F462848

General Info

Members Datasets Scaffolds Average Seq Length
553 270 553 288

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100048209|Ga0075436_1000482092
Length 322
Sequence MSCLPRSTRILVNFRGPAKGFDRGISEEIMAIQRVGVVGCGLMGSGIAQVCAASGFETVVREVATELVEKGLKGIEKNLARLVEKGTITETAKGEIRGRLKGTTAIEDLKNCDLVIEAIIEQLPAKRELFSALDKLCPASAIFASNTSSLTITEIATSTKRPERFVGLHFFNPVPVMKLVEVVRTIATDAAVYDEMVSFGAKLGKTPVRAHDSTGFIVNRLLVPYLLDAIRALEEGVGSIEDIDNSMKLGCGHPMGPLTLLDFVGLDTTYYISQIMYEEFKERRFAAPPLLKRMVLAGWNGRKAGRGFYDYADPAKPVAGKF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
152 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 5.06
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_9220216 2162886012 Bacteria 3619
2 JGI25406J46586_10006466 3300003203 Bacteria 5392
3 Ga0065715_10091628 3300005293 Bacteria 5656
4 Ga0070676_10241282 3300005328 Bacteria 1202
5 Ga0070690_100000276 3300005330 Bacteria 26326
6 Ga0070690_100078395 3300005330 Bacteria 2158
7 Ga0070670_100570542 3300005331 Bacteria 1011
8 Ga0068869_100007471 3300005334 Bacteria 6991
9 Ga0068869_100323215 3300005334 Bacteria 1252
10 Ga0070680_100039672 3300005336 Bacteria 3809
11 Ga0070680_100054189 3300005336 Bacteria 3274
12 Ga0068868_100110149 3300005338 Bacteria 2237
13 Ga0070689_100015906 3300005340 Bacteria 5497
14 Ga0070689_100053558 3300005340 Bacteria 3123
15 Ga0070689_100200598 3300005340 Bacteria 1629
16 Ga0070687_100180455 3300005343 Bacteria 1264
17 Ga0070669_100379915 3300005353 Bacteria 1152
18 Ga0070675_100092611 3300005354 Bacteria 2534
19 Ga0070675_100267735 3300005354 Bacteria 1499
20 Ga0070674_100007275 3300005356 Bacteria 6519
21 Ga0070674_100030059 3300005356 Bacteria 3586
22 Ga0070688_100004213 3300005365 Bacteria 7473
23 Ga0070667_100000353 3300005367 Bacteria 50941
24 Ga0070667_100036591 3300005367 Bacteria 4116
25 Ga0070667_100302501 3300005367 Bacteria 1440
26 Ga0070703_10045154 3300005406 Bacteria 1388
27 Ga0070709_10001767 3300005434 Bacteria 11742
28 Ga0070709_10005981 3300005434 Bacteria 6610
29 Ga0070709_10056040 3300005434 Bacteria 2491
30 Ga0070709_10089594 3300005434 Bacteria 2026
31 Ga0070709_10134301 3300005434 Bacteria 1693
32 Ga0070714_100185587 3300005435 Bacteria 1895
33 Ga0070713_100190432 3300005436 Bacteria 1848
34 Ga0070713_100252948 3300005436 Bacteria 1608
35 Ga0070713_100278959 3300005436 Bacteria 1532
36 Ga0070713_100579299 3300005436 Bacteria 1065
37 Ga0070701_10010645 3300005438 Bacteria 4077
38 Ga0070705_100005296 3300005440 Bacteria 6274
39 Ga0070705_100046942 3300005440 Bacteria 2493
40 Ga0070700_100415918 3300005441 Bacteria 1015
41 Ga0070694_100001777 3300005444 Bacteria 12759
42 Ga0070694_100046120 3300005444 Bacteria 2924
43 Ga0070708_100012993 3300005445 Bacteria 6803
44 Ga0070708_100040176 3300005445 Bacteria 4096
45 Ga0070708_100090517 3300005445 Bacteria 2785
46 Ga0070708_100481972 3300005445 Unclassified 1170
47 Ga0070662_100202935 3300005457 Bacteria 1574
48 Ga0070681_10028869 3300005458 Bacteria 5574
49 Ga0068867_100002159 3300005459 Bacteria 13795
50 Ga0068867_100030036 3300005459 Bacteria 3919
51 Ga0070685_10017901 3300005466 Bacteria 3803
52 Ga0070706_100004756 3300005467 Bacteria 13015
53 Ga0070706_100006762 3300005467 Bacteria 10826
54 Ga0070706_100023066 3300005467 Bacteria 5732
55 Ga0070706_100187038 3300005467 Bacteria 1935
56 Ga0070706_100419679 3300005467 Bacteria 1245
57 Ga0070707_100000001 3300005468 Bacteria 320358
58 Ga0070707_100001143 3300005468 Bacteria 26117
59 Ga0070707_100002126 3300005468 Bacteria 18971
60 Ga0070707_100013153 3300005468 Bacteria 7735
61 Ga0070707_100013990 3300005468 Bacteria 7519
62 Ga0070707_100016724 3300005468 Bacteria 6885
63 Ga0070707_100038754 3300005468 Bacteria 4553
64 Ga0070707_100082269 3300005468 Bacteria 3109
65 Ga0070707_100098592 3300005468 Bacteria 2831
66 Ga0070707_100125656 3300005468 Bacteria 2492
67 Ga0070707_100231815 3300005468 Bacteria 1797
68 Ga0070707_100366367 3300005468 Bacteria 1400
69 Ga0070707_100536477 3300005468 Bacteria 1132
70 Ga0070698_100001135 3300005471 Bacteria 29460
71 Ga0070698_100002968 3300005471 Bacteria 18663
72 Ga0070699_100047804 3300005518 Bacteria 3702
73 Ga0070699_100048781 3300005518 Bacteria 3665
74 Ga0070699_100171141 3300005518 Bacteria 1925
75 Ga0070699_100234149 3300005518 Bacteria 1638
76 Ga0070679_100001897 3300005530 Bacteria 18763
77 Ga0070679_100025810 3300005530 Bacteria 5766
78 Ga0070684_100298224 3300005535 Bacteria 1479
79 Ga0070697_100000403 3300005536 Bacteria 33399
80 Ga0070697_100013629 3300005536 Bacteria 6377
81 Ga0070697_100015078 3300005536 Bacteria 6066
82 Ga0070697_100060718 3300005536 Bacteria 3082
83 Ga0070697_100142933 3300005536 Bacteria 2013
84 Ga0070697_100435162 3300005536 Bacteria 1141
85 Ga0068853_100530954 3300005539 Bacteria 1113
86 Ga0070672_100160121 3300005543 Bacteria 1867
87 Ga0070686_100011909 3300005544 Bacteria 4944
88 Ga0070696_100000608 3300005546 Bacteria 22987
89 Ga0070696_100035947 3300005546 Bacteria 3412
90 Ga0070696_100042774 3300005546 Unclassified 3132
91 Ga0070696_100297338 3300005546 Bacteria 1235
92 Ga0070693_100000074 3300005547 Bacteria 41112
93 Ga0070693_100207211 3300005547 Bacteria 1277
94 Ga0070665_100000658 3300005548 Bacteria 46603
95 Ga0070665_100000839 3300005548 Bacteria 40097
96 Ga0070665_100032232 3300005548 Bacteria 5275
97 Ga0070665_100056292 3300005548 Bacteria 3943
98 Ga0070704_100007133 3300005549 Bacteria 6635
99 Ga0070704_100135795 3300005549 Bacteria 1913
100 Ga0070664_100009476 3300005564 Bacteria 7895
101 Ga0068854_100480319 3300005578 Bacteria 1043
102 Ga0068856_100000928 3300005614 Bacteria 31425
103 Ga0070702_100001628 3300005615 Bacteria 9294
104 Ga0068859_100002971 3300005617 Bacteria 17190
105 Ga0068859_100284041 3300005617 Bacteria 1748
106 Ga0068859_100391951 3300005617 Bacteria 1484
107 Ga0068859_100876116 3300005617 Bacteria 983
108 Ga0068864_100080757 3300005618 Bacteria 2850
109 Ga0068864_100103542 3300005618 Bacteria 2527
110 Ga0068866_10016469 3300005718 Bacteria 3305
111 Ga0068861_100003557 3300005719 Bacteria 10364
112 Ga0068863_100015467 3300005841 Bacteria 7334
113 Ga0068863_100182735 3300005841 Bacteria 2013
114 Ga0068863_100583484 3300005841 Bacteria 1105
115 Ga0068858_100034221 3300005842 Bacteria 4712
116 Ga0068858_100054235 3300005842 Bacteria 3707
117 Ga0068858_100156986 3300005842 Bacteria 2141
118 Ga0068858_100162140 3300005842 Bacteria 2105
119 Ga0068860_100002166 3300005843 Bacteria 20690
120 Ga0068860_100036262 3300005843 Bacteria 4726
121 Ga0068860_100198206 3300005843 Bacteria 1945
122 Ga0068860_100546792 3300005843 Bacteria 1160
123 Ga0068862_100127571 3300005844 Bacteria 2247
124 Ga0081455_10013309 3300005937 Bacteria 8142
125 Ga0081455_10013931 3300005937 Bacteria 7904
126 Ga0070717_10310785 3300006028 Bacteria 1403
127 Ga0075368_10009666 3300006042 Bacteria 3473
128 Ga0075364_10015566 3300006051 Bacteria 4718
129 Ga0070716_100000189 3300006173 Bacteria 24291
130 Ga0070716_100000320 3300006173 Bacteria 19326
131 Ga0070716_100009017 3300006173 Bacteria 4964
132 Ga0070716_100034851 3300006173 Bacteria 2763
133 Ga0070716_100063585 3300006173 Bacteria 2143
134 Ga0070716_100166862 3300006173 Bacteria 1432
135 Ga0070712_100199425 3300006175 Bacteria 1571
136 Ga0075362_10045515 3300006177 Bacteria 1949
137 Ga0075367_10000762 3300006178 Bacteria 12593
138 Ga0075366_10078502 3300006195 Bacteria 1970
139 Ga0097621_100016224 3300006237 Bacteria 5625
140 Ga0097621_100024740 3300006237 Bacteria 4693
141 Ga0075370_10047072 3300006353 Bacteria 2441
142 Ga0068871_100003158 3300006358 Bacteria 11318
143 Ga0075428_100012452 3300006844 Bacteria 9459
144 Ga0075428_100033867 3300006844 Bacteria 5635
145 Ga0075428_100198204 3300006844 Bacteria 2171
146 Ga0075428_100712893 3300006844 Bacteria 1068
147 Ga0075431_100008888 3300006847 Bacteria 10066
148 Ga0075431_100116286 3300006847 Bacteria 2760
149 Ga0075431_100400646 3300006847 Bacteria 1373
