F462817

General Info

Members Datasets Scaffolds Average Seq Length
553 248 553 166

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10084601|Ga0065704_100846012
Length 165
Sequence MSNRLKVILLALIVVVGAAWYAFRPDRIFTNQRVNEQFPTASAAMSTQLAAGEFHSGAHETKGTATVFQLADGKKTLRLTNFATSNGPDVHVYLVAATDAKDNAVTNAGFVDLGSLKGNIGDQNYELPANADLAKYRAVTIWCKRFSVNFGTAPLNSAMQSMNVQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
178 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
179 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
180 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
181 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
185 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
201 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
202 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
203 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
210 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
211 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
212 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
218 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
221 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
222 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
229 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
230 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
231 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
235 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
238 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
242 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 7.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.99
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2076090 2162886007 Unclassified 2981
2 JGI24736J21556_1008527 3300001904 Bacteria 1703
3 JGI24751J29686_10000179 3300002459 Bacteria 29149
4 JGI25406J46586_10017735 3300003203 Bacteria 2937
5 JGI25406J46586_10041338 3300003203 Bacteria 1624
6 rootH2_10242219 3300003320 Bacteria 1134
7 Ga0065714_10064440 3300005288 Bacteria 109986
8 Ga0065704_10084601 3300005289 Unclassified 3316
9 Ga0065704_10369489 3300005289 Bacteria 772
10 Ga0065712_10000120 3300005290 Bacteria 105792
11 Ga0065712_10032263 3300005290 Bacteria 1440
12 Ga0065712_10080463 3300005290 Bacteria 3103
13 Ga0065712_10235170 3300005290 Bacteria 1000
14 Ga0065712_10266639 3300005290 Bacteria 918
15 Ga0065712_10461956 3300005290 Bacteria 677
16 Ga0065715_10045410 3300005293 Bacteria 1310
17 Ga0065715_10090220 3300005293 Bacteria 7427
18 Ga0065715_10091105 3300005293 Bacteria 6105
19 Ga0065715_10096605 3300005293 Bacteria 3850
20 Ga0065715_10109897 3300005293 Bacteria 2646
21 Ga0065715_10352974 3300005293 Unclassified 928
22 Ga0065715_10434764 3300005293 Bacteria 810
23 Ga0065715_10493834 3300005293 Bacteria 786
24 Ga0065707_10003499 3300005295 Bacteria 5998
25 Ga0065707_10110990 3300005295 Bacteria 2401
26 Ga0070676_10651264 3300005328 Bacteria 765
27 Ga0070670_100000188 3300005331 Bacteria 56512
28 Ga0070670_100067788 3300005331 Bacteria 3062
29 Ga0068869_100214069 3300005334 Bacteria 1525
30 Ga0068869_100306854 3300005334 Bacteria 1283
31 Ga0068869_100571872 3300005334 Bacteria 952
32 Ga0068869_101254875 3300005334 Bacteria 653
33 Ga0070666_11159879 3300005335 Unclassified 575
34 Ga0070680_100105569 3300005336 Bacteria 2341
35 Ga0070682_100006213 3300005337 Bacteria 6695
36 Ga0070682_100563575 3300005337 Bacteria 893
37 Ga0068868_100548998 3300005338 Bacteria 1018
38 Ga0070687_100574065 3300005343 Unclassified 771
39 Ga0070687_100713555 3300005343 Unclassified 702
40 Ga0070661_100037957 3300005344 Bacteria 3506
41 Ga0070661_100760467 3300005344 Bacteria 793
42 Ga0070692_10084724 3300005345 Bacteria 1713
43 Ga0070669_100080582 3300005353 Bacteria 2423
44 Ga0070669_100845167 3300005353 Unclassified 780
45 Ga0070675_100810057 3300005354 Bacteria 856
46 Ga0070675_100958173 3300005354 Unclassified 785
47 Ga0070671_100075842 3300005355 Unclassified 2809
48 Ga0070673_100024940 3300005364 Bacteria 4392
49 Ga0070673_100088944 3300005364 Bacteria 2520
50 Ga0070673_101519551 3300005364 Unclassified 632
51 Ga0070673_101767336 3300005364 Unclassified 586
52 Ga0070659_100108442 3300005366 Bacteria 2240
53 Ga0070703_10012555 3300005406 Bacteria 2400
54 Ga0070703_10053666 3300005406 Bacteria 1297
55 Ga0070714_100025283 3300005435 Unclassified 4898
56 Ga0070701_10023785 3300005438 Bacteria 2955
57 Ga0070705_100020961 3300005440 Bacteria 3470
58 Ga0070705_100417478 3300005440 Unclassified 998
59 Ga0070705_101344027 3300005440 Unclassified 594
60 Ga0070700_100011925 3300005441 Bacteria 4828
61 Ga0070700_101618028 3300005441 Unclassified 554
62 Ga0070694_100014470 3300005444 Bacteria 4940
63 Ga0070694_100015767 3300005444 Bacteria 4753
64 Ga0070694_100324134 3300005444 Bacteria 1186
65 Ga0070694_100565728 3300005444 Bacteria 912
66 Ga0070694_100886737 3300005444 Bacteria 736
67 Ga0070708_100000311 3300005445 Bacteria 36596
68 Ga0070681_10004020 3300005458 Bacteria 13871
69 Ga0070681_10091319 3300005458 Bacteria 2995
70 Ga0070681_10142360 3300005458 Bacteria 2327
71 Ga0068867_100030742 3300005459 Bacteria 3874
72 Ga0068867_100130124 3300005459 Bacteria 1955
73 Ga0070706_100001871 3300005467 Bacteria 21735
74 Ga0070706_100110752 3300005467 Bacteria 2555
75 Ga0070707_100072312 3300005468 Bacteria 3323
76 Ga0070698_100003522 3300005471 Bacteria 17232
77 Ga0070698_100003912 3300005471 Bacteria 16380
78 Ga0070698_100039997 3300005471 Bacteria 4821
79 Ga0070698_101564630 3300005471 Bacteria 611
80 Ga0070699_100006602 3300005518 Bacteria 10086
81 Ga0070699_100361073 3300005518 Bacteria 1309
82 Ga0070679_100023851 3300005530 Bacteria 5994
83 Ga0070697_100000082 3300005536 Bacteria 77550
84 Ga0070697_100051584 3300005536 Bacteria 3342
85 Ga0070697_100160187 3300005536 Bacteria 1901
86 Ga0070697_100592645 3300005536 Bacteria 974
87 Ga0068853_100017115 3300005539 Bacteria 5979
88 Ga0068853_100061098 3300005539 Bacteria 3259
89 Ga0068853_100245341 3300005539 Bacteria 1642
90 Ga0070695_100025154 3300005545 Unclassified 3674
91 Ga0070695_100237117 3300005545 Bacteria 1321
92 Ga0070695_100721390 3300005545 Unclassified 793
93 Ga0070695_100836106 3300005545 Bacteria 740
94 Ga0070696_100561712 3300005546 Bacteria 916
95 Ga0070704_100039783 3300005549 Bacteria 3230
96 Ga0070704_100159989 3300005549 Bacteria 1780
97 Ga0070704_100448371 3300005549 Bacteria 1110
98 Ga0070704_100584283 3300005549 Bacteria 980
99 Ga0070704_101055155 3300005549 Bacteria 737
100 Ga0068855_100304988 3300005563 Bacteria 1763
101 Ga0070664_101582683 3300005564 Bacteria 621
102 Ga0068857_100007599 3300005577 Bacteria 9330
103 Ga0068857_100029693 3300005577 Bacteria 4825
104 Ga0068857_100124039 3300005577 Bacteria 2327
105 Ga0068857_100900180 3300005577 Bacteria 848
106 Ga0068854_100193209 3300005578 Bacteria 1596
107 Ga0068854_100695383 3300005578 Bacteria 877
108 Ga0068854_101065505 3300005578 Bacteria 719
109 Ga0070702_100027019 3300005615 Bacteria 3092
110 Ga0070702_100188428 3300005615 Bacteria 1355
111 Ga0070702_100251893 3300005615 Bacteria 1197
112 Ga0070702_100461246 3300005615 Bacteria 924
113 Ga0068852_100082494 3300005616 Bacteria 2857
114 Ga0068859_100003607 3300005617 Bacteria 15781
115 Ga0068859_100023360 3300005617 Bacteria 6207
116 Ga0068859_100086330 3300005617 Bacteria 3184
117 Ga0068859_100348971 3300005617 Bacteria 1575
118 Ga0068859_100386770 3300005617 Bacteria 1495
119 Ga0068859_100420507 3300005617 Bacteria 1433
120 Ga0068859_100611332 3300005617 Bacteria 1183
121 Ga0068859_100657456 3300005617 Bacteria 1140
122 Ga0068864_100014735 3300005618 Bacteria 6494
123 Ga0068864_100044473 3300005618 Unclassified 3807
124 Ga0068864_100098800 3300005618 Bacteria 2585
125 Ga0068864_100165786 3300005618 Bacteria 2011
126 Ga0068864_100613361 3300005618 Bacteria 1057
127 Ga0068864_100837412 3300005618 Unclassified 906
