_103342091 189
333 3300025919 Ga0207657_10018581 Ga0207657_100185814 189
334 3300025920 Ga0207649_10329268 Ga0207649_103292682 189
335 3300025923 Ga0207681_10003715 Ga0207681_100037156 189
336 3300025923 Ga0207681_10078045 Ga0207681_100780453 189
337 3300025923 Ga0207681_10316489 Ga0207681_103164891 189
338 3300025925 Ga0207650_10000907 Ga0207650_1000090721 189
339 3300025926 Ga0207659_10026580 Ga0207659_100265806 189
340 3300025931 Ga0207644_10091273 Ga0207644_100912732 189
341 3300025931 Ga0207644_10239006 Ga0207644_102390063 189
342 3300025932 Ga0207690_10002755 Ga0207690_1000275514 189
343 3300025932 Ga0207690_10013123 Ga0207690_100131232 189
344 3300025933 Ga0207706_10001038 Ga0207706_100010382 189
345 3300025933 Ga0207706_10003711 Ga0207706_1000371113 189
346 3300025933 Ga0207706_10009897 Ga0207706_100098975 189
347 3300025935 Ga0207709_10398004 Ga0207709_103980042 189
348 3300025937 Ga0207669_10003132 Ga0207669_100031327 189
349 3300025938 Ga0207704_10326324 Ga0207704_103263241 189
350 3300025940 Ga0207691_10017883 Ga0207691_100178839 189
351 3300025940 Ga0207691_10198305 Ga0207691_101983053 189
352 3300025941 Ga0207711_10727484 Ga0207711_107274841 189
353 3300025949 Ga0207667_10007180 Ga0207667_1000718018 189
354 3300025961 Ga0207712_10003124 Ga0207712_1000312412 189
355 3300025961 Ga0207712_10030694 Ga0207712_100306944 189
356 3300025972 Ga0207668_10014035 Ga0207668_100140353 189
357 3300025986 Ga0207658_10058609 Ga0207658_100586093 189
358 3300026035 Ga0207703_10495847 Ga0207703_104958472 189
359 3300026041 Ga0207639_10236145 Ga0207639_102361452 189
360 3300026041 Ga0207639_10444629 Ga0207639_104446291 189
361 3300026075 Ga0207708_10107898 Ga0207708_101078982 189
362 3300026088 Ga0207641_10006216 Ga0207641_100062167 189
363 3300026089 Ga0207648_10009982 Ga0207648_100099824 189
364 3300026116 Ga0207674_10125739 Ga0207674_101257392 189
365 3300026121 Ga0207683_10122851 Ga0207683_101228513 189
366 3300027876 Ga0209974_10019008 Ga0209974_100190083 189
367 3300028380 Ga0268265_10003198 Ga0268265_100031987 189
368 3300028380 Ga0268265_10127552 Ga0268265_101275523 189
369 3300028380 Ga0268265_10131669 Ga0268265_101316694 189
370 3300028381 Ga0268264_10001868 Ga0268264_1000186824 189
371 3300028381 Ga0268264_10146195 Ga0268264_101461953 189
372 3300028381 Ga0268264_10174044 Ga0268264_101740443 189
373 3300030745 Ga0316182_1296768 Ga0316182_12967682 189
374 3300031548 Ga0307408_100014066 Ga0307408_1000140665 189
375 3300031548 Ga0307408_100112937 Ga0307408_1001129373 189
376 3300031731 Ga0307405_10428953 Ga0307405_104289532 189
377 3300031824 Ga0307413_10173859 Ga0307413_101738593 189
378 3300031852 Ga0307410_10314471 Ga0307410_103144712 189
379 3300031911 Ga0307412_10008969 Ga0307412_100089694 189
380 3300031995 Ga0307409_100012781 Ga0307409_1000127814 189
381 3300032002 Ga0307416_100011077 Ga0307416_1000110774 189
382 3300032002 Ga0307416_100158962 Ga0307416_1001589621 189
383 3300032004 Ga0307414_10796496 Ga0307414_107964961 189
384 3300032005 Ga0307411_10045427 Ga0307411_100454275 189
385 3300032005 Ga0307411_10618728 Ga0307411_106187282 189
386 3300032126 Ga0307415_100018963 Ga0307415_1000189632 189
387 3300032126 Ga0307415_100026442 Ga0307415_1000264426 189
388 3300032126 Ga0307415_100176295 Ga0307415_1001762952 189
389 3300037312 Ga0395899_0022418 Ga0395899_0022418_243_956 189
390 3300037312 Ga0395899_0059933 Ga0395899_0059933_516_1235 189