150 Ga0075431_100426606 3300006847 Bacteria 1324
151 Ga0075433_10017752 3300006852 Bacteria 5902
152 Ga0075433_10054549 3300006852 Bacteria 3487
153 Ga0075433_10073306 3300006852 Bacteria 3011
154 Ga0075434_100015558 3300006871 Bacteria 7301
155 Ga0075434_100026154 3300006871 Bacteria 5716
156 Ga0075434_100112924 3300006871 Bacteria 2728
157 Ga0075434_100129016 3300006871 Bacteria 2547
158 Ga0075434_100152037 3300006871 Bacteria 2335
159 Ga0075429_100023165 3300006880 Bacteria 5385
160 Ga0075429_100120979 3300006880 Bacteria 2289
161 Ga0068865_100145856 3300006881 Bacteria 1790
162 Ga0068865_100165984 3300006881 Bacteria 1688
163 Ga0075436_100000274 3300006914 Bacteria 32562
164 Ga0075436_100004772 3300006914 Bacteria 9309
165 Ga0075436_100006260 3300006914 Bacteria 8154
166 Ga0075436_100006469 3300006914 Bacteria 8025
167 Ga0075436_100048209 3300006914 Bacteria 2939
168 Ga0097620_100002971 3300006931 Bacteria 17190
169 Ga0097620_100284045 3300006931 Bacteria 1748
170 Ga0097620_100391976 3300006931 Bacteria 1484
171 Ga0097620_100876361 3300006931 Bacteria 983
172 Ga0075435_100004576 3300007076 Bacteria 9520
173 Ga0075435_100007348 3300007076 Bacteria 7846
174 Ga0075435_100015970 3300007076 Bacteria 5654
175 Ga0075435_100088718 3300007076 Bacteria 2550
176 Ga0075435_100341780 3300007076 Bacteria 1282
177 Ga0099794_10002036 3300007265 Bacteria 7317
178 Ga0099794_10004326 3300007265 Bacteria 5559
179 Ga0099794_10006403 3300007265 Bacteria 4764
180 Ga0099794_10022013 3300007265 Bacteria 2902
181 Ga0099794_10053034 3300007265 Bacteria 1955
182 Ga0099794_10091516 3300007265 Bacteria 1510
183 Ga0099794_10110583 3300007265 Bacteria 1376
184 Ga0099794_10155151 3300007265 Bacteria 1163
185 Ga0099795_10000569 3300007788 Bacteria 6994
186 Ga0111539_10001388 3300009094 Bacteria 32201
187 Ga0111539_10266696 3300009094 Bacteria 1993
188 Ga0111539_10485276 3300009094 Bacteria 1439
189 Ga0105247_10198061 3300009101 Bacteria 1348
190 Ga0105247_10206340 3300009101 Bacteria 1323
191 Ga0114129_10000596 3300009147 Bacteria 44594
192 Ga0114129_10010450 3300009147 Bacteria 13238
193 Ga0114129_10011008 3300009147 Bacteria 12887
194 Ga0114129_10129049 3300009147 Bacteria 3474
195 Ga0114129_10247941 3300009147 Bacteria 2392
196 Ga0114129_10507224 3300009147 Bacteria 1574
197 Ga0114129_10938595 3300009147 Bacteria 1094
198 Ga0105243_10099317 3300009148 Bacteria 2413
199 Ga0105242_10008603 3300009176 Bacteria 7837
200 Ga0105242_10069178 3300009176 Bacteria 2923
201 Ga0105248_10003273 3300009177 Bacteria 17975
202 Ga0105248_10018800 3300009177 Bacteria 7642
203 Ga0105237_10202801 3300009545 Bacteria 1984
204 Ga0105237_10337771 3300009545 Bacteria 1511
205 Ga0105249_10624179 3300009553 Bacteria 1134
206 Ga0099796_10008296 3300010159 Bacteria 2765
207 Ga0105239_10031713 3300010375 Bacteria 5807
208 Ga0157374_10005842 3300013296 Bacteria 10394
209 Ga0157378_10000036 3300013297 Bacteria 117422
210 Ga0157378_10194334 3300013297 Bacteria 1916
211 Ga0157378_10259549 3300013297 Bacteria 1666
212 Ga0163162_10084033 3300013306 Bacteria 3258
213 Ga0163162_10619478 3300013306 Bacteria 1207
214 Ga0157372_10121963 3300013307 Bacteria 2995
215 Ga0157375_10000609 3300013308 Bacteria 31758
216 Ga0157375_10011835 3300013308 Bacteria 7715
217 Ga0157375_10037675 3300013308 Bacteria 4635
218 Ga0157375_10040519 3300013308 Bacteria 4490
219 Ga0157375_10295389 3300013308 Bacteria 1783
220 Ga0163163_10065313 3300014325 Bacteria 3612
221 Ga0157379_10002767 3300014968 Bacteria 14794
222 Ga0157379_10034203 3300014968 Bacteria 4530
223 Ga0157379_10070742 3300014968 Bacteria 3122
224 Ga0157376_10000014 3300014969 Bacteria 303001
225 Ga0157376_10429477 3300014969 Bacteria 1284
226 Ga0163161_10124210 3300017792 Bacteria 1942
227 Ga0213876_10000038 3300021384 Bacteria 182431
228 Ga0213876_10000098 3300021384 Bacteria 98314
229 Ga0213876_10041013 3300021384 Bacteria 2446
230 Ga0228598_1000836 3300024227 Bacteria 6652
231 Ga0207653_10003301 3300025885 Bacteria 5086
232 Ga0207682_10012908 3300025893 Bacteria 3257
233 Ga0207642_10015222 3300025899 Bacteria 2860
234 Ga0207642_10126499 3300025899 Unclassified 1327
235 Ga0207710_10122670 3300025900 Bacteria 1242
236 Ga0207688_10076773 3300025901 Bacteria 1903
237 Ga0207680_10066862 3300025903 Bacteria 2212
238 Ga0207680_10179804 3300025903 Bacteria 1430
239 Ga0207699_10001100 3300025906 Bacteria 12764
240 Ga0207699_10037015 3300025906 Bacteria 2785
241 Ga0207684_10007386 3300025910 Bacteria 9902
242 Ga0207684_10009900 3300025910 Bacteria 8408
243 Ga0207684_10021550 3300025910 Bacteria 5502
244 Ga0207684_10065683 3300025910 Bacteria 3080
245 Ga0207684_10093016 3300025910 Bacteria 2570
246 Ga0207684_10139166 3300025910 Bacteria 2086
247 Ga0207684_10274859 3300025910 Bacteria 1453
248 Ga0207684_10358053 3300025910 Bacteria 1256
249 Ga0207707_10101225 3300025912 Bacteria 2518
250 Ga0207707_10140599 3300025912 Bacteria 2111
251 Ga0207671_10231249 3300025914 Bacteria 1450
252 Ga0207693_10014041 3300025915 Bacteria 6449
253 Ga0207663_10048983 3300025916 Bacteria 2618
254 Ga0207663_10471593 3300025916 Bacteria 971
255 Ga0207660_10019388 3300025917 Bacteria 4546
256 Ga0207660_10157197 3300025917 Bacteria 1751
257 Ga0207652_10024223 3300025921 Bacteria 5034
258 Ga0207652_10087328 3300025921 Bacteria 2735
259 Ga0207646_10000029 3300025922 Bacteria 223317
260 Ga0207646_10000054 3300025922 Bacteria 160414
261 Ga0207646_10000458 3300025922 Bacteria 54588
262 Ga0207646_10005722 3300025922 Bacteria 13040
263 Ga0207646_10017665 3300025922 Bacteria 6665
264 Ga0207646_10026600 3300025922 Bacteria 5278
265 Ga0207646_10092291 3300025922 Bacteria 2710
266 Ga0207646_10119807 3300025922 Bacteria 2364
267 Ga0207646_10206946 3300025922 Bacteria 1772
268 Ga0207646_10347852 3300025922 Bacteria 1339
269 Ga0207646_10390733 3300025922 Bacteria 1257
270 Ga0207646_10496546 3300025922 Bacteria 1100
271 Ga0207681_10186910 3300025923 Bacteria 1582
272 Ga0207650_10451545 3300025925 Bacteria 1070
273 Ga0207659_10063806 3300025926 Bacteria 2664
274 Ga0207700_10183543 3300025928 Bacteria 1753
275 Ga0207700_10248472 3300025928 Bacteria 1519
276 Ga0207700_10357120 3300025928 Bacteria 1273
277 Ga0207644_10235796 3300025931 Bacteria 1455
278 Ga0207706_10091656 3300025933 Bacteria 2672
279 Ga0207706_10225135 3300025933 Bacteria 1642
280 Ga0207670_10009573 3300025936 Bacteria 5536
281 Ga0207670_10157194 3300025936 Bacteria 1693
282 Ga0207669_10013292 3300025937 Bacteria 4083
283 Ga0207665_10000028 3300025939 Bacteria 96657
284 Ga0207665_10000784 3300025939 Bacteria 21399
285 Ga0207665_10003840 3300025939 Bacteria 10045
286 Ga0207665_10011617 3300025939 Bacteria 5787
287 Ga0207665_10016803 3300025939 Bacteria 4806
288 Ga0207665_10053829 3300025939 Bacteria 2713
289 Ga0207665_10081618 3300025939 Bacteria 2227
290 Ga0207691_10000409 3300025940 Bacteria 43045
291 Ga0207691_10019670 3300025940 Bacteria 6387
292 Ga0207691_10090520 3300025940 Bacteria 2742
293 Ga0207689_10022106 3300025942 Bacteria 5349
294 Ga0207689_10075192 3300025942 Bacteria 2776
295 Ga0207679_10443237 3300025945 Bacteria 1150
296 Ga0207667_10418748 3300025949 Bacteria 1363
297 Ga0207651_10027411 3300025960 Bacteria 3578
298 Ga0207651_10078782 3300025960 Bacteria 2365
299 Ga0207651_10453193 3300025960 Bacteria 1101
300 Ga0207640_10011073 3300025981 Bacteria 5095
301 Ga0207640_10358030 3300025981 Bacteria 1175
302 Ga0207658_10010761 3300025986 Bacteria 6222
303 Ga0207658_10023918 3300025986 Bacteria 4269
304 Ga0207703_10006881 3300026035 Bacteria 9053
305 Ga0207703_10081955 3300026035 Bacteria 2691
306 Ga0207703_10532231 3300026035 Bacteria 1106
307 Ga0207678_10056009 3300026067 Bacteria 3396
308 Ga0207678_10169721 3300026067 Bacteria 1863
309 Ga0207678_10457373 3300026067 Bacteria 1110
310 Ga0207708_10068543 3300026075 Bacteria 2715
311 Ga0207708_10361042 3300026075 Bacteria 1194