128 Ga0068864_101286223 3300005618 Bacteria 731
129 Ga0068864_101374613 3300005618 Unclassified 707
130 Ga0068851_10066056 3300005834 Unclassified 1863
131 Ga0068870_10011636 3300005840 Bacteria 4088
132 Ga0068870_10229793 3300005840 Unclassified 1140
133 Ga0068870_10410105 3300005840 Bacteria 884
134 Ga0068863_100070159 3300005841 Bacteria 3314
135 Ga0068863_100295491 3300005841 Bacteria 1571
136 Ga0068863_100306861 3300005841 Bacteria 1540
137 Ga0068863_100340929 3300005841 Bacteria 1458
138 Ga0068863_100566505 3300005841 Bacteria 1122
139 Ga0068858_100062528 3300005842 Bacteria 3442
140 Ga0068858_100069703 3300005842 Bacteria 3259
141 Ga0068858_100121070 3300005842 Unclassified 2447
142 Ga0068858_100155516 3300005842 Unclassified 2151
143 Ga0068858_100156710 3300005842 Bacteria 2143
144 Ga0068858_100252085 3300005842 Bacteria 1677
145 Ga0068858_100270604 3300005842 Bacteria 1617
146 Ga0068860_100017324 3300005843 Bacteria 7019
147 Ga0068860_100079084 3300005843 Bacteria 3127
148 Ga0068860_100139821 3300005843 Bacteria 2326
149 Ga0068860_100493492 3300005843 Bacteria 1222
150 Ga0068860_100931109 3300005843 Bacteria 886
151 Ga0068860_101198281 3300005843 Bacteria 779
152 Ga0081455_10256151 3300005937 Bacteria 1277
153 Ga0081539_10001316 3300005985 Bacteria 43426
154 Ga0081539_10007208 3300005985 Bacteria 10235
155 Ga0081539_10036177 3300005985 Bacteria 2958
156 Ga0081539_10112844 3300005985 Bacteria 1364
157 Ga0070715_10000002 3300006163 Bacteria 389554
158 Ga0070712_100576502 3300006175 Bacteria 950
159 Ga0097621_100006835 3300006237 Bacteria 8107
160 Ga0097621_100027684 3300006237 Bacteria 4460
161 Ga0097621_100821699 3300006237 Bacteria 862
162 Ga0068871_100029282 3300006358 Bacteria 4322
163 Ga0075433_10127954 3300006852 Bacteria 2256
164 Ga0075434_100025315 3300006871 Bacteria 5806
165 Ga0075434_100188043 3300006871 Unclassified 2085
166 Ga0075434_100284157 3300006871 Bacteria 1674
167 Ga0075429_100061539 3300006880 Bacteria 3270
168 Ga0075436_100053070 3300006914 Bacteria 2798
169 Ga0097620_100003607 3300006931 Bacteria 15781
170 Ga0097620_100023362 3300006931 Bacteria 6207
171 Ga0097620_100086335 3300006931 Bacteria 3184
172 Ga0097620_100348976 3300006931 Bacteria 1575
173 Ga0097620_100386761 3300006931 Bacteria 1495
174 Ga0097620_100420521 3300006931 Bacteria 1433
175 Ga0097620_100611277 3300006931 Bacteria 1183
176 Ga0097620_100657415 3300006931 Bacteria 1140
177 Ga0105251_10045443 3300009011 Bacteria 2117
178 Ga0105240_10273656 3300009093 Unclassified 1943
179 Ga0105240_10796373 3300009093 Bacteria 1024
180 Ga0111539_10001110 3300009094 Bacteria 35527
181 Ga0105245_10303943 3300009098 Bacteria 1566
182 Ga0105245_10641929 3300009098 Unclassified 1091
183 Ga0105245_11082842 3300009098 Bacteria 847
184 Ga0105245_11745229 3300009098 Unclassified 675
185 Ga0105245_12258921 3300009098 Unclassified 598
186 Ga0105247_10000326 3300009101 Bacteria 42400
187 Ga0105247_10031464 3300009101 Unclassified 3220
188 Ga0105247_10071196 3300009101 Bacteria 2174
189 Ga0105247_10641551 3300009101 Bacteria 792
190 Ga0105247_11260410 3300009101 Unclassified 592
191 Ga0105247_11345650 3300009101 Bacteria 575
192 Ga0114129_10030268 3300009147 Bacteria 7663
193 Ga0114129_10187983 3300009147 Bacteria 2806
194 Ga0114129_11109037 3300009147 Bacteria 990
195 Ga0105243_10001215 3300009148 Bacteria 23194
196 Ga0105243_10034462 3300009148 Bacteria 3919
197 Ga0105243_10040245 3300009148 Archaea 3648
198 Ga0105243_10254513 3300009148 Bacteria 1569
199 Ga0105243_10920380 3300009148 Bacteria 871
200 Ga0105243_11792793 3300009148 Unclassified 645
201 Ga0105241_10033380 3300009174 Bacteria 3864
202 Ga0105241_10071817 3300009174 Bacteria 2688
203 Ga0105241_10079793 3300009174 Bacteria 2560
204 Ga0105241_10102755 3300009174 Bacteria 2275
205 Ga0105241_10121684 3300009174 Bacteria 2102
206 Ga0105241_10558613 3300009174 Bacteria 1029
207 Ga0105241_11093166 3300009174 Unclassified 750
208 Ga0105242_10003233 3300009176 Bacteria 12700
209 Ga0105242_10293770 3300009176 Bacteria 1481
210 Ga0105248_10002791 3300009177 Bacteria 19407
211 Ga0105248_10022887 3300009177 Bacteria 6938
212 Ga0105248_10038646 3300009177 Bacteria 5342
213 Ga0105248_10236121 3300009177 Unclassified 2058
214 Ga0105248_10482372 3300009177 Bacteria 1397
215 Ga0105237_10003293 3300009545 Bacteria 19288
216 Ga0105237_10239894 3300009545 Bacteria 1814
217 Ga0105237_10808157 3300009545 Bacteria 944
218 Ga0105237_12008799 3300009545 Bacteria 587
219 Ga0105238_10095434 3300009551 Unclassified 2961
220 Ga0105238_10329272 3300009551 Unclassified 1514
221 Ga0105249_10010826 3300009553 Bacteria 8014
222 Ga0105249_11398597 3300009553 Unclassified 772
223 Ga0105239_10099847 3300010375 Bacteria 3209
224 Ga0105239_10303470 3300010375 Bacteria 1798
225 Ga0105239_10381770 3300010375 Bacteria 1593
226 Ga0105239_10408373 3300010375 Bacteria 1537
227 Ga0105239_10678799 3300010375 Bacteria 1177
228 Ga0105239_10679333 3300010375 Bacteria 1177
229 Ga0105246_10335123 3300011119 Bacteria 1234
230 Ga0105246_11174519 3300011119 Bacteria 705
231 Ga0157373_10023592 3300013100 Bacteria 4458
232 Ga0157373_10169252 3300013100 Bacteria 1537
233 Ga0157373_10186999 3300013100 Bacteria 1459
234 Ga0157373_10850558 3300013100 Archaea 675
235 Ga0157378_10000105 3300013297 Bacteria 79945
236 Ga0157378_10433528 3300013297 Bacteria 1301
237 Ga0163162_10428131 3300013306 Bacteria 1455
238 Ga0163162_11216260 3300013306 Bacteria 855
239 Ga0157372_10052061 3300013307 Bacteria 4557
240 Ga0157372_10751819 3300013307 Bacteria 1134
241 Ga0157372_10837672 3300013307 Bacteria 1068
242 Ga0157372_11172907 3300013307 Unclassified 888
243 Ga0157372_11345500 3300013307 Bacteria 824
244 Ga0157372_11512626 3300013307 Unclassified 773
245 Ga0157375_10005309 3300013308 Bacteria 11193
246 Ga0157375_10140088 3300013308 Bacteria 2545
247 Ga0157375_10200809 3300013308 Bacteria 2150
248 Ga0163163_10019265 3300014325 Bacteria 6406
249 Ga0163163_10290364 3300014325 Bacteria 1687
250 Ga0163163_10796421 3300014325 Bacteria 1008
251 Ga0163163_11034322 3300014325 Unclassified 885
252 Ga0163163_11147152 3300014325 Bacteria 840
253 Ga0163163_12543604 3300014325 Unclassified 570
254 Ga0157380_10514661 3300014326 Bacteria 1166
255 Ga0157377_10092959 3300014745 Bacteria 1784
256 Ga0157379_10018565 3300014968 Bacteria 6134
257 Ga0157379_10154257 3300014968 Bacteria 2071
258 Ga0157376_10392713 3300014969 Bacteria 1339
259 Ga0207653_10005200 3300025885 Bacteria 4067
260 Ga0207710_10000291 3300025900 Bacteria 40580
261 Ga0207710_10320044 3300025900 Bacteria 786
262 Ga0207688_10245893 3300025901 Bacteria 1083
263 Ga0207647_10004426 3300025904 Bacteria 10414
264 Ga0207647_10116335 3300025904 Bacteria 1578
265 Ga0207647_10146470 3300025904 Bacteria 1382
266 Ga0207685_10000030 3300025905 Bacteria 89606
267 Ga0207643_10005258 3300025908 Bacteria 6921
268 Ga0207684_10005120 3300025910 Bacteria 12210
269 Ga0207684_10112357 3300025910 Bacteria 2332
270 Ga0207654_10055464 3300025911 Unclassified 2294
271 Ga0207654_10126138 3300025911 Bacteria 1614
272 Ga0207654_10353051 3300025911 Bacteria 1013
273 Ga0207707_10041783 3300025912 Bacteria 4004
274 Ga0207707_10160160 3300025912 Unclassified 1968
275 Ga0207707_10387921 3300025912 Bacteria 1200
276 Ga0207695_10121921 3300025913 Bacteria 2574
277 Ga0207671_10051644 3300025914 Bacteria 3047
278 Ga0207671_10130715 3300025914 Bacteria 1927
279 Ga0207671_10866104 3300025914 Unclassified 715
280 Ga0207657_10869492 3300025919 Bacteria 695
281 Ga0207652_10858357 3300025921 Bacteria 804
282 Ga0207646_10412493 3300025922 Unclassified 1219
283 Ga0207681_10036514 3300025923 Bacteria 3242
284 Ga0207694_10053205 3300025924 Bacteria 3139
285 Ga0207694_10063974 3300025924 Bacteria 2866
286 Ga0207650_10000007 3300025925 Bacteria 530810
287 Ga0207650_10567678 3300025925 Unclassified 952