391 3300037312 Ga0395899_0290096 Ga0395899_0290096_123_842 189
392 3300037418 Ga0395900_0001090 Ga0395900_0001090_32635_33354 189
393 3300037418 Ga0395900_0004128 Ga0395900_0004128_9509_10222 189
394 3300037418 Ga0395900_0341624 Ga0395900_0341624_343_1062 189
395 3300037418 Ga0395900_0485561 Ga0395900_0485561_350_1069 189
396 3300037466 Ga0395898_0320765 Ga0395898_0320765_299_1018 189
397 3300037471 Ga0395905_0001328 Ga0395905_0001328_13063_13782 189
398 3300037471 Ga0395905_0001412 Ga0395905_0001412_4915_5634 189
399 3300037471 Ga0395905_0039058 Ga0395905_0039058_3698_4417 189
400 3300037471 Ga0395905_0042935 Ga0395905_0042935_2808_3527 189
401 3300037471 Ga0395905_0081447 Ga0395905_0081447_786_1505 189
402 3300037471 Ga0395905_0148208 Ga0395905_0148208_582_1304 189
403 3300037471 Ga0395905_0356328 Ga0395905_0356328_350_1072 189
404 3300038443 Ga0395901_0057438 Ga0395901_0057438_2554_3273 189
405 3300038443 Ga0395901_0342522 Ga0395901_0342522_44_763 189
406 3300038443 Ga0395901_0493448 Ga0395901_0493448_145_864 189
407 3300042157 Ga0439458_0000025 Ga0439458_0000025_17747_18466 189
408 3300042157 Ga0439458_0001657 Ga0439458_0001657_3769_4488 189
409 3300044693 Ga0466961_0084884 Ga0466961_0084884_916_1635 189
410 3300045836 Ga0466958_0239378 Ga0466958_0239378_378_1097 189
411 3300045836 Ga0466958_0404641 Ga0466958_0404641_100_819 189
412 3300046500 Ga0495596_0022459 Ga0495596_0022459_1315_2046 189
413 3300046525 Ga0495663_0015883 Ga0495663_0015883_998_1723 189
414 3300046539 Ga0495621_0000121 Ga0495621_0000121_8123_8848 189
415 3300046539 Ga0495621_0033975 Ga0495621_0033975_417_1148 189
416 3300046558 Ga0495633_0014199 Ga0495633_0014199_1030_1761 189
417 3300046664 Ga0495659_0072825 Ga0495659_0072825_463_1194 189
418 3300046691 Ga0495670_0021115 Ga0495670_0021115_1866_2591 189
419 3300046691 Ga0495670_0024112 Ga0495670_0024112_549_1280 189
420 3300048915 Ga0496112_0059671 Ga0496112_0059671_2436_3149 189
421 3300048915 Ga0496112_0079830 Ga0496112_0079830_2250_2972 189
422 3300048916 Ga0496113_0011581 Ga0496113_0011581_2363_3076 189
423 3300049652 Ga0501202_003892 Ga0501202_003892_748_1467 189
424 3300049664 Ga0501224_007049 Ga0501224_007049_136_855 189
425 3300049679 Ga0501249_009132 Ga0501249_009132_41_760 189
426 3300050511 nmdc:mga08y16_48195_c1 nmdc:mga08y16_48195_c1_1646_2377 189
427 3300050512 nmdc:mga0n895_186287_c1 nmdc:mga0n895_186287_c1_353_1075 189
428 3300053134 Ga0500658_0000022 Ga0500658_0000022_34019_34741 189
429 3300001991 JGI24743J22301_10028966 JGI24743J22301_100289662 190
430 3300005331 Ga0070670_100106430 Ga0070670_1001064304 190
431 3300005344 Ga0070661_100385882 Ga0070661_1003858822 190
432 3300005354 Ga0070675_100026972 Ga0070675_1000269725 190
433 3300005364 Ga0070673_100006764 Ga0070673_1000067647 190
434 3300005364 Ga0070673_100018247 Ga0070673_1000182474 190
435 3300005364 Ga0070673_100073244 Ga0070673_1000732443 190
436 3300006051 Ga0075364_10296469 Ga0075364_102964691 190
437 3300006175 Ga0070712_100005180 Ga0070712_1000051804 190
438 3300006914 Ga0075436_100300782 Ga0075436_1003007821 190
439 3300025903 Ga0207680_10026175 Ga0207680_100261753 190
440 3300025915 Ga0207693_10011907 Ga0207693_100119074 190
441 3300025920 Ga0207649_10331455 Ga0207649_103314552 190
442 3300025925 Ga0207650_10075443 Ga0207650_100754433 190
443 3300025960 Ga0207651_10144519 Ga0207651_101445193 190
444 3300026121 Ga0207683_10608435 Ga0207683_106084351 190