312 Ga0207641_10000946 3300026088 Bacteria 29813
313 Ga0207641_10011070 3300026088 Bacteria 7399
314 Ga0207641_10056430 3300026088 Bacteria 3338
315 Ga0207641_10090278 3300026088 Bacteria 2679
316 Ga0207641_10106082 3300026088 Bacteria 2483
317 Ga0207641_10563229 3300026088 Bacteria 1112
318 Ga0207648_10001084 3300026089 Bacteria 30487
319 Ga0207648_10028168 3300026089 Bacteria 4982
320 Ga0207676_10084854 3300026095 Bacteria 2583
321 Ga0207676_10126686 3300026095 Bacteria 2164
322 Ga0207676_10136229 3300026095 Bacteria 2095
323 Ga0207674_10119505 3300026116 Bacteria 2604
324 Ga0207675_100003518 3300026118 Bacteria 15286
325 Ga0207675_100013317 3300026118 Bacteria 7676
326 Ga0207675_100029288 3300026118 Bacteria 5130
327 Ga0207683_10013111 3300026121 Bacteria 7070
328 Ga0209968_1004661 3300027526 Bacteria 2056
329 Ga0209999_1003031 3300027543 Bacteria 2990
330 Ga0209970_1006981 3300027614 Bacteria 1852
331 Ga0209983_1003468 3300027665 Bacteria 3367
332 Ga0209588_1000932 3300027671 Bacteria 7454
333 Ga0209588_1001252 3300027671 Bacteria 6573
334 Ga0209588_1002246 3300027671 Bacteria 5222
335 Ga0209588_1011359 3300027671 Bacteria 2688
336 Ga0209588_1021546 3300027671 Bacteria 2025
337 Ga0209588_1021932 3300027671 Bacteria 2008
338 Ga0209588_1046538 3300027671 Bacteria 1403
339 Ga0209971_1000763 3300027682 Bacteria 8312
340 Ga0209966_1017041 3300027695 Bacteria 1381
341 Ga0209998_10004780 3300027717 Bacteria 2860
342 Ga0209813_10009530 3300027866 Bacteria 2487
343 Ga0209974_10001348 3300027876 Bacteria 8836
344 Ga0207428_10000085 3300027907 Bacteria 132411
345 Ga0207428_10003072 3300027907 Bacteria 16432
346 Ga0265354_1000207 3300028016 Bacteria 10859
347 Ga0265354_1001426 3300028016 Bacteria 3436
348 Ga0265357_1000861 3300028023 Bacteria 2022
349 Ga0268266_10000072 3300028379 Bacteria 232245
350 Ga0268266_10001041 3300028379 Bacteria 34843
351 Ga0268266_10026583 3300028379 Bacteria 4925
352 Ga0268265_10030499 3300028380 Bacteria 3884
353 Ga0268265_10187696 3300028380 Bacteria 1782
354 Ga0268265_10197900 3300028380 Bacteria 1740
355 Ga0268264_10001283 3300028381 Bacteria 23718
356 Ga0268264_10200213 3300028381 Bacteria 1827
357 Ga0268264_10624389 3300028381 Bacteria 1064
358 Ga0265338_10045431 3300028800 Bacteria 4039
359 Ga0265338_10048786 3300028800 Bacteria 3847
360 Ga0265762_1017168 3300030760 Bacteria 1315
361 Ga0265770_1004829 3300030878 Bacteria 1847
362 Ga0265760_10003849 3300031090 Bacteria 4349
363 Ga0265760_10016896 3300031090 Bacteria 2095
364 Ga0265330_10034005 3300031235 Bacteria 2278
365 Ga0265332_10052365 3300031238 Bacteria 1753
366 Ga0307408_100032553 3300031548 Bacteria 3636
367 Ga0307408_100376555 3300031548 Bacteria 1212
368 Ga0316576_10016026 3300031727 Bacteria 5050
369 Ga0316576_10322726 3300031727 Bacteria 1152
370 Ga0316578_10012890 3300031728 Bacteria 4418
371 Ga0316578_10176765 3300031728 Bacteria 1286
372 Ga0316577_10010197 3300031733 Bacteria 5065
373 Ga0307413_10002445 3300031824 Bacteria 7550
374 Ga0307413_10005986 3300031824 Bacteria 5502
375 Ga0307410_10002774 3300031852 Bacteria 8568
376 Ga0307409_100101207 3300031995 Bacteria 2390
377 Ga0307416_100254955 3300032002 Bacteria 1710
378 Ga0307414_10001731 3300032004 Bacteria 11343
379 Ga0307411_10002621 3300032005 Bacteria 8045
380 Ga0307415_100006034 3300032126 Bacteria 6491
381 Ga0307415_100362222 3300032126 Bacteria 1225
382 Ga0316580_10046557 3300032139 Bacteria 1337
383 Ga0373926_0009384 3300035083 Bacteria 3270
384 Ga0373954_0048489 3300035118 Bacteria 1990
385 Ga0373943_0044447 3300035170 Bacteria 2162
386 Ga0373946_0019783 3300035171 Bacteria 2597
387 Ga0316574_0025326 3300035398 Bacteria 3560
388 Ga0373931_0120969 3300035691 Unclassified 1496
389 Ga0373935_0095559 3300035692 Bacteria 1952
390 Ga0373927_0000114 3300035695 Bacteria 60543
391 Ga0373947_0198233 3300035725 Bacteria 1313
392 Ga0373937_0114163 3300036401 Bacteria 2514
393 Ga0373937_0621239 3300036401 Bacteria 1025
394 Ga0316584_0112213 3300036712 Bacteria 2040
395 Ga0373925_0000115 3300037068 Bacteria 85776
396 Ga0373925_0224172 3300037068 Bacteria 1501
397 Ga0436365_1023949 3300039437 Bacteria 126686
398 Ga0436365_1292890 3300039437 Bacteria 4858
399 Ga0439448_0004832 3300042005 Bacteria 3819
400 Ga0451577_0055340 3300042876 Bacteria 3541
401 Ga0451577_0083721 3300042876 Bacteria 2845
402 Ga0451577_0153228 3300042876 Bacteria 2074
403 Ga0451577_0209774 3300042876 Bacteria 1759
404 Ga0453683_0001795 3300044673 Bacteria 17751
405 Ga0453683_0028239 3300044673 Bacteria 3553
406 Ga0453683_0152853 3300044673 Bacteria 1459
407 Ga0453684_0000949 3300044712 Bacteria 95680
408 Ga0453684_0122859 3300044712 Bacteria 3131
409 Ga0453684_0354242 3300044712 Bacteria 1654
410 Ga0453684_0478731 3300044712 Bacteria 1381
411 Ga0466959_0298506 3300045049 Bacteria 1103
412 Ga0451576_0059087 3300045051 Bacteria 4004
413 Ga0451576_0404681 3300045051 Bacteria 1431
414 Ga0495603_0005249 3300046455 Bacteria 7729
415 Ga0495629_0045492 3300046459 Bacteria 3079
416 Ga0495580_0001469 3300046472 Bacteria 20673
417 Ga0495580_0007702 3300046472 Bacteria 8636
418 Ga0495580_0082885 3300046472 Bacteria 2235
419 Ga0495580_0097976 3300046472 Bacteria 2040
420 Ga0495580_0187500 3300046472 Bacteria 1427
421 Ga0495582_0000133 3300046473 Bacteria 39882
422 Ga0495582_0054228 3300046473 Bacteria 2211
423 Ga0495582_0233856 3300046473 Bacteria 1052
424 Ga0495639_0003189 3300046475 Bacteria 7124
425 Ga0495664_0061497 3300046477 Bacteria 2236
426 Ga0495594_0009585 3300046499 Bacteria 5005
427 Ga0495618_0112127 3300046514 Bacteria 1746
428 Ga0495628_0040650 3300046516 Bacteria 3715
429 Ga0495628_0371134 3300046516 Bacteria 1049
430 Ga0495630_0020202 3300046517 Bacteria 4908
431 Ga0495630_0053979 3300046517 Bacteria 3010
432 Ga0495652_0236736 3300046529 Bacteria 1362
433 Ga0495586_0283985 3300046535 Bacteria 947
434 Ga0495645_0025485 3300046543 Bacteria 4292
435 Ga0495622_0083172 3300046557 Bacteria 1473
436 Ga0495622_0145378 3300046557 Bacteria 1075
437 Ga0495667_0022562 3300046559 Bacteria 4241
438 Ga0495634_0355975 3300046642 Bacteria 876
439 Ga0495647_0000571 3300046681 Bacteria 10870
440 Ga0495647_0004359 3300046681 Bacteria 4594
441 Ga0495658_0001911 3300046683 Bacteria 10634
442 Ga0495658_0124174 3300046683 Bacteria 1565
443 Ga0495669_0017826 3300046684 Bacteria 3049
444 Ga0495613_0075687 3300046689 Bacteria 2450
445 Ga0495613_0189832 3300046689 Bacteria 1452
446 Ga0495624_0011264 3300046690 Bacteria 6150
447 Ga0495624_0021028 3300046690 Bacteria 4333
448 Ga0495581_0201057 3300047315 Bacteria 1165
449 Ga0495674_0026257 3300047319 Bacteria 5331
450 Ga0495672_0000867 3300047320 Bacteria 31854
451 Ga0495684_0073355 3300047471 Bacteria 2600
452 Ga0495684_0147527 3300047471 Bacteria 1761
453 Ga0495602_0049084 3300048088 Bacteria 3784
454 Ga0495602_0309251 3300048088 Bacteria 1154
455 Ga0496101_0016917 3300048904 Bacteria 4937
456 Ga0496101_0028985 3300048904 Bacteria 3870
457 Ga0496102_0081563 3300048905 Bacteria 2982
458 Ga0496102_0393479 3300048905 Bacteria 1303
459 Ga0496103_0014284 3300048906 Bacteria 4715
460 Ga0496104_0002198 3300048907 Bacteria 16879
461 Ga0496105_0011466 3300048908 Bacteria 7003
462 Ga0496106_0003373 3300048909 Bacteria 11910
463 Ga0496106_0009402 3300048909 Bacteria 7225
464 Ga0496107_0002479 3300048910 Bacteria 11982
465 Ga0496107_0013960 3300048910 Bacteria 5620
466 Ga0496107_0327359 3300048910 Bacteria 1140
467 Ga0496108_0000421 3300048911 Bacteria 34733
468 Ga0496108_0511754 3300048911 Bacteria 1048
469 Ga0496109_0000014 3300048912 Bacteria 223246
470 Ga0496109_0009900 3300048912 Bacteria 8139
471 Ga0496110_0005127 3300048913 Bacteria 10235
472 Ga0496110_0342396 3300048913 Bacteria 1362
473 Ga0496111_0025171 3300048914 Bacteria 4198
474 Ga0496112_0037480 3300048915 Bacteria 4732
475 Ga0496113_0000833 3300048916 Bacteria 16120
476 Ga0496114_0026665 3300048917 Bacteria 4733