288 Ga0207650_10987326 3300025925 Unclassified 716
289 Ga0207687_10321760 3300025927 Bacteria 1252
290 Ga0207687_10758414 3300025927 Bacteria 826
291 Ga0207687_11025109 3300025927 Unclassified 708
292 Ga0207664_10423110 3300025929 Bacteria 1187
293 Ga0207690_10892563 3300025932 Unclassified 737
294 Ga0207706_10686251 3300025933 Bacteria 875
295 Ga0207686_10011703 3300025934 Archaea 4812
296 Ga0207686_10284902 3300025934 Bacteria 1221
297 Ga0207709_10011194 3300025935 Bacteria 4947
298 Ga0207709_10011268 3300025935 Unclassified 4932
299 Ga0207709_10107335 3300025935 Bacteria 1859
300 Ga0207709_10568209 3300025935 Bacteria 894
301 Ga0207709_10976610 3300025935 Bacteria 691
302 Ga0207670_10221110 3300025936 Bacteria 1450
303 Ga0207670_10276996 3300025936 Bacteria 1306
304 Ga0207704_10407201 3300025938 Bacteria 1075
305 Ga0207665_10149238 3300025939 Unclassified 1673
306 Ga0207665_10736843 3300025939 Bacteria 776
307 Ga0207691_10376662 3300025940 Bacteria 1212
308 Ga0207691_10379423 3300025940 Bacteria 1207
309 Ga0207691_10796125 3300025940 Bacteria 794
310 Ga0207711_10067511 3300025941 Unclassified 3096
311 Ga0207711_10081221 3300025941 Bacteria 2833
312 Ga0207711_10248318 3300025941 Bacteria 1633
313 Ga0207711_10875866 3300025941 Bacteria 835
314 Ga0207689_10204395 3300025942 Bacteria 1631
315 Ga0207689_10264296 3300025942 Bacteria 1424
316 Ga0207689_10299469 3300025942 Bacteria 1333
317 Ga0207689_10310778 3300025942 Bacteria 1307
318 Ga0207689_10989810 3300025942 Bacteria 709
319 Ga0207679_10772241 3300025945 Bacteria 875
320 Ga0207667_10121607 3300025949 Bacteria 2690
321 Ga0207651_10017400 3300025960 Bacteria 4248
322 Ga0207651_10114069 3300025960 Bacteria 2035
323 Ga0207712_10010848 3300025961 Bacteria 5798
324 Ga0207712_11197615 3300025961 Unclassified 678
325 Ga0207640_10558690 3300025981 Bacteria 963
326 Ga0207640_10925934 3300025981 Bacteria 763
327 Ga0207703_10035528 3300026035 Bacteria 3960
328 Ga0207703_10066390 3300026035 Bacteria 2968
329 Ga0207703_10101601 3300026035 Unclassified 2438
330 Ga0207703_10179388 3300026035 Unclassified 1868
331 Ga0207703_10621746 3300026035 Bacteria 1023
332 Ga0207703_11646732 3300026035 Unclassified 617
333 Ga0207639_10202005 3300026041 Bacteria 1705
334 Ga0207639_10878753 3300026041 Bacteria 837
335 Ga0207708_10013886 3300026075 Bacteria 6020
336 Ga0207708_10042178 3300026075 Bacteria 3479
337 Ga0207708_10374018 3300026075 Bacteria 1173
338 Ga0207708_10589628 3300026075 Unclassified 941
339 Ga0207641_10260353 3300026088 Bacteria 1624
340 Ga0207641_11016013 3300026088 Bacteria 826
341 Ga0207641_11307772 3300026088 Unclassified 725
342 Ga0207648_10055934 3300026089 Bacteria 3444
343 Ga0207648_10118355 3300026089 Bacteria 2328
344 Ga0207676_10014677 3300026095 Bacteria 5642
345 Ga0207676_10090221 3300026095 Bacteria 2514
346 Ga0207676_10153725 3300026095 Unclassified 1985
347 Ga0207676_10679896 3300026095 Bacteria 995
348 Ga0207676_10722216 3300026095 Bacteria 967
349 Ga0207674_10033731 3300026116 Bacteria 5358
350 Ga0207674_10173959 3300026116 Bacteria 2106
351 Ga0207674_11033717 3300026116 Unclassified 791
352 Ga0207674_11104768 3300026116 Bacteria 762
353 Ga0207675_100051587 3300026118 Bacteria 3838
354 Ga0207698_10025182 3300026142 Bacteria 4187
355 Ga0207428_10020242 3300027907 Bacteria 5656
356 Ga0207428_10745500 3300027907 Unclassified 698
357 Ga0268265_10356961 3300028380 Bacteria 1337
358 Ga0268265_10560317 3300028380 Bacteria 1086
359 Ga0268265_11841326 3300028380 Unclassified 612
360 Ga0268264_10027849 3300028381 Bacteria 4619
361 Ga0268264_10038533 3300028381 Bacteria 3946
362 Ga0268264_10214453 3300028381 Bacteria 1769
363 Ga0268264_10260833 3300028381 Bacteria 1614
364 Ga0268264_10751731 3300028381 Unclassified 971
365 Ga0268264_10769393 3300028381 Bacteria 960
366 Ga0268264_11478470 3300028381 Bacteria 690
367 Ga0307408_100543519 3300031548 Bacteria 1024
368 Ga0307408_101156191 3300031548 Unclassified 720
369 Ga0307405_10020166 3300031731 Bacteria 3720
370 Ga0307405_10122340 3300031731 Bacteria 1783
371 Ga0307405_10285068 3300031731 Bacteria 1245
372 Ga0307413_10066118 3300031824 Bacteria 2255
373 Ga0307413_10235009 3300031824 Bacteria 1349
374 Ga0307410_10040938 3300031852 Unclassified 3052
375 Ga0307410_10076197 3300031852 Unclassified 2341
376 Ga0307406_10013540 3300031901 Bacteria 4674
377 Ga0307412_10045754 3300031911 Unclassified 2863
378 Ga0307412_10077603 3300031911 Bacteria 2285
379 Ga0307412_10402366 3300031911 Bacteria 1115
380 Ga0307412_10423426 3300031911 Bacteria 1090
381 Ga0307409_100169508 3300031995 Unclassified 1920
382 Ga0307416_100038058 3300032002 Bacteria 3707
383 Ga0307416_100061642 3300032002 Unclassified 3062
384 Ga0307414_10101570 3300032004 Unclassified 2166
385 Ga0307414_10110093 3300032004 Bacteria 2094
386 Ga0307414_10298588 3300032004 Bacteria 1361
387 Ga0307411_10049939 3300032005 Bacteria 2722
388 Ga0307415_100004550 3300032126 Bacteria 7225
389 Ga0307415_101096734 3300032126 Bacteria 745
390 Ga0395900_0310855 3300037418 Bacteria 1559
391 Ga0395900_0962595 3300037418 Bacteria 775
392 Ga0395898_0265578 3300037466 Unclassified 1637
393 Ga0395898_0555645 3300037466 Unclassified 1090
394 Ga0242420_005601 3300038996 Unclassified 1952
395 Ga0242420_015287 3300038996 Bacteria 1326
396 Ga0439448_0053035 3300042005 Bacteria 1330
397 Ga0439458_0038702 3300042157 Bacteria 1152
398 Ga0453683_0196205 3300044673 Unclassified 1282
399 Ga0451576_0189959 3300045051 Bacteria 2145
400 Ga0451576_0409212 3300045051 Unclassified 1423
401 Ga0451576_0615804 3300045051 Bacteria 1141
402 Ga0451576_2010803 3300045051 Unclassified 595
403 Ga0495643_0204237 3300046522 Unclassified 947
404 Ga0495672_0188011 3300047320 Bacteria 1041
405 Ga0496104_0256720 3300048907 Bacteria 1661
406 Ga0496106_0024737 3300048909 Unclassified 4465
407 Ga0496107_0179105 3300048910 Unclassified 1574
408 Ga0496108_1053906 3300048911 Bacteria 693
409 Ga0496110_0421622 3300048913 Bacteria 1217
410 Ga0496111_0138302 3300048914 Bacteria 1805
411 Ga0496112_0834977 3300048915 Bacteria 845
412 Ga0496112_1108397 3300048915 Bacteria 710
413 Ga0496112_1420923 3300048915 Bacteria 608
414 Ga0496113_0148947 3300048916 Bacteria 1845
415 Ga0496113_1371926 3300048916 Bacteria 548
416 Ga0501306_001972 3300049127 Bacteria 2030
417 Ga0501306_002365 3300049127 Unclassified 1925
418 Ga0501306_063325 3300049127 Unclassified 613
419 Ga0501306_070909 3300049127 Unclassified 588
420 Ga0501309_003794 3300049129 Unclassified 1732
421 Ga0501309_004298 3300049129 Bacteria 1654
422 Ga0501309_024542 3300049129 Bacteria 862
423 Ga0501309_043229 3300049129 Bacteria 693
424 Ga0501309_072418 3300049129 Unclassified 568
425 Ga0501341_08994 3300049131 Bacteria 643
426 Ga0501343_005479 3300049132 Unclassified 974
427 Ga0501343_015511 3300049132 Bacteria 649
428 Ga0501343_021187 3300049132 Unclassified 575
429 Ga0501344_06568 3300049133 Bacteria 674
430 Ga0501345_01722 3300049134 Bacteria 859
431 Ga0501305_068866 3300049161 Bacteria 620
432 Ga0501305_092260 3300049161 Unclassified 556
433 Ga0501307_007639 3300049162 Bacteria 1197
434 Ga0501307_043974 3300049162 Bacteria 656
435 Ga0501307_055067 3300049162 Bacteria 606
436 Ga0501290_019043 3300049513 Unclassified 929
437 Ga0501291_038332 3300049514 Bacteria 834
438 Ga0501291_078200 3300049514 Unclassified 654
439 Ga0501293_015297 3300049516 Unclassified 705
440 Ga0501295_001752 3300049518 Bacteria 2321
441 Ga0501296_001135 3300049519 Bacteria 2671
442 Ga0501296_001534 3300049519 Bacteria 2346
443 Ga0501297_015234 3300049520 Bacteria 918
444 Ga0501298_001496 3300049521 Bacteria 3438
445 Ga0501299_006163 3300049522 Bacteria 1873
446 Ga0501299_011471 3300049522 Unclassified 1497
447 Ga0501300_011270 3300049523 Bacteria 1303
448 Ga0501311_061141 3300049527 Bacteria 609
449 Ga0501311_082380 3300049527 Unclassified 549