445 3300028380 Ga0268265_10007068 Ga0268265_100070689 190
446 3300031852 Ga0307410_10040338 Ga0307410_100403383 190
447 3300032005 Ga0307411_10229980 Ga0307411_102299801 190
448 3300032126 Ga0307415_100569803 Ga0307415_1005698031 190
449 3300037312 Ga0395899_0010126 Ga0395899_0010126_332_1054 190
450 3300037312 Ga0395899_0048521 Ga0395899_0048521_843_1565 190
451 3300037418 Ga0395900_0025406 Ga0395900_0025406_102_824 190
452 3300037418 Ga0395900_0027249 Ga0395900_0027249_1857_2579 190
453 3300037466 Ga0395898_0022960 Ga0395898_0022960_4418_5140 190
454 3300037466 Ga0395898_0078705 Ga0395898_0078705_1986_2708 190
455 3300037471 Ga0395905_0003967 Ga0395905_0003967_11567_12289 190
456 3300037471 Ga0395905_0004150 Ga0395905_0004150_6167_6889 190
457 3300037471 Ga0395905_0009388 Ga0395905_0009388_983_1705 190
458 3300037471 Ga0395905_0021349 Ga0395905_0021349_1676_2398 190
459 3300037471 Ga0395905_0293647 Ga0395905_0293647_734_1456 190
460 3300037471 Ga0395905_0325718 Ga0395905_0325718_119_841 190
461 3300038443 Ga0395901_0028350 Ga0395901_0028350_150_872 190
462 3300038443 Ga0395901_0031697 Ga0395901_0031697_1693_2415 190
463 3300038443 Ga0395901_0037553 Ga0395901_0037553_2445_3167 190
464 3300050491 nmdc:mga00v17_116410_c1 nmdc:mga00v17_116410_c1_323_1045 190
465 3300050492 nmdc:mga0yw44_326918_c1 nmdc:mga0yw44_326918_c1_222_944 190
466 3300031548 Ga0307408_100020009 Ga0307408_1000200094 191
467 3300031731 Ga0307405_10005612 Ga0307405_100056124 191
468 3300031824 Ga0307413_10013753 Ga0307413_100137534 191
469 3300031852 Ga0307410_10010829 Ga0307410_100108295 191
470 3300031901 Ga0307406_10022885 Ga0307406_100228855 191
471 3300031901 Ga0307406_10158536 Ga0307406_101585362 191
472 3300031903 Ga0307407_10000729 Ga0307407_100007298 191
473 3300031911 Ga0307412_10073634 Ga0307412_100736343 191
474 3300031995 Ga0307409_100009982 Ga0307409_1000099824 191
475 3300031995 Ga0307409_100011022 Ga0307409_1000110224 191
476 3300031995 Ga0307409_100256496 Ga0307409_1002564961 191
477 3300032002 Ga0307416_100019447 Ga0307416_1000194474 191
478 3300032002 Ga0307416_100064507 Ga0307416_1000645073 191
479 3300032004 Ga0307414_10007306 Ga0307414_100073066 191
480 3300032004 Ga0307414_10041628 Ga0307414_100416282 191
481 3300032005 Ga0307411_10006086 Ga0307411_100060864 191
482 3300032005 Ga0307411_10009911 Ga0307411_100099114 191
483 3300032005 Ga0307411_10069460 Ga0307411_100694602 191
484 3300032126 Ga0307415_100008679 Ga0307415_1000086794 191
485 3300037471 Ga0395905_0523070 Ga0395905_0523070_311_1036 191
486 3300005844 Ga0068862_100229165 Ga0068862_1002291653 192
487 3300028380 Ga0268265_10018945 Ga0268265_100189452 192
488 3300009551 Ga0105238_10015311 Ga0105238_100153118 196
489 3300014325 Ga0163163_10030233 Ga0163163_100302334 196
490 3300014969 Ga0157376_10007563 Ga0157376_100075638 196
491 3300048905 Ga0496102_0784094 Ga0496102_0784094_14_763 196
492 3300048913 Ga0496110_0001880 Ga0496110_0001880_13923_14672 196
493 3300048915 Ga0496112_0162893 Ga0496112_0162893_294_1043 196
494 3300048916 Ga0496113_0000485 Ga0496113_0000485_18614_19363 196
495 3300031824 Ga0307413_10000961 Ga0307413_100009617 198
496 3300031852 Ga0307410_10001040 Ga0307410_100010407 198
497 3300031903 Ga0307407_10094647 Ga0307407_100946472 198
498 3300032004 Ga0307414_10001136 Ga0307414_100011369 198
499 3300032005 Ga0307411_10000914 Ga0307411_100009147 198
500 3300005355 Ga0070671_100159000 Ga0070671_1001590003 205