477 Ga0496114_0078550 3300048917 Bacteria 2784
478 Ga0496115_0016855 3300048918 Bacteria 5572
479 Ga0496115_0041518 3300048918 Bacteria 3661
480 Ga0496115_0066181 3300048918 Unclassified 2920
481 Ga0496115_0072447 3300048918 Bacteria 2796
482 Ga0496115_0170363 3300048918 Bacteria 1801
483 Ga0496126_0364437 3300048929 Bacteria 1180
484 Ga0501037_0215555 3300049573 Bacteria 1352
485 Ga0501040_0184669 3300049576 Bacteria 1479
486 Ga0501042_0140232 3300049578 Bacteria 1743
487 Ga0501047_0001736 3300049581 Bacteria 21142
488 Ga0501048_0282722 3300049582 Bacteria 1180
489 Ga0501072_0169768 3300049588 Bacteria 1741
490 Ga0501075_0033255 3300049591 Bacteria 3836
491 Ga0501076_0106213 3300049592 Bacteria 2266
492 Ga0501079_0123369 3300049741 Bacteria 2015
493 Ga0501080_0144873 3300049742 Bacteria 2196
494 Ga0501273_014903 3300049770 Bacteria 1005
495 Ga0501035_0002703 3300049822 Bacteria 17239
496 Ga0501044_0008266 3300049823 Bacteria 11412
497 nmdc:mga03n38_2395_c1 3300050490 Bacteria 5785
498 nmdc:mga00v17_104157_c1 3300050491 Bacteria 1794
499 nmdc:mga0yw44_93950_c1 3300050492 Bacteria 1900
500 nmdc:mga0k408_1676_c1 3300050493 Bacteria 11958
501 nmdc:mga06z11_14044_c1 3300050494 Bacteria 3535
502 nmdc:mga04h51_11160_c1 3300050495 Bacteria 2487
503 nmdc:mga07m45_44421_c1 3300050496 Bacteria 2494
504 nmdc:mga05p37_187057_c1 3300050507 Bacteria 2517
505 nmdc:mga05p37_19561_c1 3300050507 Bacteria 8191
506 nmdc:mga05p37_26273_c1 3300050507 Bacteria 7081
507 nmdc:mga05p37_316041_c1 3300050507 Bacteria 1850
508 nmdc:mga05p37_472808_c1 3300050507 Bacteria 1446
509 nmdc:mga05p37_83958_c1 3300050507 Bacteria 3924
510 nmdc:mga09592_14338_c1 3300050508 Bacteria 6471
511 nmdc:mga09592_255997_c1 3300050508 Bacteria 1517
512 nmdc:mga09592_59053_c1 3300050508 Bacteria 3243
513 nmdc:mga0qj67_391848_c1 3300050509 Bacteria 1121
514 nmdc:mga06r32_19019_c1 3300050510 Bacteria 6298
515 nmdc:mga06r32_401637_c1 3300050510 Bacteria 1352
516 nmdc:mga06r32_53673_c1 3300050510 Bacteria 3862
517 nmdc:mga06r32_86136_c1 3300050510 Bacteria 3064
518 nmdc:mga08y16_3121_c1 3300050511 Bacteria 17157
519 nmdc:mga08y16_57390_c1 3300050511 Bacteria 4069
520 nmdc:mga0n895_121960_c1 3300050512 Bacteria 2628
521 nmdc:mga0n895_226108_c1 3300050512 Bacteria 1899
522 nmdc:mga0n895_36987_c1 3300050512 Bacteria 4718
523 nmdc:mga0n895_6612_c1 3300050512 Bacteria 9870
524 nmdc:mga0n895_6650_c1 3300050512 Bacteria 9848
525 nmdc:mga0n895_90344_c1 3300050512 Bacteria 3064
526 nmdc:mga0n895_96039_c1 3300050512 Bacteria 2969
527 nmdc:mga0rr50_195855_c1 3300050513 Bacteria 1658
528 nmdc:mga0rr50_21378_c1 3300050513 Bacteria 4416
529 nmdc:mga0rr50_5279_c1 3300050513 Bacteria 7686
530 nmdc:mga0rr50_591027_c1 3300050513 Bacteria 946
531 nmdc:mga0rr50_79171_c1 3300050513 Bacteria 2530
532 nmdc:mga0rr50_8863_c1 3300050513 Bacteria 6283
533 nmdc:mga0rr50_90020_c1 3300050513 Bacteria 2387
534 nmdc:mga08x19_11744_c1 3300050514 Bacteria 5275
535 nmdc:mga08x19_153543_c1 3300050514 Bacteria 1560
536 nmdc:mga08x19_17238_c2 3300050514 Bacteria 1812
537 nmdc:mga08x19_26528_c1 3300050514 Bacteria 3616
538 nmdc:mga08x19_368_c1 3300050514 Bacteria 31740
539 nmdc:mga0a205_324711_c1 3300050515 Bacteria 1409
540 nmdc:mga0a205_454_c2 3300050515 Bacteria 11129
541 nmdc:mga0a205_46695_c2 3300050515 Bacteria 3482
542 nmdc:mga0a205_47321_c1 3300050515 Bacteria 4149
543 nmdc:mga0a205_56562_c1 3300050515 Bacteria 3787
544 Ga0495601_0021882 3300053077 Unclassified 3921
545 Ga0495619_0014566 3300053085 Bacteria 4967
546 Ga0495619_0239403 3300053085 Bacteria 1258
547 Ga0500641_0038548 3300053096 Bacteria 1921
548 Ga0500555_006487 3300053103 Bacteria 3325
549 Ga0501084_0063365 3300054114 Bacteria 3095
550 Ga0501084_0067638 3300054114 Bacteria 2990
551 Ga0501082_0094436 3300060353 Bacteria 2584
552 Ga0530510_0117226 3300061734 Bacteria 1953
553 Ga0530510_0170931 3300061734 Bacteria 1610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100001143 Ga0070707_1000011436 247
2 3300005546 Ga0070696_100297338 Ga0070696_1002973382 247
3 3300049770 Ga0501273_014903 Ga0501273_014903_49_816 255
4 3300025939 Ga0207665_10011617 Ga0207665_100116173 260
5 3300048088 Ga0495602_0309251 Ga0495602_0309251_343_1134 262
6 3300061734 Ga0530510_0170931 Ga0530510_0170931_25_882 263
7 3300044712 Ga0453684_0354242 Ga0453684_0354242_260_1144 264
8 3300005535 Ga0070684_100298224 Ga0070684_1002982242 265
9 3300046455 Ga0495603_0005249 Ga0495603_0005249_318_1160 265
10 3300046459 Ga0495629_0045492 Ga0495629_0045492_242_1084 265
11 3300046473 Ga0495582_0233856 Ga0495582_0233856_102_944 265
12 3300046475 Ga0495639_0003189 Ga0495639_0003189_4655_5497 265
13 3300046477 Ga0495664_0061497 Ga0495664_0061497_611_1453 265
14 3300046499 Ga0495594_0009585 Ga0495594_0009585_1908_2750 265
15 3300046517 Ga0495630_0053979 Ga0495630_0053979_1492_2334 265
16 3300046529 Ga0495652_0236736 Ga0495652_0236736_78_920 265
17 3300046535 Ga0495586_0283985 Ga0495586_0283985_82_924 265
18 3300046681 Ga0495647_0000571 Ga0495647_0000571_10015_10857 265
19 3300046683 Ga0495658_0001911 Ga0495658_0001911_5337_6179 265
20 3300046689 Ga0495613_0189832 Ga0495613_0189832_319_1161 265
21 3300046690 Ga0495624_0011264 Ga0495624_0011264_4837_5679 265
22 3300047315 Ga0495581_0201057 Ga0495581_0201057_229_1071 265
23 3300047319 Ga0495674_0026257 Ga0495674_0026257_1562_2404 265
24 3300047471 Ga0495684_0073355 Ga0495684_0073355_29_871 265
25 3300006237 Ga0097621_100024740 Ga0097621_1000247406 269
26 3300025981 Ga0207640_10011073 Ga0207640_100110734 269
27 3300005356 Ga0070674_100007275 Ga0070674_1000072754 271
28 3300005548 Ga0070665_100000839 Ga0070665_1000008398 271
29 3300005841 Ga0068863_100583484 Ga0068863_1005834841 271
30 3300006881 Ga0068865_100145856 Ga0068865_1001458562 271
31 3300009101 Ga0105247_10198061 Ga0105247_101980612 271
32 3300009147 Ga0114129_10010450 Ga0114129_100104505 271
33 3300013308 Ga0157375_10011835 Ga0157375_100118353 271
34 3300026088 Ga0207641_10563229 Ga0207641_105632292 271
35 3300028379 Ga0268266_10000072 Ga0268266_10000072124 271
36 3300049578 Ga0501042_0140232 Ga0501042_0140232_79_963 271
37 3300049591 Ga0501075_0033255 Ga0501075_0033255_1100_1984 271
38 3300049592 Ga0501076_0106213 Ga0501076_0106213_630_1514 271
39 3300050507 nmdc:mga05p37_83958_c1 nmdc:mga05p37_83958_c1_1009_1824 271
40 3300060353 Ga0501082_0094436 Ga0501082_0094436_818_1702 271
41 3300005467 Ga0070706_100023066 Ga0070706_1000230662 273
42 3300009094 Ga0111539_10485276 Ga0111539_104852762 273
43 3300009147 Ga0114129_10507224 Ga0114129_105072243 273
44 3300013296 Ga0157374_10005842 Ga0157374_100058423 273
45 3300013297 Ga0157378_10259549 Ga0157378_102595492 273
46 3300013308 Ga0157375_10040519 Ga0157375_100405195 273
47 3300014325 Ga0163163_10065313 Ga0163163_100653132 273
48 3300014969 Ga0157376_10429477 Ga0157376_104294772 273
49 3300025910 Ga0207684_10021550 Ga0207684_100215503 273
50 3300031727 Ga0316576_10016026 Ga0316576_100160263 273
51 3300031728 Ga0316578_10176765 Ga0316578_101767651 273
52 3300032139 Ga0316580_10046557 Ga0316580_100465572 273
53 3300045051 Ga0451576_0404681 Ga0451576_0404681_33_854 273
54 3300050513 nmdc:mga0rr50_79171_c1 nmdc:mga0rr50_79171_c1_28_849 273
55 3300050514 nmdc:mga08x19_153543_c1 nmdc:mga08x19_153543_c1_358_1218 274
56 3300032126 Ga0307415_100362222 Ga0307415_1003622222 275
57 3300031727 Ga0316576_10322726 Ga0316576_103227261 276
58 3300031235 Ga0265330_10034005 Ga0265330_100340053 278
59 3300031238 Ga0265332_10052365 Ga0265332_100523652 278
60 3300006852 Ga0075433_10073306 Ga0075433_100733063 279
61 3300006871 Ga0075434_100152037 Ga0075434_1001520373 279
62 3300007265 Ga0099794_10004326 Ga0099794_100043263 279
63 3300007265 Ga0099794_10006403 Ga0099794_100064034 279
64 3300007265 Ga0099794_10053034 Ga0099794_100530341 279
65 3300007265 Ga0099794_10091516 Ga0099794_100915162 279
66 3300007265 Ga0099794_10110583 Ga0099794_101105832 279