450 Ga0501312_070655 3300049528 Bacteria 618
451 Ga0501312_071294 3300049528 Bacteria 616
452 Ga0501315_056295 3300049531 Bacteria 628
453 Ga0501317_062118 3300049533 Bacteria 615
454 Ga0501320_017327 3300049536 Bacteria 804
455 Ga0501321_003607 3300049537 Bacteria 1429
456 Ga0501321_040587 3300049537 Bacteria 653
457 Ga0501321_056180 3300049537 Bacteria 586
458 Ga0501321_062818 3300049537 Unclassified 564
459 Ga0501323_029472 3300049539 Bacteria 764
460 Ga0501325_019544 3300049541 Bacteria 703
461 Ga0501334_10380 3300049550 Bacteria 672
462 Ga0501335_009185 3300049551 Bacteria 939
463 Ga0501336_007395 3300049552 Bacteria 832
464 Ga0501336_007799 3300049552 Bacteria 818
465 Ga0501336_012038 3300049552 Bacteria 710
466 Ga0501337_013802 3300049553 Bacteria 613
467 Ga0501340_009041 3300049556 Bacteria 711
468 Ga0501067_0166067 3300049583 Bacteria 1229
469 Ga0501077_0578073 3300049593 Unclassified 721
470 Ga0501198_004990 3300049649 Unclassified 1858
471 Ga0501198_008570 3300049649 Bacteria 1487
472 Ga0501198_022372 3300049649 Bacteria 1012
473 Ga0501198_024111 3300049649 Bacteria 983
474 Ga0501201_008422 3300049651 Bacteria 996
475 Ga0501202_023216 3300049652 Bacteria 1250
476 Ga0501202_038456 3300049652 Bacteria 1025
477 Ga0501202_130969 3300049652 Unclassified 639
478 Ga0501206_014721 3300049653 Bacteria 1077
479 Ga0501207_001884 3300049654 Unclassified 2674
480 Ga0501207_006265 3300049654 Bacteria 1666
481 Ga0501207_017534 3300049654 Bacteria 1118
482 Ga0501207_039635 3300049654 Bacteria 816
483 Ga0501209_024173 3300049656 Bacteria 1477
484 Ga0501216_005806 3300049660 Bacteria 1873
485 Ga0501216_043760 3300049660 Unclassified 863
486 Ga0501217_000272 3300049661 Bacteria 8088
487 Ga0501217_007774 3300049661 Bacteria 2303
488 Ga0501217_027858 3300049661 Bacteria 1373
489 Ga0501223_003122 3300049663 Bacteria 3620
490 Ga0501223_008588 3300049663 Bacteria 2081
491 Ga0501223_013459 3300049663 Bacteria 1629
492 Ga0501224_013593 3300049664 Bacteria 1202
493 Ga0501224_017743 3300049664 Unclassified 1058
494 Ga0501227_000627 3300049665 Bacteria 7681
495 Ga0501227_018313 3300049665 Bacteria 1588
496 Ga0501228_036638 3300049666 Unclassified 623
497 Ga0501230_001762 3300049667 Unclassified 2647
498 Ga0501230_106121 3300049667 Unclassified 610
499 Ga0501233_016488 3300049668 Bacteria 1533
500 Ga0501233_020546 3300049668 Bacteria 1410
501 Ga0501233_021061 3300049668 Bacteria 1396
502 Ga0501235_001808 3300049669 Bacteria 4593
503 Ga0501235_008297 3300049669 Bacteria 2266
504 Ga0501235_119498 3300049669 Unclassified 658
505 Ga0501240_059710 3300049673 Unclassified 670
506 Ga0501240_106495 3300049673 Unclassified 544
507 Ga0501243_007124 3300049675 Bacteria 1704
508 Ga0501243_010138 3300049675 Bacteria 1468
509 Ga0501243_011612 3300049675 Bacteria 1383
510 Ga0501246_016503 3300049676 Bacteria 728
511 Ga0501247_030518 3300049677 Bacteria 734
512 Ga0501249_007843 3300049679 Bacteria 2214
513 Ga0501249_028396 3300049679 Bacteria 1240
514 Ga0501250_000960 3300049680 Bacteria 2198
515 Ga0501250_040398 3300049680 Bacteria 682
516 Ga0501251_007821 3300049681 Bacteria 1197
517 Ga0501253_025145 3300049683 Bacteria 1086
518 Ga0501257_025680 3300049686 Bacteria 1402
519 Ga0501259_015377 3300049688 Bacteria 1306
520 Ga0501261_019719 3300049690 Unclassified 960
521 Ga0501221_009074 3300049704 Bacteria 1740
522 Ga0501225_0007355 3300049705 Unclassified 3192
523 Ga0501225_0040500 3300049705 Bacteria 1284
524 Ga0501225_0092555 3300049705 Bacteria 877
525 Ga0501229_026747 3300049706 Bacteria 779
526 Ga0501234_014225 3300049707 Bacteria 1249
527 Ga0501234_019526 3300049707 Bacteria 1075
528 Ga0501245_011544 3300049708 Bacteria 1286
529 Ga0501263_010458 3300049760 Bacteria 1138
530 Ga0501268_021034 3300049765 Bacteria 1117
531 Ga0501270_006880 3300049767 Bacteria 1385
532 Ga0501271_002012 3300049768 Bacteria 1785
533 Ga0501272_004202 3300049769 Bacteria 1491
534 Ga0501273_002151 3300049770 Bacteria 1983
535 Ga0501274_009820 3300049771 Bacteria 875
536 Ga0501274_010871 3300049771 Unclassified 844
537 Ga0501276_014803 3300049773 Bacteria 696
538 Ga0501279_027183 3300049775 Bacteria 837
539 Ga0501283_001783 3300049779 Bacteria 2792
540 Ga0501283_009913 3300049779 Bacteria 1396
541 Ga0501212_009800 3300049851 Bacteria 1357
542 Ga0501226_005756 3300049853 Bacteria 1408
543 nmdc:mga05p37_220295_c1 3300050507 Bacteria 2290
544 nmdc:mga05p37_49976_c1 3300050507 Bacteria 5143
545 nmdc:mga09592_714313_c1 3300050508 Bacteria 852
546 nmdc:mga08y16_606_c1 3300050511 Bacteria 33436
547 nmdc:mga08y16_695471_c1 3300050511 Unclassified 1017
548 nmdc:mga0n895_1035146_c1 3300050512 Bacteria 801
549 nmdc:mga0n895_122789_c1 3300050512 Unclassified 2619
550 nmdc:mga0a205_36669_c2 3300050515 Bacteria 4370
551 nmdc:mga0a205_414014_c1 3300050515 Unclassified 1210
552 nmdc:mga0a205_58137_c1 3300050515 Bacteria 3735
553 Ga0587086_087920 3300059507 Unclassified 557

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100561712 Ga0070696_1005617122 154
2 3300009174 Ga0105241_10558613 Ga0105241_105586132 154
3 3300006163 Ga0070715_10000002 Ga0070715_1000000227 155
4 3300025905 Ga0207685_10000030 Ga0207685_1000003026 155
5 3300049537 Ga0501321_062818 Ga0501321_062818_23_496 155
6 3300025921 Ga0207652_10858357 Ga0207652_108583572 158
7 3300049131 Ga0501341_08994 Ga0501341_08994_35_517 158
8 3300005336 Ga0070680_100105569 Ga0070680_1001055691 159
9 3300005337 Ga0070682_100563575 Ga0070682_1005635751 159
10 3300005344 Ga0070661_100037957 Ga0070661_1000379575 159
11 3300005354 Ga0070675_100810057 Ga0070675_1008100571 159
12 3300005458 Ga0070681_10142360 Ga0070681_101423601 159
13 3300005530 Ga0070679_100023851 Ga0070679_1000238512 159
14 3300005539 Ga0068853_100061098 Ga0068853_1000610982 159
15 3300005577 Ga0068857_100007599 Ga0068857_1000075999 159
16 3300005618 Ga0068864_101374613 Ga0068864_1013746131 159
17 3300009174 Ga0105241_10102755 Ga0105241_101027551 159
18 3300013100 Ga0157373_10169252 Ga0157373_101692521 159
19 3300013307 Ga0157372_10837672 Ga0157372_108376721 159
20 3300013308 Ga0157375_10200809 Ga0157375_102008091 159
21 3300014325 Ga0163163_11034322 Ga0163163_110343221 159
22 3300049519 Ga0501296_001135 Ga0501296_001135_1975_2460 159
23 3300049675 Ga0501243_007124 Ga0501243_007124_652_1137 159
24 3300005355 Ga0070671_100075842 Ga0070671_1000758422 160
25 3300048916 Ga0496113_1371926 Ga0496113_1371926_11_499 160
26 3300005471 Ga0070698_100003522 Ga0070698_1000035223 161
27 3300045051 Ga0451576_0409212 Ga0451576_0409212_851_1351 161
28 3300049583 Ga0501067_0166067 Ga0501067_0166067_320_820 161
29 3300005328 Ga0070676_10651264 Ga0070676_106512642 162
30 3300005331 Ga0070670_100067788 Ga0070670_1000677883 162
31 3300005343 Ga0070687_100713555 Ga0070687_1007135551 162
32 3300005364 Ga0070673_100088944 Ga0070673_1000889443 162
33 3300005435 Ga0070714_100025283 Ga0070714_1000252835 162
34 3300005444 Ga0070694_100015767 Ga0070694_1000157674 162
35 3300005536 Ga0070697_100592645 Ga0070697_1005926452 162
36 3300005578 Ga0068854_100695383 Ga0068854_1006953832 162
37 3300005617 Ga0068859_100023360 Ga0068859_1000233602 162
38 3300005842 Ga0068858_100155516 Ga0068858_1001555161 162
39 3300005843 Ga0068860_101198281 Ga0068860_1011982811 162
40 3300006880 Ga0075429_100061539 Ga0075429_1000615393 162
41 3300006931 Ga0097620_100023362 Ga0097620_1000233622 162
42 3300009101 Ga0105247_10031464 Ga0105247_100314641 162
43 3300009147 Ga0114129_11109037 Ga0114129_111090372 162
44 3300009177 Ga0105248_10022887 Ga0105248_100228878 162
45 3300009177 Ga0105248_10236121 Ga0105248_102361212 162
46 3300010375 Ga0105239_10408373 Ga0105239_104083732 162
47 3300013306 Ga0163162_10428131 Ga0163162_104281312 162
48 3300014745 Ga0157377_10092959 Ga0157377_100929592 162
49 3300014968 Ga0157379_10018565 Ga0157379_100185657 162
50 3300025922 Ga0207646_10412493 Ga0207646_104124932 162