501 3300005354 Ga0070675_100406710 Ga0070675_1004067101 206
502 3300001979 JGI24740J21852_10027473 JGI24740J21852_100274733 209
503 3300001989 JGI24739J22299_10009989 JGI24739J22299_100099893 209
504 3300001990 JGI24737J22298_10033148 JGI24737J22298_100331483 209
505 3300002075 JGI24738J21930_10002409 JGI24738J21930_100024098 209
506 3300005327 Ga0070658_10000117 Ga0070658_1000011767 209
507 3300005335 Ga0070666_10026669 Ga0070666_100266695 209
508 3300005339 Ga0070660_100000530 Ga0070660_10000053021 209
509 3300005344 Ga0070661_100000079 Ga0070661_10000007966 209
510 3300005364 Ga0070673_100292353 Ga0070673_1002923532 209
511 3300005366 Ga0070659_100000165 Ga0070659_10000016521 209
512 3300005367 Ga0070667_100026477 Ga0070667_1000264773 209
513 3300005455 Ga0070663_100007461 Ga0070663_1000074613 209
514 3300005457 Ga0070662_100000171 Ga0070662_1000001716 209
515 3300005539 Ga0068853_100001092 Ga0068853_10000109213 209
516 3300005547 Ga0070693_100000327 Ga0070693_10000032722 209
517 3300005548 Ga0070665_100015947 Ga0070665_1000159474 209
518 3300005563 Ga0068855_100000447 Ga0068855_10000044721 209
519 3300005564 Ga0070664_100000311 Ga0070664_1000003112 209
520 3300005578 Ga0068854_100060863 Ga0068854_1000608634 209
521 3300005614 Ga0068856_100000979 Ga0068856_1000009792 209
522 3300005616 Ga0068852_100014704 Ga0068852_1000147045 209
523 3300005834 Ga0068851_10018904 Ga0068851_100189043 209
524 3300005842 Ga0068858_100135351 Ga0068858_1001353515 209
525 3300006358 Ga0068871_100025963 Ga0068871_1000259638 209
526 3300009177 Ga0105248_10000117 Ga0105248_1000011765 209
527 3300009551 Ga0105238_10539521 Ga0105238_105395212 209
528 3300013102 Ga0157371_10004956 Ga0157371_100049563 209
529 3300013105 Ga0157369_10452068 Ga0157369_104520681 209
530 3300014325 Ga0163163_10000380 Ga0163163_1000038033 209
531 3300025321 Ga0207656_10009797 Ga0207656_100097973 209
532 3300025903 Ga0207680_10016496 Ga0207680_100164963 209
533 3300025904 Ga0207647_10092346 Ga0207647_100923462 209
534 3300025909 Ga0207705_10000222 Ga0207705_1000022240 209
535 3300025919 Ga0207657_10000378 Ga0207657_1000037833 209
536 3300025920 Ga0207649_10000135 Ga0207649_1000013519 209
537 3300025931 Ga0207644_10045670 Ga0207644_100456701 209
538 3300025932 Ga0207690_10000559 Ga0207690_1000055911 209
539 3300025933 Ga0207706_10000513 Ga0207706_1000051315 209
540 3300025941 Ga0207711_10000558 Ga0207711_100005587 209
541 3300025945 Ga0207679_10001067 Ga0207679_100010674 209
542 3300025949 Ga0207667_10001204 Ga0207667_1000120419 209
543 3300025981 Ga0207640_10048196 Ga0207640_100481964 209
544 3300025986 Ga0207658_10128921 Ga0207658_101289213 209
545 3300026035 Ga0207703_10189765 Ga0207703_101897654 209
546 3300026041 Ga0207639_10000412 Ga0207639_1000041211 209
547 3300026067 Ga0207678_10218774 Ga0207678_102187743 209
548 3300026078 Ga0207702_10002993 Ga0207702_1000299310 209
549 3300026116 Ga0207674_10253174 Ga0207674_102531742 209
550 3300026142 Ga0207698_10030784 Ga0207698_100307844 209
551 3300028379 Ga0268266_10006447 Ga0268266_100064474 209
552 3300035691 Ga0373931_0012374 Ga0373931_0012374_2035_2808 209
553 3300048907 Ga0496104_0144473 Ga0496104_0144473_700_1473 209
554 3300048915 Ga0496112_0581968 Ga0496112_0581968_249_1022 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

53

253

0.93

Feature Viewer

pLDDT pTM Quality
58.63 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map