67 3300007265 Ga0099794_10155151 Ga0099794_101551512 279
68 3300009094 Ga0111539_10001388 Ga0111539_1000138810 279
69 3300009177 Ga0105248_10018800 Ga0105248_100188003 279
70 3300013297 Ga0157378_10000036 Ga0157378_1000003649 279
71 3300014968 Ga0157379_10070742 Ga0157379_100707423 279
72 3300014969 Ga0157376_10000014 Ga0157376_10000014157 279
73 3300027671 Ga0209588_1021932 Ga0209588_10219322 279
74 3300035118 Ga0373954_0048489 Ga0373954_0048489_615_1457 279
75 3300036401 Ga0373937_0114163 Ga0373937_0114163_1604_2446 279
76 3300046472 Ga0495580_0001469 Ga0495580_0001469_13176_14018 279
77 3300046472 Ga0495580_0082885 Ga0495580_0082885_67_909 279
78 3300046472 Ga0495580_0097976 Ga0495580_0097976_752_1594 279
79 3300046473 Ga0495582_0000133 Ga0495582_0000133_21709_22551 279
80 3300046543 Ga0495645_0025485 Ga0495645_0025485_1870_2712 279
81 3300046557 Ga0495622_0083172 Ga0495622_0083172_126_968 279
82 3300046557 Ga0495622_0145378 Ga0495622_0145378_108_950 279
83 3300046642 Ga0495634_0355975 Ga0495634_0355975_15_857 279
84 3300046684 Ga0495669_0017826 Ga0495669_0017826_1634_2479 279
85 3300048904 Ga0496101_0028985 Ga0496101_0028985_815_1657 279
86 3300048917 Ga0496114_0026665 Ga0496114_0026665_2202_3044 279
87 3300048917 Ga0496114_0078550 Ga0496114_0078550_174_1016 279
88 3300048918 Ga0496115_0016855 Ga0496115_0016855_968_1810 279
89 3300048918 Ga0496115_0041518 Ga0496115_0041518_1769_2611 279
90 3300050490 nmdc:mga03n38_2395_c1 nmdc:mga03n38_2395_c1_4067_4912 279
91 3300050492 nmdc:mga0yw44_93950_c1 nmdc:mga0yw44_93950_c1_333_1178 279
92 3300050493 nmdc:mga0k408_1676_c1 nmdc:mga0k408_1676_c1_6308_7153 279
93 3300050494 nmdc:mga06z11_14044_c1 nmdc:mga06z11_14044_c1_1818_2663 279
94 3300050495 nmdc:mga04h51_11160_c1 nmdc:mga04h51_11160_c1_1419_2264 279
95 3300050496 nmdc:mga07m45_44421_c1 nmdc:mga07m45_44421_c1_169_1014 279
96 3300050508 nmdc:mga09592_59053_c1 nmdc:mga09592_59053_c1_2018_2863 279
97 3300050509 nmdc:mga0qj67_391848_c1 nmdc:mga0qj67_391848_c1_115_960 279
98 3300050510 nmdc:mga06r32_19019_c1 nmdc:mga06r32_19019_c1_3064_3909 279
99 3300050511 nmdc:mga08y16_3121_c1 nmdc:mga08y16_3121_c1_225_1070 279
100 3300050512 nmdc:mga0n895_121960_c1 nmdc:mga0n895_121960_c1_178_1020 279
101 3300050512 nmdc:mga0n895_90344_c1 nmdc:mga0n895_90344_c1_1048_1908 279
102 3300050513 nmdc:mga0rr50_195855_c1 nmdc:mga0rr50_195855_c1_691_1533 279
103 3300050513 nmdc:mga0rr50_591027_c1 nmdc:mga0rr50_591027_c1_76_918 279
104 3300050513 nmdc:mga0rr50_90020_c1 nmdc:mga0rr50_90020_c1_234_1079 279
105 3300050515 nmdc:mga0a205_46695_c2 nmdc:mga0a205_46695_c2_1666_2508 279
106 3300050515 nmdc:mga0a205_47321_c1 nmdc:mga0a205_47321_c1_1569_2429 279
107 3300050515 nmdc:mga0a205_56562_c1 nmdc:mga0a205_56562_c1_1260_2105 279
108 3300053077 Ga0495601_0021882 Ga0495601_0021882_430_1272 279
109 3300005336 Ga0070680_100054189 Ga0070680_1000541893 280
110 3300005458 Ga0070681_10028869 Ga0070681_100288694 280
111 3300005530 Ga0070679_100025810 Ga0070679_1000258106 280
112 3300005578 Ga0068854_100480319 Ga0068854_1004803192 280
113 3300005617 Ga0068859_100284041 Ga0068859_1002840412 280
114 3300006931 Ga0097620_100284045 Ga0097620_1002840452 280
115 3300025912 Ga0207707_10140599 Ga0207707_101405992 280
116 3300025917 Ga0207660_10019388 Ga0207660_100193883 280
117 3300025921 Ga0207652_10024223 Ga0207652_100242232 280
118 3300031548 Ga0307408_100376555 Ga0307408_1003765552 280
119 3300031728 Ga0316578_10012890 Ga0316578_100128903 280
120 3300035398 Ga0316574_0025326 Ga0316574_0025326_1472_2317 280
121 3300036712 Ga0316584_0112213 Ga0316584_0112213_398_1243 280
122 3300045049 Ga0466959_0298506 Ga0466959_0298506_228_1073 280
123 3300048905 Ga0496102_0393479 Ga0496102_0393479_340_1185 280
124 3300048911 Ga0496108_0511754 Ga0496108_0511754_167_1012 280
125 3300005841 Ga0068863_100015467 Ga0068863_1000154674 282
126 3300026088 Ga0207641_10011070 Ga0207641_100110706 282
127 3300046516 Ga0495628_0040650 Ga0495628_0040650_1463_2311 282
128 3300049576 Ga0501040_0184669 Ga0501040_0184669_343_1191 282
129 3300053085 Ga0495619_0239403 Ga0495619_0239403_338_1186 282
130 3300005353 Ga0070669_100379915 Ga0070669_1003799152 284
131 3300005354 Ga0070675_100267735 Ga0070675_1002677352 284
132 3300005457 Ga0070662_100202935 Ga0070662_1002029353 284
133 3300005467 Ga0070706_100006762 Ga0070706_1000067622 284
134 3300005468 Ga0070707_100016724 Ga0070707_1000167244 284
135 3300005564 Ga0070664_100009476 Ga0070664_1000094762 284
136 3300005618 Ga0068864_100103542 Ga0068864_1001035422 284
137 3300005841 Ga0068863_100182735 Ga0068863_1001827353 284
138 3300005937 Ga0081455_10013309 Ga0081455_100133097 284
139 3300006852 Ga0075433_10017752 Ga0075433_100177525 284
140 3300007076 Ga0075435_100007348 Ga0075435_1000073484 284
141 3300009147 Ga0114129_10011008 Ga0114129_100110086 284
142 3300009553 Ga0105249_10624179 Ga0105249_106241792 284
143 3300025893 Ga0207682_10012908 Ga0207682_100129083 284
144 3300025910 Ga0207684_10009900 Ga0207684_100099002 284
145 3300025910 Ga0207684_10093016 Ga0207684_100930162 284
146 3300025922 Ga0207646_10017665 Ga0207646_100176657 284
147 3300025922 Ga0207646_10347852 Ga0207646_103478522 284
148 3300025923 Ga0207681_10186910 Ga0207681_101869102 284
149 3300025925 Ga0207650_10451545 Ga0207650_104515452 284
150 3300025933 Ga0207706_10225135 Ga0207706_102251353 284
151 3300025940 Ga0207691_10000409 Ga0207691_1000040910 284
152 3300025945 Ga0207679_10443237 Ga0207679_104432371 284
153 3300026067 Ga0207678_10169721 Ga0207678_101697212 284
154 3300026075 Ga0207708_10361042 Ga0207708_103610421 284
155 3300026088 Ga0207641_10106082 Ga0207641_101060822 284
156 3300026095 Ga0207676_10084854 Ga0207676_100848542 284
157 3300026118 Ga0207675_100029288 Ga0207675_1000292881 284
158 3300027526 Ga0209968_1004661 Ga0209968_10046612 284
159 3300027543 Ga0209999_1003031 Ga0209999_10030313 284
160 3300027614 Ga0209970_1006981 Ga0209970_10069813 284
161 3300027665 Ga0209983_1003468 Ga0209983_10034683 284
162 3300027682 Ga0209971_1000763 Ga0209971_10007634 284
163 3300027695 Ga0209966_1017041 Ga0209966_10170412 284
164 3300027717 Ga0209998_10004780 Ga0209998_100047802 284
165 3300027876 Ga0209974_10001348 Ga0209974_100013489 284
166 3300028380 Ga0268265_10197900 Ga0268265_101979003 284
167 3300031548 Ga0307408_100032553 Ga0307408_1000325533 284
168 3300031824 Ga0307413_10005986 Ga0307413_100059866 284
169 3300031852 Ga0307410_10002774 Ga0307410_100027745 284
170 3300031995 Ga0307409_100101207 Ga0307409_1001012072 284
171 3300032004 Ga0307414_10001731 Ga0307414_100017317 284
172 3300032005 Ga0307411_10002621 Ga0307411_100026218 284
173 3300032126 Ga0307415_100006034 Ga0307415_1000060346 284
174 3300042876 Ga0451577_0209774 Ga0451577_0209774_877_1731 284
175 3300044673 Ga0453683_0152853 Ga0453683_0152853_170_1024 284
176 3300046683 Ga0495658_0124174 Ga0495658_0124174_146_1000 284
177 3300049582 Ga0501048_0282722 Ga0501048_0282722_170_1024 284
178 3300049588 Ga0501072_0169768 Ga0501072_0169768_589_1443 284
179 3300050507 nmdc:mga05p37_472808_c1 nmdc:mga05p37_472808_c1_247_1101 284
180 3300050510 nmdc:mga06r32_401637_c1 nmdc:mga06r32_401637_c1_441_1337 284
181 3300050512 nmdc:mga0n895_36987_c1 nmdc:mga0n895_36987_c1_2319_3173 284
182 3300050513 nmdc:mga0rr50_8863_c1 nmdc:mga0rr50_8863_c1_4039_4893 284
183 3300050515 nmdc:mga0a205_454_c2 nmdc:mga0a205_454_c2_1737_2591 284
184 3300005518 Ga0070699_100171141 Ga0070699_1001711412 285
185 3300006847 Ga0075431_100116286 Ga0075431_1001162862 285
186 3300006847 Ga0075431_100400646 Ga0075431_1004006461 285
187 3300006847 Ga0075431_100426606 Ga0075431_1004266062 285
188 3300006871 Ga0075434_100129016 Ga0075434_1001290163 285
189 3300027907 Ga0207428_10003072 Ga0207428_1000307215 285
190 3300030760 Ga0265762_1017168 Ga0265762_10171681 285
191 3300050507 nmdc:mga05p37_19561_c1 nmdc:mga05p37_19561_c1_4201_5094 285