51 3300025929 Ga0207664_10423110 Ga0207664_104231102 162
52 3300025941 Ga0207711_10248318 Ga0207711_102483182 162
53 3300026035 Ga0207703_10179388 Ga0207703_101793881 162
54 3300026035 Ga0207703_11646732 Ga0207703_116467321 162
55 3300026075 Ga0207708_10374018 Ga0207708_103740181 162
56 3300026118 Ga0207675_100051587 Ga0207675_1000515874 162
57 3300028380 Ga0268265_11841326 Ga0268265_118413261 162
58 3300028381 Ga0268264_10214453 Ga0268264_102144532 162
59 3300037418 Ga0395900_0962595 Ga0395900_0962595_197_691 162
60 3300037466 Ga0395898_0265578 Ga0395898_0265578_204_698 162
61 3300045051 Ga0451576_0189959 Ga0451576_0189959_511_1005 162
62 3300046522 Ga0495643_0204237 Ga0495643_0204237_273_767 162
63 3300047320 Ga0495672_0188011 Ga0495672_0188011_404_907 162
64 3300049127 Ga0501306_063325 Ga0501306_063325_33_527 162
65 3300049129 Ga0501309_004298 Ga0501309_004298_21_515 162
66 3300049537 Ga0501321_056180 Ga0501321_056180_23_517 162
67 3300049552 Ga0501336_007799 Ga0501336_007799_254_748 162
68 3300049593 Ga0501077_0578073 Ga0501077_0578073_27_521 162
69 3300050507 nmdc:mga05p37_220295_c1 nmdc:mga05p37_220295_c1_582_1085 162
70 3300050508 nmdc:mga09592_714313_c1 nmdc:mga09592_714313_c1_100_603 162
71 3300050515 nmdc:mga0a205_414014_c1 nmdc:mga0a205_414014_c1_94_597 162
72 3300005288 Ga0065714_10064440 Ga0065714_1006444078 163
73 3300005290 Ga0065712_10000120 Ga0065712_1000012010 163
74 3300005290 Ga0065712_10235170 Ga0065712_102351701 163
75 3300005293 Ga0065715_10090220 Ga0065715_100902203 163
76 3300005293 Ga0065715_10352974 Ga0065715_103529741 163
77 3300005295 Ga0065707_10110990 Ga0065707_101109901 163
78 3300005334 Ga0068869_100214069 Ga0068869_1002140692 163
79 3300005334 Ga0068869_100306854 Ga0068869_1003068542 163
80 3300005338 Ga0068868_100548998 Ga0068868_1005489982 163
81 3300005343 Ga0070687_100574065 Ga0070687_1005740651 163
82 3300005353 Ga0070669_100845167 Ga0070669_1008451672 163
83 3300005354 Ga0070675_100958173 Ga0070675_1009581731 163
84 3300005406 Ga0070703_10053666 Ga0070703_100536662 163
85 3300005440 Ga0070705_100417478 Ga0070705_1004174781 163
86 3300005440 Ga0070705_101344027 Ga0070705_1013440271 163
87 3300005445 Ga0070708_100000311 Ga0070708_10000031118 163
88 3300005467 Ga0070706_100001871 Ga0070706_10000187123 163
89 3300005467 Ga0070706_100110752 Ga0070706_1001107522 163
90 3300005468 Ga0070707_100072312 Ga0070707_1000723123 163
91 3300005471 Ga0070698_100003912 Ga0070698_10000391212 163
92 3300005471 Ga0070698_101564630 Ga0070698_1015646301 163
93 3300005518 Ga0070699_100006602 Ga0070699_1000066027 163
94 3300005536 Ga0070697_100000082 Ga0070697_10000008234 163
95 3300005536 Ga0070697_100051584 Ga0070697_1000515842 163
96 3300005549 Ga0070704_100584283 Ga0070704_1005842832 163
97 3300005549 Ga0070704_101055155 Ga0070704_1010551551 163
98 3300005617 Ga0068859_100657456 Ga0068859_1006574561 163
99 3300005618 Ga0068864_101286223 Ga0068864_1012862231 163
100 3300005842 Ga0068858_100121070 Ga0068858_1001210703 163
101 3300005985 Ga0081539_10112844 Ga0081539_101128442 163
102 3300006237 Ga0097621_100821699 Ga0097621_1008216991 163
103 3300006871 Ga0075434_100284157 Ga0075434_1002841571 163
104 3300006931 Ga0097620_100657415 Ga0097620_1006574151 163
105 3300009011 Ga0105251_10045443 Ga0105251_100454431 163
106 3300009101 Ga0105247_11345650 Ga0105247_113456501 163
107 3300009147 Ga0114129_10187983 Ga0114129_101879834 163
108 3300009148 Ga0105243_10040245 Ga0105243_100402453 163
109 3300009148 Ga0105243_10254513 Ga0105243_102545132 163
110 3300009176 Ga0105242_10003233 Ga0105242_100032338 163
111 3300009177 Ga0105248_10038646 Ga0105248_100386463 163
112 3300009177 Ga0105248_10482372 Ga0105248_104823722 163
113 3300013297 Ga0157378_10000105 Ga0157378_1000010528 163
114 3300013308 Ga0157375_10005309 Ga0157375_100053093 163
115 3300014325 Ga0163163_10290364 Ga0163163_102903642 163
116 3300014325 Ga0163163_12543604 Ga0163163_125436041 163
117 3300025900 Ga0207710_10320044 Ga0207710_103200441 163
118 3300025910 Ga0207684_10005120 Ga0207684_100051202 163
119 3300025910 Ga0207684_10112357 Ga0207684_101123572 163
120 3300025934 Ga0207686_10011703 Ga0207686_100117031 163
121 3300025935 Ga0207709_10011268 Ga0207709_100112683 163
122 3300025940 Ga0207691_10379423 Ga0207691_103794232 163
123 3300025941 Ga0207711_10081221 Ga0207711_100812213 163
124 3300025942 Ga0207689_10299469 Ga0207689_102994692 163
125 3300026035 Ga0207703_10101601 Ga0207703_101016012 163
126 3300026095 Ga0207676_10679896 Ga0207676_106798962 163
127 3300027907 Ga0207428_10745500 Ga0207428_107455001 163
128 3300031548 Ga0307408_101156191 Ga0307408_1011561911 163
129 3300031911 Ga0307412_10423426 Ga0307412_104234262 163
130 3300048909 Ga0496106_0024737 Ga0496106_0024737_2861_3358 163
131 3300048910 Ga0496107_0179105 Ga0496107_0179105_1057_1554 163
132 3300049129 Ga0501309_072418 Ga0501309_072418_61_558 163
133 3300050511 nmdc:mga08y16_695471_c1 nmdc:mga08y16_695471_c1_171_677 163
134 3300050512 nmdc:mga0n895_1035146_c1 nmdc:mga0n895_1035146_c1_209_706 163
135 3300001904 JGI24736J21556_1008527 JGI24736J21556_10085272 164
136 3300002459 JGI24751J29686_10000179 JGI24751J29686_1000017921 164
137 3300003203 JGI25406J46586_10017735 JGI25406J46586_100177351 164
138 3300003203 JGI25406J46586_10041338 JGI25406J46586_100413382 164
139 3300003320 rootH2_10242219 rootH2_102422192 164
140 3300005289 Ga0065704_10369489 Ga0065704_103694891 164
141 3300005290 Ga0065712_10032263 Ga0065712_100322632 164
142 3300005290 Ga0065712_10080463 Ga0065712_100804633 164
143 3300005290 Ga0065712_10266639 Ga0065712_102666391 164
144 3300005293 Ga0065715_10045410 Ga0065715_100454101 164
145 3300005293 Ga0065715_10091105 Ga0065715_100911053 164
146 3300005293 Ga0065715_10096605 Ga0065715_100966055 164
147 3300005293 Ga0065715_10109897 Ga0065715_101098972 164
148 3300005293 Ga0065715_10434764 Ga0065715_104347641 164
149 3300005293 Ga0065715_10493834 Ga0065715_104938341 164
150 3300005331 Ga0070670_100000188 Ga0070670_10000018842 164
151 3300005334 Ga0068869_100571872 Ga0068869_1005718722 164
152 3300005334 Ga0068869_101254875 Ga0068869_1012548751 164
153 3300005335 Ga0070666_11159879 Ga0070666_111598791 164
154 3300005337 Ga0070682_100006213 Ga0070682_1000062133 164
155 3300005345 Ga0070692_10084724 Ga0070692_100847242 164
156 3300005353 Ga0070669_100080582 Ga0070669_1000805822 164
157 3300005364 Ga0070673_100024940 Ga0070673_1000249403 164
158 3300005364 Ga0070673_101767336 Ga0070673_1017673361 164
159 3300005366 Ga0070659_100108442 Ga0070659_1001084423 164
160 3300005406 Ga0070703_10012555 Ga0070703_100125551 164
161 3300005438 Ga0070701_10023785 Ga0070701_100237852 164
162 3300005440 Ga0070705_100020961 Ga0070705_1000209612 164
163 3300005441 Ga0070700_100011925 Ga0070700_1000119252 164
164 3300005441 Ga0070700_101618028 Ga0070700_1016180281 164
165 3300005444 Ga0070694_100014470 Ga0070694_1000144702 164
166 3300005444 Ga0070694_100324134 Ga0070694_1003241342 164
167 3300005444 Ga0070694_100565728 Ga0070694_1005657281 164
168 3300005444 Ga0070694_100886737 Ga0070694_1008867371 164
169 3300005458 Ga0070681_10004020 Ga0070681_100040202 164
170 3300005458 Ga0070681_10091319 Ga0070681_100913193 164
171 3300005459 Ga0068867_100030742 Ga0068867_1000307422 164
172 3300005459 Ga0068867_100130124 Ga0068867_1001301242 164
173 3300005539 Ga0068853_100017115 Ga0068853_1000171153 164
174 3300005539 Ga0068853_100245341 Ga0068853_1002453412 164
175 3300005545 Ga0070695_100025154 Ga0070695_1000251541 164
176 3300005545 Ga0070695_100237117 Ga0070695_1002371172 164
177 3300005545 Ga0070695_100721390 Ga0070695_1007213901 164
178 3300005545 Ga0070695_100836106 Ga0070695_1008361062 164
179 3300005549 Ga0070704_100039783 Ga0070704_1000397834 164
180 3300005549 Ga0070704_100159989 Ga0070704_1001599892 164
181 3300005549 Ga0070704_100448371 Ga0070704_1004483711 164
182 3300005563 Ga0068855_100304988 Ga0068855_1003049882 164
183 3300005577 Ga0068857_100124039 Ga0068857_1001240392 164
184 3300005578 Ga0068854_100193209 Ga0068854_1001932091 164
185 3300005578 Ga0068854_101065505 Ga0068854_1010655051 164
186 3300005615 Ga0070702_100027019 Ga0070702_1000270192 164
187 3300005615 Ga0070702_100188428 Ga0070702_1001884282 164
188 3300005615 Ga0070702_100251893 Ga0070702_1002518931 164
189 3300005615 Ga0070702_100461246 Ga0070702_1004612462 164
190 3300005616 Ga0068852_100082494 Ga0068852_1000824941 164
191 3300005617 Ga0068859_100003607 Ga0068859_1000036073 164
192 3300005617 Ga0068859_100086330 Ga0068859_1000863302 164
193 3300005617 Ga0068859_100348971 Ga0068859_1003489712 164
194 3300005617 Ga0068859_100386770 Ga0068859_1003867701 164
195 3300005617 Ga0068859_100420507 Ga0068859_1004205071 164
196 3300005617 Ga0068859_100611332 Ga0068859_1006113322 164
197 3300005618 Ga0068864_100044473 Ga0068864_1000444735 164
198 3300005618 Ga0068864_100098800 Ga0068864_1000988003 164
199 3300005618 Ga0068864_100165786 Ga0068864_1001657862 164
200 3300005618 Ga0068864_100613361 Ga0068864_1006133612 164
201 3300005618 Ga0068864_100837412 Ga0068864_1008374121 164
202 3300005834 Ga0068851_10066056 Ga0068851_100660561 164
203 3300005840 Ga0068870_10011636 Ga0068870_100116362 164
204 3300005840 Ga0068870_10229793 Ga0068870_102297932 164
205 3300005840 Ga0068870_10410105 Ga0068870_104101051 164
206 3300005841 Ga0068863_100070159 Ga0068863_1000701595 164
207 3300005841 Ga0068863_100306861 Ga0068863_1003068612 164
208 3300005841 Ga0068863_100340929 Ga0068863_1003409292 164
209 3300005841 Ga0068863_100566505 Ga0068863_1005665052 164
210 3300005842 Ga0068858_100062528 Ga0068858_1000625281 164
211 3300005842 Ga0068858_100069703 Ga0068858_1000697032 164
212 3300005842 Ga0068858_100156710 Ga0068858_1001567102 164
213 3300005842 Ga0068858_100252085 Ga0068858_1002520851 164
214 3300005842 Ga0068858_100270604 Ga0068858_1002706042 164
215 3300005843 Ga0068860_100017324 Ga0068860_1000173245 164
216 3300005843 Ga0068860_100079084 Ga0068860_1000790842 164
217 3300005843 Ga0068860_100139821 Ga0068860_1001398212 164
218 3300005843 Ga0068860_100493492 Ga0068860_1004934922 164
219 3300005937 Ga0081455_10256151 Ga0081455_102561512 164
220 3300005985 Ga0081539_10001316 Ga0081539_1000131622 164
221 3300005985 Ga0081539_10007208 Ga0081539_100072084 164
222 3300006175 Ga0070712_100576502 Ga0070712_1005765022 164
223 3300006237 Ga0097621_100006835 Ga0097621_1000068352 164
224 3300006237 Ga0097621_100027684 Ga0097621_1000276846 164
225 3300006358 Ga0068871_100029282 Ga0068871_1000292822 164
226 3300006852 Ga0075433_10127954 Ga0075433_101279544 164
227 3300006871 Ga0075434_100025315 Ga0075434_1000253158 164
228 3300006871 Ga0075434_100188043 Ga0075434_1001880432 164
229 3300006914 Ga0075436_100053070 Ga0075436_1000530703 164
230 3300006931 Ga0097620_100003607 Ga0097620_10000360720 164
231 3300006931 Ga0097620_100086335 Ga0097620_1000863352 164
232 3300006931 Ga0097620_100348976 Ga0097620_1003489762 164
233 3300006931 Ga0097620_100386761 Ga0097620_1003867611 164
234 3300006931 Ga0097620_100420521 Ga0097620_1004205212 164
235 3300006931 Ga0097620_100611277 Ga0097620_1006112772 164
236 3300009093 Ga0105240_10273656 Ga0105240_102736563 164
237 3300009093 Ga0105240_10796373 Ga0105240_107963731 164
238 3300009098 Ga0105245_10303943 Ga0105245_103039432 164
239 3300009098 Ga0105245_10641929 Ga0105245_106419291 164
240 3300009098 Ga0105245_11082842 Ga0105245_110828422 164
241 3300009098 Ga0105245_11745229 Ga0105245_117452291 164
242 3300009098 Ga0105245_12258921 Ga0105245_122589211 164
243 3300009101 Ga0105247_10000326 Ga0105247_100003268 164
244 3300009101 Ga0105247_10071196 Ga0105247_100711962 164
245 3300009101 Ga0105247_11260410 Ga0105247_112604101 164
246 3300009147 Ga0114129_10030268 Ga0114129_100302684 164
247 3300009148 Ga0105243_10001215 Ga0105243_1000121516 164
248 3300009148 Ga0105243_10034462 Ga0105243_100344622 164
249 3300009148 Ga0105243_10920380 Ga0105243_109203801 164
250 3300009148 Ga0105243_11792793 Ga0105243_117927931 164
251 3300009174 Ga0105241_10033380 Ga0105241_100333802 164
252 3300009174 Ga0105241_10071817 Ga0105241_100718172 164
253 3300009174 Ga0105241_10079793 Ga0105241_100797933 164
254 3300009174 Ga0105241_10121684 Ga0105241_101216842 164
255 3300009176 Ga0105242_10293770 Ga0105242_102937702 164
256 3300009177 Ga0105248_10002791 Ga0105248_1000279119 164
257 3300009545 Ga0105237_10003293 Ga0105237_1000329310 164
258 3300009545 Ga0105237_10239894 Ga0105237_102398942 164
259 3300009545 Ga0105237_10808157 Ga0105237_108081572 164
260 3300009545 Ga0105237_12008799 Ga0105237_120087991 164
261 3300009551 Ga0105238_10329272 Ga0105238_103292721 164
262 3300009553 Ga0105249_10010826 Ga0105249_100108266 164
263 3300009553 Ga0105249_11398597 Ga0105249_113985971 164
264 3300010375 Ga0105239_10099847 Ga0105239_100998472 164
265 3300010375 Ga0105239_10303470 Ga0105239_103034701 164
266 3300010375 Ga0105239_10381770 Ga0105239_103817702 164
267 3300010375 Ga0105239_10678799 Ga0105239_106787991 164
268 3300011119 Ga0105246_10335123 Ga0105246_103351232 164
269 3300011119 Ga0105246_11174519 Ga0105246_111745191 164
270 3300013100 Ga0157373_10023592 Ga0157373_100235922 164
271 3300013100 Ga0157373_10186999 Ga0157373_101869992 164
272 3300013100 Ga0157373_10850558 Ga0157373_108505582 164
273 3300013306 Ga0163162_11216260 Ga0163162_112162601 164
274 3300013307 Ga0157372_10052061 Ga0157372_100520611 164
275 3300013307 Ga0157372_10751819 Ga0157372_107518193 164
276 3300013307 Ga0157372_11172907 Ga0157372_111729071 164
277 3300013307 Ga0157372_11345500 Ga0157372_113455002 164
278 3300013307 Ga0157372_11512626 Ga0157372_115126261 164
279 3300013308 Ga0157375_10140088 Ga0157375_101400882 164
280 3300014325 Ga0163163_10019265 Ga0163163_100192654 164
281 3300014325 Ga0163163_10796421 Ga0163163_107964212 164
282 3300014325 Ga0163163_11147152 Ga0163163_111471522 164
283 3300014326 Ga0157380_10514661 Ga0157380_105146612 164
284 3300014968 Ga0157379_10154257 Ga0157379_101542573 164
285 3300014969 Ga0157376_10392713 Ga0157376_103927131 164
286 3300025885 Ga0207653_10005200 Ga0207653_100052002 164
287 3300025900 Ga0207710_10000291 Ga0207710_1000029111 164
288 3300025901 Ga0207688_10245893 Ga0207688_102458932 164
289 3300025904 Ga0207647_10004426 Ga0207647_100044262 164
290 3300025904 Ga0207647_10116335 Ga0207647_101163353 164
291 3300025904 Ga0207647_10146470 Ga0207647_101464702 164
292 3300025908 Ga0207643_10005258 Ga0207643_100052582 164
293 3300025911 Ga0207654_10055464 Ga0207654_100554642 164
294 3300025911 Ga0207654_10126138 Ga0207654_101261382 164
295 3300025911 Ga0207654_10353051 Ga0207654_103530512 164
296 3300025912 Ga0207707_10041783 Ga0207707_100417836 164
297 3300025912 Ga0207707_10160160 Ga0207707_101601602 164
298 3300025912 Ga0207707_10387921 Ga0207707_103879212 164
299 3300025913 Ga0207695_10121921 Ga0207695_101219211 164
300 3300025914 Ga0207671_10051644 Ga0207671_100516443 164
301 3300025914 Ga0207671_10130715 Ga0207671_101307152 164
302 3300025914 Ga0207671_10866104 Ga0207671_108661042 164
303 3300025919 Ga0207657_10869492 Ga0207657_108694921 164
304 3300025923 Ga0207681_10036514 Ga0207681_100365143 164
305 3300025924 Ga0207694_10053205 Ga0207694_100532052 164
306 3300025925 Ga0207650_10000007 Ga0207650_100000071 164
307 3300025925 Ga0207650_10567678 Ga0207650_105676782 164
308 3300025925 Ga0207650_10987326 Ga0207650_109873261 164
309 3300025927 Ga0207687_10321760 Ga0207687_103217601 164
310 3300025927 Ga0207687_10758414 Ga0207687_107584142 164
311 3300025927 Ga0207687_11025109 Ga0207687_110251091 164
312 3300025932 Ga0207690_10892563 Ga0207690_108925632 164
313 3300025933 Ga0207706_10686251 Ga0207706_106862512 164
314 3300025934 Ga0207686_10284902 Ga0207686_102849023 164