192 3300050508 nmdc:mga09592_255997_c1 nmdc:mga09592_255997_c1_603_1496 285
193 3300050510 nmdc:mga06r32_53673_c1 nmdc:mga06r32_53673_c1_2104_3000 285
194 3300050511 nmdc:mga08y16_57390_c1 nmdc:mga08y16_57390_c1_2955_3848 285
195 3300050512 nmdc:mga0n895_226108_c1 nmdc:mga0n895_226108_c1_829_1755 285
196 3300050512 nmdc:mga0n895_96039_c1 nmdc:mga0n895_96039_c1_943_1839 285
197 3300050515 nmdc:mga0a205_324711_c1 nmdc:mga0a205_324711_c1_495_1391 285
198 3300054114 Ga0501084_0063365 Ga0501084_0063365_1837_2763 285
199 3300005330 Ga0070690_100000276 Ga0070690_1000002762 286
200 3300005331 Ga0070670_100570542 Ga0070670_1005705421 286
201 3300005338 Ga0068868_100110149 Ga0068868_1001101493 286
202 3300005340 Ga0070689_100053558 Ga0070689_1000535582 286
203 3300005340 Ga0070689_100200598 Ga0070689_1002005982 286
204 3300005343 Ga0070687_100180455 Ga0070687_1001804551 286
205 3300005354 Ga0070675_100092611 Ga0070675_1000926113 286
206 3300005367 Ga0070667_100000353 Ga0070667_1000003534 286
207 3300005367 Ga0070667_100302501 Ga0070667_1003025011 286
208 3300005441 Ga0070700_100415918 Ga0070700_1004159181 286
209 3300005459 Ga0068867_100030036 Ga0068867_1000300362 286
210 3300005467 Ga0070706_100419679 Ga0070706_1004196792 286
211 3300005468 Ga0070707_100536477 Ga0070707_1005364771 286
212 3300005539 Ga0068853_100530954 Ga0068853_1005309541 286
213 3300005543 Ga0070672_100160121 Ga0070672_1001601213 286
214 3300005547 Ga0070693_100207211 Ga0070693_1002072111 286
215 3300005548 Ga0070665_100000658 Ga0070665_1000006589 286
216 3300005548 Ga0070665_100032232 Ga0070665_1000322324 286
217 3300005548 Ga0070665_100056292 Ga0070665_1000562924 286
218 3300005614 Ga0068856_100000928 Ga0068856_10000092814 286
219 3300005615 Ga0070702_100001628 Ga0070702_1000016283 286
220 3300005617 Ga0068859_100002971 Ga0068859_1000029714 286
221 3300005617 Ga0068859_100391951 Ga0068859_1003919512 286
222 3300005618 Ga0068864_100080757 Ga0068864_1000807573 286
223 3300005718 Ga0068866_10016469 Ga0068866_100164692 286
224 3300005842 Ga0068858_100034221 Ga0068858_1000342214 286
225 3300006844 Ga0075428_100712893 Ga0075428_1007128931 286
226 3300006931 Ga0097620_100002971 Ga0097620_1000029714 286
227 3300006931 Ga0097620_100391976 Ga0097620_1003919762 286
228 3300009148 Ga0105243_10099317 Ga0105243_100993173 286
229 3300009177 Ga0105248_10003273 Ga0105248_100032731 286
230 3300013308 Ga0157375_10000609 Ga0157375_1000060921 286
231 3300014968 Ga0157379_10002767 Ga0157379_100027678 286
232 3300025899 Ga0207642_10015222 Ga0207642_100152223 286
233 3300025903 Ga0207680_10066862 Ga0207680_100668623 286
234 3300025910 Ga0207684_10139166 Ga0207684_101391663 286
235 3300025910 Ga0207684_10358053 Ga0207684_103580532 286
236 3300025922 Ga0207646_10496546 Ga0207646_104965462 286
237 3300025926 Ga0207659_10063806 Ga0207659_100638062 286
238 3300025931 Ga0207644_10235796 Ga0207644_102357962 286
239 3300025936 Ga0207670_10009573 Ga0207670_100095734 286
240 3300025940 Ga0207691_10019670 Ga0207691_100196703 286
241 3300025940 Ga0207691_10090520 Ga0207691_100905203 286
242 3300025960 Ga0207651_10027411 Ga0207651_100274113 286
243 3300025960 Ga0207651_10078782 Ga0207651_100787823 286
244 3300025986 Ga0207658_10010761 Ga0207658_100107613 286
245 3300026035 Ga0207703_10006881 Ga0207703_100068817 286
246 3300026088 Ga0207641_10056430 Ga0207641_100564302 286
247 3300026088 Ga0207641_10090278 Ga0207641_100902783 286
248 3300026089 Ga0207648_10028168 Ga0207648_100281683 286
249 3300026095 Ga0207676_10136229 Ga0207676_101362292 286
250 3300026121 Ga0207683_10013111 Ga0207683_100131114 286
251 3300028379 Ga0268266_10001041 Ga0268266_1000104126 286
252 3300028379 Ga0268266_10026583 Ga0268266_100265833 286
253 3300028381 Ga0268264_10001283 Ga0268264_1000128321 286
254 3300031824 Ga0307413_10002445 Ga0307413_100024452 286
255 3300035725 Ga0373947_0198233 Ga0373947_0198233_431_1291 286
256 3300036401 Ga0373937_0621239 Ga0373937_0621239_98_958 286
257 3300037068 Ga0373925_0224172 Ga0373925_0224172_262_1122 286
258 3300046472 Ga0495580_0007702 Ga0495580_0007702_48_908 286
259 3300046681 Ga0495647_0004359 Ga0495647_0004359_2785_3645 286
260 3300048088 Ga0495602_0049084 Ga0495602_0049084_1675_2535 286
261 3300048909 Ga0496106_0003373 Ga0496106_0003373_2746_3606 286
262 3300048910 Ga0496107_0002479 Ga0496107_0002479_8274_9134 286
263 3300048912 Ga0496109_0000014 Ga0496109_0000014_80397_81293 286
264 3300005518 Ga0070699_100234149 Ga0070699_1002341492 287
265 3300049742 Ga0501080_0144873 Ga0501080_0144873_1052_1939 288
266 3300005436 Ga0070713_100579299 Ga0070713_1005792991 289
267 3300005468 Ga0070707_100013990 Ga0070707_1000139902 289
268 3300025922 Ga0207646_10026600 Ga0207646_100266003 289
269 3300025903 Ga0207680_10179804 Ga0207680_101798042 290
270 3300042876 Ga0451577_0055340 Ga0451577_0055340_2030_2917 290
271 3300044673 Ga0453683_0028239 Ga0453683_0028239_1325_2212 290
272 3300044712 Ga0453684_0000949 Ga0453684_0000949_24992_25879 290
273 3300005436 Ga0070713_100278959 Ga0070713_1002789592 291
274 3300025928 Ga0207700_10183543 Ga0207700_101835432 291
275 3300046472 Ga0495580_0187500 Ga0495580_0187500_231_1106 291
276 3300003203 JGI25406J46586_10006466 JGI25406J46586_100064664 292
277 3300005330 Ga0070690_100078395 Ga0070690_1000783953 292
278 3300005334 Ga0068869_100007471 Ga0068869_1000074714 292
279 3300005336 Ga0070680_100039672 Ga0070680_1000396725 292
280 3300005340 Ga0070689_100015906 Ga0070689_1000159063 292
281 3300005356 Ga0070674_100030059 Ga0070674_1000300592 292
282 3300005365 Ga0070688_100004213 Ga0070688_1000042134 292
283 3300005367 Ga0070667_100036591 Ga0070667_1000365915 292
284 3300005406 Ga0070703_10045154 Ga0070703_100451541 292
285 3300005434 Ga0070709_10005981 Ga0070709_100059818 292
286 3300005434 Ga0070709_10056040 Ga0070709_100560402 292
287 3300005434 Ga0070709_10089594 Ga0070709_100895943 292
288 3300005434 Ga0070709_10134301 Ga0070709_101343011 292
289 3300005436 Ga0070713_100190432 Ga0070713_1001904322 292
290 3300005436 Ga0070713_100252948 Ga0070713_1002529482 292
291 3300005438 Ga0070701_10010645 Ga0070701_100106453 292
292 3300005440 Ga0070705_100005296 Ga0070705_1000052965 292
293 3300005440 Ga0070705_100046942 Ga0070705_1000469421 292
294 3300005444 Ga0070694_100001777 Ga0070694_1000017779 292
295 3300005445 Ga0070708_100012993 Ga0070708_1000129933 292
296 3300005445 Ga0070708_100040176 Ga0070708_1000401763 292
297 3300005445 Ga0070708_100090517 Ga0070708_1000905171 292
298 3300005445 Ga0070708_100481972 Ga0070708_1004819722 292
299 3300005459 Ga0068867_100002159 Ga0068867_1000021598 292
300 3300005466 Ga0070685_10017901 Ga0070685_100179014 292
301 3300005467 Ga0070706_100004756 Ga0070706_1000047568 292
302 3300005467 Ga0070706_100187038 Ga0070706_1001870382 292
303 3300005468 Ga0070707_100000001 Ga0070707_100000001121 292
304 3300005468 Ga0070707_100002126 Ga0070707_10000212610 292
305 3300005468 Ga0070707_100013153 Ga0070707_1000131533 292
306 3300005468 Ga0070707_100038754 Ga0070707_1000387545 292
307 3300005468 Ga0070707_100082269 Ga0070707_1000822693 292
308 3300005468 Ga0070707_100098592 Ga0070707_1000985922 292
309 3300005468 Ga0070707_100125656 Ga0070707_1001256562 292
310 3300005468 Ga0070707_100231815 Ga0070707_1002318151 292
311 3300005468 Ga0070707_100366367 Ga0070707_1003663672 292
312 3300005471 Ga0070698_100001135 Ga0070698_1000011356 292
313 3300005471 Ga0070698_100002968 Ga0070698_10000296810 292
314 3300005518 Ga0070699_100047804 Ga0070699_1000478043 292
315 3300005518 Ga0070699_100048781 Ga0070699_1000487815 292
316 3300005530 Ga0070679_100001897 Ga0070679_10000189710 292
317 3300005536 Ga0070697_100000403 Ga0070697_10000040319 292
318 3300005536 Ga0070697_100015078 Ga0070697_1000150783 292
319 3300005536 Ga0070697_100060718 Ga0070697_1000607182 292
320 3300005536 Ga0070697_100142933 Ga0070697_1001429332 292
321 3300005536 Ga0070697_100435162 Ga0070697_1004351621 292