315 3300025935 Ga0207709_10011194 Ga0207709_100111942 164
316 3300025935 Ga0207709_10107335 Ga0207709_101073352 164
317 3300025935 Ga0207709_10568209 Ga0207709_105682092 164
318 3300025935 Ga0207709_10976610 Ga0207709_109766102 164
319 3300025936 Ga0207670_10221110 Ga0207670_102211102 164
320 3300025936 Ga0207670_10276996 Ga0207670_102769962 164
321 3300025938 Ga0207704_10407201 Ga0207704_104072012 164
322 3300025939 Ga0207665_10149238 Ga0207665_101492382 164
323 3300025939 Ga0207665_10736843 Ga0207665_107368432 164
324 3300025940 Ga0207691_10376662 Ga0207691_103766622 164
325 3300025940 Ga0207691_10796125 Ga0207691_107961252 164
326 3300025941 Ga0207711_10067511 Ga0207711_100675114 164
327 3300025941 Ga0207711_10875866 Ga0207711_108758662 164
328 3300025942 Ga0207689_10204395 Ga0207689_102043952 164
329 3300025942 Ga0207689_10264296 Ga0207689_102642963 164
330 3300025942 Ga0207689_10310778 Ga0207689_103107782 164
331 3300025945 Ga0207679_10772241 Ga0207679_107722412 164
332 3300025949 Ga0207667_10121607 Ga0207667_101216072 164
333 3300025960 Ga0207651_10017400 Ga0207651_100174004 164
334 3300025960 Ga0207651_10114069 Ga0207651_101140692 164
335 3300025961 Ga0207712_10010848 Ga0207712_100108486 164
336 3300025961 Ga0207712_11197615 Ga0207712_111976151 164
337 3300025981 Ga0207640_10558690 Ga0207640_105586902 164
338 3300025981 Ga0207640_10925934 Ga0207640_109259341 164
339 3300026035 Ga0207703_10035528 Ga0207703_100355282 164
340 3300026035 Ga0207703_10066390 Ga0207703_100663902 164
341 3300026035 Ga0207703_10621746 Ga0207703_106217461 164
342 3300026041 Ga0207639_10202005 Ga0207639_102020052 164
343 3300026041 Ga0207639_10878753 Ga0207639_108787531 164
344 3300026075 Ga0207708_10013886 Ga0207708_100138861 164
345 3300026075 Ga0207708_10042178 Ga0207708_100421783 164
346 3300026075 Ga0207708_10589628 Ga0207708_105896282 164
347 3300026088 Ga0207641_10260353 Ga0207641_102603531 164
348 3300026088 Ga0207641_11016013 Ga0207641_110160131 164
349 3300026089 Ga0207648_10055934 Ga0207648_100559342 164
350 3300026089 Ga0207648_10118355 Ga0207648_101183552 164
351 3300026095 Ga0207676_10014677 Ga0207676_100146772 164
352 3300026095 Ga0207676_10153725 Ga0207676_101537252 164
353 3300026095 Ga0207676_10722216 Ga0207676_107222161 164
354 3300026116 Ga0207674_10173959 Ga0207674_101739591 164
355 3300026116 Ga0207674_11104768 Ga0207674_111047681 164
356 3300026142 Ga0207698_10025182 Ga0207698_100251824 164
357 3300028380 Ga0268265_10356961 Ga0268265_103569612 164
358 3300028380 Ga0268265_10560317 Ga0268265_105603172 164
359 3300028381 Ga0268264_10027849 Ga0268264_100278492 164
360 3300028381 Ga0268264_10038533 Ga0268264_100385332 164
361 3300028381 Ga0268264_10260833 Ga0268264_102608332 164
362 3300028381 Ga0268264_10751731 Ga0268264_107517311 164
363 3300031731 Ga0307405_10020166 Ga0307405_100201662 164
364 3300031731 Ga0307405_10122340 Ga0307405_101223401 164
365 3300031824 Ga0307413_10066118 Ga0307413_100661182 164
366 3300031852 Ga0307410_10040938 Ga0307410_100409383 164
367 3300031901 Ga0307406_10013540 Ga0307406_100135402 164
368 3300031911 Ga0307412_10077603 Ga0307412_100776032 164
369 3300031911 Ga0307412_10402366 Ga0307412_104023662 164
370 3300032002 Ga0307416_100061642 Ga0307416_1000616421 164
371 3300032004 Ga0307414_10110093 Ga0307414_101100932 164
372 3300032004 Ga0307414_10298588 Ga0307414_102985881 164
373 3300032005 Ga0307411_10049939 Ga0307411_100499392 164
374 3300032126 Ga0307415_100004550 Ga0307415_1000045505 164
375 3300032126 Ga0307415_101096734 Ga0307415_1010967341 164
376 3300037418 Ga0395900_0310855 Ga0395900_0310855_669_1169 164
377 3300037466 Ga0395898_0555645 Ga0395898_0555645_128_664 164
378 3300038996 Ga0242420_005601 Ga0242420_005601_1211_1708 164
379 3300038996 Ga0242420_015287 Ga0242420_015287_290_787 164
380 3300042005 Ga0439448_0053035 Ga0439448_0053035_133_633 164
381 3300042157 Ga0439458_0038702 Ga0439458_0038702_283_783 164
382 3300044673 Ga0453683_0196205 Ga0453683_0196205_43_543 164
383 3300045051 Ga0451576_0615804 Ga0451576_0615804_187_684 164
384 3300045051 Ga0451576_2010803 Ga0451576_2010803_58_558 164
385 3300048907 Ga0496104_0256720 Ga0496104_0256720_245_862 164
386 3300048911 Ga0496108_1053906 Ga0496108_1053906_103_600 164
387 3300048913 Ga0496110_0421622 Ga0496110_0421622_65_682 164
388 3300048914 Ga0496111_0138302 Ga0496111_0138302_521_1018 164
389 3300048915 Ga0496112_0834977 Ga0496112_0834977_296_793 164
390 3300048915 Ga0496112_1108397 Ga0496112_1108397_150_647 164
391 3300048915 Ga0496112_1420923 Ga0496112_1420923_95_592 164
392 3300048916 Ga0496113_0148947 Ga0496113_0148947_506_1003 164
393 3300049127 Ga0501306_001972 Ga0501306_001972_1508_2008 164
394 3300049127 Ga0501306_002365 Ga0501306_002365_20_520 164
395 3300049127 Ga0501306_070909 Ga0501306_070909_68_565 164
396 3300049129 Ga0501309_003794 Ga0501309_003794_16_516 164
397 3300049129 Ga0501309_024542 Ga0501309_024542_111_611 164
398 3300049129 Ga0501309_043229 Ga0501309_043229_171_671 164
399 3300049132 Ga0501343_005479 Ga0501343_005479_228_728 164
400 3300049132 Ga0501343_015511 Ga0501343_015511_137_637 164
401 3300049132 Ga0501343_021187 Ga0501343_021187_62_562 164
402 3300049133 Ga0501344_06568 Ga0501344_06568_13_513 164
403 3300049134 Ga0501345_01722 Ga0501345_01722_204_704 164
404 3300049161 Ga0501305_068866 Ga0501305_068866_20_520 164
405 3300049161 Ga0501305_092260 Ga0501305_092260_14_514 164
406 3300049162 Ga0501307_007639 Ga0501307_007639_16_516 164
407 3300049162 Ga0501307_043974 Ga0501307_043974_20_520 164
408 3300049162 Ga0501307_055067 Ga0501307_055067_25_525 164
409 3300049513 Ga0501290_019043 Ga0501290_019043_34_534 164
410 3300049514 Ga0501291_038332 Ga0501291_038332_196_696 164
411 3300049514 Ga0501291_078200 Ga0501291_078200_64_564 164
412 3300049518 Ga0501295_001752 Ga0501295_001752_634_1134 164
413 3300049519 Ga0501296_001534 Ga0501296_001534_908_1408 164
414 3300049520 Ga0501297_015234 Ga0501297_015234_70_567 164
415 3300049521 Ga0501298_001496 Ga0501298_001496_1954_2454 164
416 3300049522 Ga0501299_006163 Ga0501299_006163_1307_1807 164
417 3300049523 Ga0501300_011270 Ga0501300_011270_708_1208 164
418 3300049527 Ga0501311_061141 Ga0501311_061141_20_520 164
419 3300049527 Ga0501311_082380 Ga0501311_082380_30_527 164
420 3300049528 Ga0501312_070655 Ga0501312_070655_16_516 164
421 3300049528 Ga0501312_071294 Ga0501312_071294_15_515 164
422 3300049531 Ga0501315_056295 Ga0501315_056295_110_610 164
423 3300049533 Ga0501317_062118 Ga0501317_062118_13_513 164
424 3300049536 Ga0501320_017327 Ga0501320_017327_292_792 164
425 3300049537 Ga0501321_003607 Ga0501321_003607_15_515 164
426 3300049537 Ga0501321_040587 Ga0501321_040587_132_632 164
427 3300049539 Ga0501323_029472 Ga0501323_029472_147_647 164
428 3300049541 Ga0501325_019544 Ga0501325_019544_13_513 164
429 3300049550 Ga0501334_10380 Ga0501334_10380_13_513 164
430 3300049551 Ga0501335_009185 Ga0501335_009185_229_729 164
431 3300049552 Ga0501336_007395 Ga0501336_007395_205_705 164
432 3300049552 Ga0501336_012038 Ga0501336_012038_198_698 164
433 3300049553 Ga0501337_013802 Ga0501337_013802_101_601 164
434 3300049556 Ga0501340_009041 Ga0501340_009041_81_581 164
435 3300049649 Ga0501198_008570 Ga0501198_008570_759_1259 164
436 3300049649 Ga0501198_022372 Ga0501198_022372_434_934 164
437 3300049649 Ga0501198_024111 Ga0501198_024111_322_819 164
438 3300049651 Ga0501201_008422 Ga0501201_008422_400_900 164
439 3300049652 Ga0501202_023216 Ga0501202_023216_400_900 164
440 3300049652 Ga0501202_038456 Ga0501202_038456_393_890 164
441 3300049652 Ga0501202_130969 Ga0501202_130969_118_618 164
442 3300049653 Ga0501206_014721 Ga0501206_014721_554_1054 164
443 3300049654 Ga0501207_006265 Ga0501207_006265_418_918 164
444 3300049654 Ga0501207_017534 Ga0501207_017534_211_711 164