322 3300005544 Ga0070686_100011909 Ga0070686_1000119093 292
323 3300005546 Ga0070696_100000608 Ga0070696_10000060810 292
324 3300005547 Ga0070693_100000074 Ga0070693_10000007423 292
325 3300005549 Ga0070704_100007133 Ga0070704_1000071336 292
326 3300005549 Ga0070704_100135795 Ga0070704_1001357952 292
327 3300005617 Ga0068859_100876116 Ga0068859_1008761161 292
328 3300005842 Ga0068858_100054235 Ga0068858_1000542353 292
329 3300005842 Ga0068858_100156986 Ga0068858_1001569862 292
330 3300005843 Ga0068860_100002166 Ga0068860_1000021665 292
331 3300005843 Ga0068860_100036262 Ga0068860_1000362625 292
332 3300005843 Ga0068860_100198206 Ga0068860_1001982063 292
333 3300005843 Ga0068860_100546792 Ga0068860_1005467921 292
334 3300005844 Ga0068862_100127571 Ga0068862_1001275713 292
335 3300005937 Ga0081455_10013931 Ga0081455_100139314 292
336 3300006028 Ga0070717_10310785 Ga0070717_103107852 292
337 3300006051 Ga0075364_10015566 Ga0075364_100155662 292
338 3300006173 Ga0070716_100000189 Ga0070716_10000018918 292
339 3300006173 Ga0070716_100000320 Ga0070716_10000032013 292
340 3300006173 Ga0070716_100009017 Ga0070716_1000090174 292
341 3300006173 Ga0070716_100034851 Ga0070716_1000348512 292
342 3300006173 Ga0070716_100063585 Ga0070716_1000635851 292
343 3300006173 Ga0070716_100166862 Ga0070716_1001668622 292
344 3300006175 Ga0070712_100199425 Ga0070712_1001994252 292
345 3300006177 Ga0075362_10045515 Ga0075362_100455152 292
346 3300006237 Ga0097621_100016224 Ga0097621_1000162247 292
347 3300006358 Ga0068871_100003158 Ga0068871_1000031586 292
348 3300006847 Ga0075431_100008888 Ga0075431_1000088888 292
349 3300006871 Ga0075434_100026154 Ga0075434_1000261547 292
350 3300006871 Ga0075434_100112924 Ga0075434_1001129243 292
351 3300006881 Ga0068865_100165984 Ga0068865_1001659842 292
352 3300006914 Ga0075436_100006260 Ga0075436_1000062604 292
353 3300006914 Ga0075436_100006469 Ga0075436_1000064698 292
354 3300006914 Ga0075436_100048209 Ga0075436_1000482092 292
355 3300006931 Ga0097620_100876361 Ga0097620_1008763611 292
356 3300007076 Ga0075435_100004576 Ga0075435_1000045762 292
357 3300007076 Ga0075435_100015970 Ga0075435_1000159702 292
358 3300007076 Ga0075435_100088718 Ga0075435_1000887181 292
359 3300007076 Ga0075435_100341780 Ga0075435_1003417802 292
360 3300007265 Ga0099794_10002036 Ga0099794_100020363 292
361 3300007265 Ga0099794_10022013 Ga0099794_100220132 292
362 3300007788 Ga0099795_10000569 Ga0099795_100005698 292
363 3300009101 Ga0105247_10206340 Ga0105247_102063401 292
364 3300009147 Ga0114129_10247941 Ga0114129_102479412 292
365 3300009147 Ga0114129_10938595 Ga0114129_109385951 292
366 3300009176 Ga0105242_10008603 Ga0105242_100086036 292
367 3300009176 Ga0105242_10069178 Ga0105242_100691782 292
368 3300009545 Ga0105237_10202801 Ga0105237_102028012 292
369 3300009545 Ga0105237_10337771 Ga0105237_103377712 292
370 3300010159 Ga0099796_10008296 Ga0099796_100082963 292
371 3300013297 Ga0157378_10194334 Ga0157378_101943342 292
372 3300013306 Ga0163162_10084033 Ga0163162_100840331 292
373 3300013307 Ga0157372_10121963 Ga0157372_101219632 292
374 3300013308 Ga0157375_10037675 Ga0157375_100376756 292
375 3300013308 Ga0157375_10295389 Ga0157375_102953892 292
376 3300014968 Ga0157379_10034203 Ga0157379_100342035 292
377 3300017792 Ga0163161_10124210 Ga0163161_101242102 292
378 3300021384 Ga0213876_10000038 Ga0213876_10000038115 292
379 3300021384 Ga0213876_10000098 Ga0213876_1000009828 292
380 3300021384 Ga0213876_10041013 Ga0213876_100410132 292
381 3300024227 Ga0228598_1000836 Ga0228598_10008364 292
382 3300025885 Ga0207653_10003301 Ga0207653_100033016 292
383 3300025899 Ga0207642_10126499 Ga0207642_101264992 292
384 3300025900 Ga0207710_10122670 Ga0207710_101226702 292
385 3300025901 Ga0207688_10076773 Ga0207688_100767732 292
386 3300025906 Ga0207699_10037015 Ga0207699_100370152 292
387 3300025910 Ga0207684_10007386 Ga0207684_100073863 292
388 3300025910 Ga0207684_10065683 Ga0207684_100656832 292
389 3300025910 Ga0207684_10274859 Ga0207684_102748592 292
390 3300025912 Ga0207707_10101225 Ga0207707_101012252 292
391 3300025914 Ga0207671_10231249 Ga0207671_102312492 292
392 3300025915 Ga0207693_10014041 Ga0207693_100140417 292
393 3300025916 Ga0207663_10048983 Ga0207663_100489833 292
394 3300025916 Ga0207663_10471593 Ga0207663_104715931 292
395 3300025917 Ga0207660_10157197 Ga0207660_101571972 292
396 3300025921 Ga0207652_10087328 Ga0207652_100873282 292
397 3300025922 Ga0207646_10000029 Ga0207646_1000002981 292
398 3300025922 Ga0207646_10000054 Ga0207646_1000005416 292
399 3300025922 Ga0207646_10000458 Ga0207646_1000045843 292
400 3300025922 Ga0207646_10005722 Ga0207646_100057224 292
401 3300025922 Ga0207646_10092291 Ga0207646_100922912 292
402 3300025922 Ga0207646_10119807 Ga0207646_101198071 292
403 3300025922 Ga0207646_10206946 Ga0207646_102069462 292
404 3300025922 Ga0207646_10390733 Ga0207646_103907331 292
405 3300025928 Ga0207700_10248472 Ga0207700_102484721 292
406 3300025928 Ga0207700_10357120 Ga0207700_103571201 292
407 3300025937 Ga0207669_10013292 Ga0207669_100132923 292
408 3300025939 Ga0207665_10000028 Ga0207665_1000002834 292
409 3300025939 Ga0207665_10000784 Ga0207665_1000078418 292
410 3300025939 Ga0207665_10016803 Ga0207665_100168033 292
411 3300025939 Ga0207665_10053829 Ga0207665_100538293 292
412 3300025939 Ga0207665_10081618 Ga0207665_100816183 292
413 3300025942 Ga0207689_10022106 Ga0207689_100221064 292
414 3300025942 Ga0207689_10075192 Ga0207689_100751922 292
415 3300025960 Ga0207651_10453193 Ga0207651_104531932 292
416 3300025981 Ga0207640_10358030 Ga0207640_103580302 292
417 3300025986 Ga0207658_10023918 Ga0207658_100239185 292
418 3300026035 Ga0207703_10081955 Ga0207703_100819552 292
419 3300026035 Ga0207703_10532231 Ga0207703_105322312 292
420 3300026067 Ga0207678_10056009 Ga0207678_100560093 292
421 3300026075 Ga0207708_10068543 Ga0207708_100685432 292
422 3300026088 Ga0207641_10000946 Ga0207641_1000094617 292
423 3300026089 Ga0207648_10001084 Ga0207648_100010846 292
424 3300026095 Ga0207676_10126686 Ga0207676_101266863 292
425 3300026116 Ga0207674_10119505 Ga0207674_101195053 292
426 3300027671 Ga0209588_1000932 Ga0209588_10009326 292
427 3300027671 Ga0209588_1001252 Ga0209588_10012524 292
428 3300027671 Ga0209588_1002246 Ga0209588_10022466 292
429 3300027671 Ga0209588_1011359 Ga0209588_10113592 292
430 3300027671 Ga0209588_1021546 Ga0209588_10215462 292
431 3300027671 Ga0209588_1046538 Ga0209588_10465382 292
432 3300028016 Ga0265354_1000207 Ga0265354_100020710 292
433 3300028016 Ga0265354_1001426 Ga0265354_10014262 292
434 3300028023 Ga0265357_1000861 Ga0265357_10008612 292
435 3300028380 Ga0268265_10030499 Ga0268265_100304992 292
436 3300028381 Ga0268264_10200213 Ga0268264_102002132 292
437 3300028381 Ga0268264_10624389 Ga0268264_106243892 292
438 3300028800 Ga0265338_10045431 Ga0265338_100454313 292
439 3300028800 Ga0265338_10048786 Ga0265338_100487864 292
440 3300030878 Ga0265770_1004829 Ga0265770_10048292 292
441 3300031090 Ga0265760_10003849 Ga0265760_100038491 292
442 3300031090 Ga0265760_10016896 Ga0265760_100168962 292
443 3300035083 Ga0373926_0009384 Ga0373926_0009384_1059_1940 292
444 3300035170 Ga0373943_0044447 Ga0373943_0044447_669_1550 292
445 3300035171 Ga0373946_0019783 Ga0373946_0019783_939_1820 292
446 3300035691 Ga0373931_0120969 Ga0373931_0120969_489_1370 292
447 3300035692 Ga0373935_0095559 Ga0373935_0095559_44_925 292
448 3300035695 Ga0373927_0000114 Ga0373927_0000114_46946_47827 292
449 3300037068 Ga0373925_0000115 Ga0373925_0000115_60728_61609 292
450 3300039437 Ga0436365_1023949 Ga0436365_1023949_86617_87507 292
451 3300039437 Ga0436365_1292890 Ga0436365_1292890_2616_3497 292
452 3300042876 Ga0451577_0083721 Ga0451577_0083721_913_1797 292
453 3300042876 Ga0451577_0153228 Ga0451577_0153228_245_1129 292
454 3300044673 Ga0453683_0001795 Ga0453683_0001795_2326_3210 292
455 3300044712 Ga0453684_0122859 Ga0453684_0122859_1393_2277 292
456 3300044712 Ga0453684_0478731 Ga0453684_0478731_424_1308 292
457 3300045051 Ga0451576_0059087 Ga0451576_0059087_2907_3791 292
458 3300046473 Ga0495582_0054228 Ga0495582_0054228_134_1018 292
459 3300046514 Ga0495618_0112127 Ga0495618_0112127_710_1591 292
460 3300046516 Ga0495628_0371134 Ga0495628_0371134_105_986 292
461 3300046517 Ga0495630_0020202 Ga0495630_0020202_919_1800 292
462 3300046689 Ga0495613_0075687 Ga0495613_0075687_1415_2299 292
463 3300046690 Ga0495624_0021028 Ga0495624_0021028_1199_2080 292
464 3300047471 Ga0495684_0147527 Ga0495684_0147527_759_1640 292
465 3300048905 Ga0496102_0081563 Ga0496102_0081563_162_1127 292
466 3300048910 Ga0496107_0327359 Ga0496107_0327359_23_988 292
467 3300048918 Ga0496115_0170363 Ga0496115_0170363_266_1147 292
468 3300048929 Ga0496126_0364437 Ga0496126_0364437_177_1058 292
469 3300050491 nmdc:mga00v17_104157_c1 nmdc:mga00v17_104157_c1_116_1000 292
470 3300050507 nmdc:mga05p37_187057_c1 nmdc:mga05p37_187057_c1_1544_2428 292
471 3300050510 nmdc:mga06r32_86136_c1 nmdc:mga06r32_86136_c1_1852_2730 292
472 3300050512 nmdc:mga0n895_6650_c1 nmdc:mga0n895_6650_c1_6365_7246 292
473 3300050513 nmdc:mga0rr50_21378_c1 nmdc:mga0rr50_21378_c1_429_1310 292
474 3300050513 nmdc:mga0rr50_5279_c1 nmdc:mga0rr50_5279_c1_995_1888 292
475 3300050514 nmdc:mga08x19_11744_c1 nmdc:mga08x19_11744_c1_1523_2434 292
476 3300050514 nmdc:mga08x19_368_c1 nmdc:mga08x19_368_c1_10509_11390 292
477 3300053085 Ga0495619_0014566 Ga0495619_0014566_2687_3568 292
478 3300053096 Ga0500641_0038548 Ga0500641_0038548_643_1539 292
479 3300053103 Ga0500555_006487 Ga0500555_006487_1060_1956 292
480 3300006844 Ga0075428_100033867 Ga0075428_1000338676 293
481 3300009094 Ga0111539_10266696 Ga0111539_102666961 293
482 3300031733 Ga0316577_10010197 Ga0316577_100101976 293
483 3300047320 Ga0495672_0000867 Ga0495672_0000867_1262_2149 293
484 3300048913 Ga0496110_0342396 Ga0496110_0342396_293_1177 293
485 3300049573 Ga0501037_0215555 Ga0501037_0215555_408_1289 293
486 3300061734 Ga0530510_0117226 Ga0530510_0117226_944_1837 293
487 3300005434 Ga0070709_10001767 Ga0070709_100017677 294
488 3300005435 Ga0070714_100185587 Ga0070714_1001855872 294
489 3300005536 Ga0070697_100013629 Ga0070697_1000136295 294
490 3300005546 Ga0070696_100035947 Ga0070696_1000359474 294
491 3300006042 Ga0075368_10009666 Ga0075368_100096662 294
492 3300006178 Ga0075367_10000762 Ga0075367_1000076211 294
493 3300006195 Ga0075366_10078502 Ga0075366_100785023 294
494 3300006353 Ga0075370_10047072 Ga0075370_100470722 294
495 3300006844 Ga0075428_100198204 Ga0075428_1001982042 294
496 3300006880 Ga0075429_100120979 Ga0075429_1001209792 294
497 3300006914 Ga0075436_100000274 Ga0075436_10000027412 294
498 3300025906 Ga0207699_10001100 Ga0207699_100011006 294
499 3300025939 Ga0207665_10003840 Ga0207665_100038405 294
500 3300026118 Ga0207675_100013317 Ga0207675_1000133178 294
501 3300027866 Ga0209813_10009530 Ga0209813_100095302 294
502 3300027907 Ga0207428_10000085 Ga0207428_1000008564 294
503 3300028380 Ga0268265_10187696 Ga0268265_101876962 294
504 3300032002 Ga0307416_100254955 Ga0307416_1002549553 294
505 3300046559 Ga0495667_0022562 Ga0495667_0022562_2318_3205 294
506 3300049581 Ga0501047_0001736 Ga0501047_0001736_13572_14459 294
507 3300049741 Ga0501079_0123369 Ga0501079_0123369_1103_1990 294
508 3300049822 Ga0501035_0002703 Ga0501035_0002703_13355_14242 294
509 3300049823 Ga0501044_0008266 Ga0501044_0008266_10458_11345 294
510 3300050514 nmdc:mga08x19_26528_c1 nmdc:mga08x19_26528_c1_1888_2775 294
511 3300054114 Ga0501084_0067638 Ga0501084_0067638_2018_2905 294
512 2162886012 MBSR1b_contig_9220216 MBSR1b_0013.00003670 295
513 3300005293 Ga0065715_10091628 Ga0065715_100916284 295
514 3300005328 Ga0070676_10241282 Ga0070676_102412821 295
515 3300005334 Ga0068869_100323215 Ga0068869_1003232152 295
516 3300005444 Ga0070694_100046120 Ga0070694_1000461203 295
517 3300005546 Ga0070696_100042774 Ga0070696_1000427743 295
518 3300005719 Ga0068861_100003557 Ga0068861_1000035572 295
519 3300005842 Ga0068858_100162140 Ga0068858_1001621401 295
520 3300006844 Ga0075428_100012452 Ga0075428_1000124523 295
521 3300006852 Ga0075433_10054549 Ga0075433_100545493 295
522 3300006871 Ga0075434_100015558 Ga0075434_1000155584 295
523 3300006880 Ga0075429_100023165 Ga0075429_1000231655 295
524 3300006914 Ga0075436_100004772 Ga0075436_1000047725 295
525 3300009147 Ga0114129_10000596 Ga0114129_100005966 295
526 3300009147 Ga0114129_10129049 Ga0114129_101290492 295
527 3300010375 Ga0105239_10031713 Ga0105239_100317135 295
528 3300013306 Ga0163162_10619478 Ga0163162_106194781 295
529 3300025933 Ga0207706_10091656 Ga0207706_100916562 295
530 3300025936 Ga0207670_10157194 Ga0207670_101571942 295
531 3300025949 Ga0207667_10418748 Ga0207667_104187482 295
532 3300026067 Ga0207678_10457373 Ga0207678_104573731 295
533 3300026118 Ga0207675_100003518 Ga0207675_10000351814 295
534 3300042005 Ga0439448_0004832 Ga0439448_0004832_2682_3569 295
535 3300048904 Ga0496101_0016917 Ga0496101_0016917_450_1337 295
536 3300048906 Ga0496103_0014284 Ga0496103_0014284_3098_3985 295
537 3300048907 Ga0496104_0002198 Ga0496104_0002198_620_1507 295
538 3300048908 Ga0496105_0011466 Ga0496105_0011466_3706_4593 295
539 3300048909 Ga0496106_0009402 Ga0496106_0009402_3186_4073 295
540 3300048910 Ga0496107_0013960 Ga0496107_0013960_1387_2274 295
541 3300048911 Ga0496108_0000421 Ga0496108_0000421_23061_23948 295
542 3300048912 Ga0496109_0009900 Ga0496109_0009900_4551_5438 295
543 3300048913 Ga0496110_0005127 Ga0496110_0005127_1309_2196 295
544 3300048914 Ga0496111_0025171 Ga0496111_0025171_841_1728 295
545 3300048915 Ga0496112_0037480 Ga0496112_0037480_3199_4086 295
546 3300048916 Ga0496113_0000833 Ga0496113_0000833_5581_6468 295
547 3300048918 Ga0496115_0066181 Ga0496115_0066181_1809_2696 295
548 3300048918 Ga0496115_0072447 Ga0496115_0072447_1470_2360 295
549 3300050507 nmdc:mga05p37_26273_c1 nmdc:mga05p37_26273_c1_3969_4856 295
550 3300050507 nmdc:mga05p37_316041_c1 nmdc:mga05p37_316041_c1_169_1056 295
551 3300050508 nmdc:mga09592_14338_c1 nmdc:mga09592_14338_c1_2454_3341 295
552 3300050512 nmdc:mga0n895_6612_c1 nmdc:mga0n895_6612_c1_7284_8171 295
553 3300050514 nmdc:mga08x19_17238_c2 nmdc:mga08x19_17238_c2_42_929 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

215

311

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

34

213

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 1.003 6 36
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9995 6 37
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9943 5 36
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9882 5 36
4r1n-assembly1.cif.gz_A crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum. 0.9843 5 286
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.004 6 37 3.50.50.60
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.001 7 34 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9989 8 36 3.50.50.60
6hrdD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9886 196 280 1.10.1040.10
af_Q8S1G9_1_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9875 1 190 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E0NCF5-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9944 3 189 GO:0006631
GO:0008691
GO:0070403
AF-A0A838RAU8-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9932 2 294 GO:0006635
GO:0008691
GO:0070403
AF-A0A832IXK0-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9927 3 202 GO:0006631
GO:0016491
GO:0070403
AF-A0A7C7KJB8-F1-model_v4 LTD domain-containing protein 0.992 3 195 GO:0006631
GO:0016491
GO:0070403
AF-A0A2E0NCF5-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9891 3 189 GO:0006631
GO:0008691
GO:0070403

Feature Viewer

pLDDT pTM Quality
95.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map