445 3300049654 Ga0501207_039635 Ga0501207_039635_266_766 164
446 3300049656 Ga0501209_024173 Ga0501209_024173_718_1218 164
447 3300049660 Ga0501216_005806 Ga0501216_005806_785_1285 164
448 3300049660 Ga0501216_043760 Ga0501216_043760_59_559 164
449 3300049661 Ga0501217_000272 Ga0501217_000272_6430_6930 164
450 3300049661 Ga0501217_007774 Ga0501217_007774_990_1487 164
451 3300049661 Ga0501217_027858 Ga0501217_027858_403_903 164
452 3300049663 Ga0501223_003122 Ga0501223_003122_2456_2953 164
453 3300049663 Ga0501223_008588 Ga0501223_008588_1045_1545 164
454 3300049664 Ga0501224_013593 Ga0501224_013593_488_985 164
455 3300049664 Ga0501224_017743 Ga0501224_017743_79_579 164
456 3300049665 Ga0501227_000627 Ga0501227_000627_6191_6691 164
457 3300049665 Ga0501227_018313 Ga0501227_018313_357_857 164
458 3300049666 Ga0501228_036638 Ga0501228_036638_27_524 164
459 3300049667 Ga0501230_001762 Ga0501230_001762_619_1119 164
460 3300049667 Ga0501230_106121 Ga0501230_106121_10_507 164
461 3300049668 Ga0501233_016488 Ga0501233_016488_1005_1502 164
462 3300049668 Ga0501233_020546 Ga0501233_020546_206_706 164
463 3300049668 Ga0501233_021061 Ga0501233_021061_783_1283 164
464 3300049669 Ga0501235_001808 Ga0501235_001808_4003_4503 164
465 3300049669 Ga0501235_008297 Ga0501235_008297_957_1457 164
466 3300049669 Ga0501235_119498 Ga0501235_119498_23_520 164
467 3300049673 Ga0501240_059710 Ga0501240_059710_29_529 164
468 3300049673 Ga0501240_106495 Ga0501240_106495_37_534 164
469 3300049675 Ga0501243_010138 Ga0501243_010138_813_1313 164
470 3300049675 Ga0501243_011612 Ga0501243_011612_178_678 164
471 3300049676 Ga0501246_016503 Ga0501246_016503_143_643 164
472 3300049677 Ga0501247_030518 Ga0501247_030518_29_526 164
473 3300049679 Ga0501249_007843 Ga0501249_007843_669_1169 164
474 3300049679 Ga0501249_028396 Ga0501249_028396_356_856 164
475 3300049680 Ga0501250_000960 Ga0501250_000960_775_1275 164
476 3300049680 Ga0501250_040398 Ga0501250_040398_131_631 164
477 3300049681 Ga0501251_007821 Ga0501251_007821_663_1163 164
478 3300049683 Ga0501253_025145 Ga0501253_025145_489_989 164
479 3300049686 Ga0501257_025680 Ga0501257_025680_34_534 164
480 3300049688 Ga0501259_015377 Ga0501259_015377_411_911 164
481 3300049690 Ga0501261_019719 Ga0501261_019719_67_564 164
482 3300049704 Ga0501221_009074 Ga0501221_009074_553_1053 164
483 3300049705 Ga0501225_0007355 Ga0501225_0007355_1642_2142 164
484 3300049705 Ga0501225_0040500 Ga0501225_0040500_122_622 164
485 3300049705 Ga0501225_0092555 Ga0501225_0092555_32_532 164
486 3300049706 Ga0501229_026747 Ga0501229_026747_100_597 164
487 3300049707 Ga0501234_014225 Ga0501234_014225_426_926 164
488 3300049707 Ga0501234_019526 Ga0501234_019526_35_535 164
489 3300049708 Ga0501245_011544 Ga0501245_011544_576_1076 164
490 3300049760 Ga0501263_010458 Ga0501263_010458_583_1083 164
491 3300049765 Ga0501268_021034 Ga0501268_021034_94_594 164
492 3300049768 Ga0501271_002012 Ga0501271_002012_775_1275 164
493 3300049769 Ga0501272_004202 Ga0501272_004202_776_1276 164
494 3300049770 Ga0501273_002151 Ga0501273_002151_1259_1759 164
495 3300049771 Ga0501274_009820 Ga0501274_009820_79_579 164
496 3300049773 Ga0501276_014803 Ga0501276_014803_155_655 164
497 3300049775 Ga0501279_027183 Ga0501279_027183_127_624 164
498 3300049779 Ga0501283_001783 Ga0501283_001783_147_647 164
499 3300049779 Ga0501283_009913 Ga0501283_009913_163_663 164
500 3300049851 Ga0501212_009800 Ga0501212_009800_143_643 164
501 3300049853 Ga0501226_005756 Ga0501226_005756_67_564 164
502 3300050507 nmdc:mga05p37_49976_c1 nmdc:mga05p37_49976_c1_76_576 164
503 3300050512 nmdc:mga0n895_122789_c1 nmdc:mga0n895_122789_c1_1662_2204 164
504 3300050515 nmdc:mga0a205_36669_c2 nmdc:mga0a205_36669_c2_3319_3819 164
505 3300050515 nmdc:mga0a205_58137_c1 nmdc:mga0a205_58137_c1_2778_3320 164
506 3300059507 Ga0587086_087920 Ga0587086_087920_17_514 164
507 2162886007 SwRhRL2b_contig_2076090 SwRhRL2b_0304.00003660 165
508 3300005289 Ga0065704_10084601 Ga0065704_100846012 165
509 3300005290 Ga0065712_10461956 Ga0065712_104619561 165
510 3300005295 Ga0065707_10003499 Ga0065707_100034992 165
511 3300005344 Ga0070661_100760467 Ga0070661_1007604671 165
512 3300005364 Ga0070673_101519551 Ga0070673_1015195511 165
513 3300005471 Ga0070698_100039997 Ga0070698_1000399974 165
514 3300005518 Ga0070699_100361073 Ga0070699_1003610732 165
515 3300005536 Ga0070697_100160187 Ga0070697_1001601872 165
516 3300005564 Ga0070664_101582683 Ga0070664_1015826831 165
517 3300005577 Ga0068857_100029693 Ga0068857_1000296933 165
518 3300005577 Ga0068857_100900180 Ga0068857_1009001801 165
519 3300005618 Ga0068864_100014735 Ga0068864_1000147353 165
520 3300005841 Ga0068863_100295491 Ga0068863_1002954911 165
521 3300005843 Ga0068860_100931109 Ga0068860_1009311091 165
522 3300005985 Ga0081539_10036177 Ga0081539_100361772 165
523 3300009094 Ga0111539_10001110 Ga0111539_1000111019 165
524 3300009101 Ga0105247_10641551 Ga0105247_106415511 165
525 3300009174 Ga0105241_11093166 Ga0105241_110931662 165
526 3300009551 Ga0105238_10095434 Ga0105238_100954343 165
527 3300010375 Ga0105239_10679333 Ga0105239_106793331 165
528 3300013297 Ga0157378_10433528 Ga0157378_104335282 165
529 3300025924 Ga0207694_10063974 Ga0207694_100639742 165
530 3300025942 Ga0207689_10989810 Ga0207689_109898102 165
531 3300026088 Ga0207641_11307772 Ga0207641_113077721 165
532 3300026095 Ga0207676_10090221 Ga0207676_100902213 165
533 3300026116 Ga0207674_10033731 Ga0207674_100337313 165
534 3300026116 Ga0207674_11033717 Ga0207674_110337171 165
535 3300027907 Ga0207428_10020242 Ga0207428_100202424 165
536 3300028381 Ga0268264_10769393 Ga0268264_107693932 165
537 3300028381 Ga0268264_11478470 Ga0268264_114784701 165
538 3300031548 Ga0307408_100543519 Ga0307408_1005435191 165
539 3300031731 Ga0307405_10285068 Ga0307405_102850682 165
540 3300031824 Ga0307413_10235009 Ga0307413_102350092 165
541 3300031852 Ga0307410_10076197 Ga0307410_100761972 165
542 3300031911 Ga0307412_10045754 Ga0307412_100457542 165
543 3300031995 Ga0307409_100169508 Ga0307409_1001695081 165
544 3300032002 Ga0307416_100038058 Ga0307416_1000380584 165
545 3300032004 Ga0307414_10101570 Ga0307414_101015702 165
546 3300049516 Ga0501293_015297 Ga0501293_015297_96_599 165
547 3300049522 Ga0501299_011471 Ga0501299_011471_156_659 165
548 3300049649 Ga0501198_004990 Ga0501198_004990_18_521 165
549 3300049654 Ga0501207_001884 Ga0501207_001884_540_1043 165
550 3300049663 Ga0501223_013459 Ga0501223_013459_774_1277 165
551 3300049767 Ga0501270_006880 Ga0501270_006880_720_1223 165
552 3300049771 Ga0501274_010871 Ga0501274_010871_265_768 165
553 3300050511 nmdc:mga08y16_606_c1 nmdc:mga08y16_606_c1_9391_9888 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10517

DM13

Electron transfer DM13

53

155

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h3h-assembly1.cif.gz_A crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution 0.6266 46 128
3km1-assembly1.cif.gz_B zinc-reconstituted tomato chloroplast superoxide dismutase 0.6236 47 154
7wx0-assembly1.cif.gz_B e40k variant of cu/zn-superoxide dismutase from dog (canis familiaris) 0.6223 45 154
1xtl-assembly4.cif.gz_B crystal structure of p104h mutant of sod-like protein from bacillus subtilis. 0.6061 51 157
1xtm-assembly1.cif.gz_B crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis. 0.6007 47 157
ID Description Score Start End Superfamily
af_F4I2N7_648_756_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9614 63 79 3.30.200.20
af_A0A1D6JYK5_395_630_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8689 63 79 3.40.1110.10
af_Q2G2G0_55_145_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.8201 54 155 2.60.120.430
af_Q9VXG6_732_895_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.8057 46 79 3.40.1110.10
af_Q2G2G0_55_145_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.8036 54 155 2.60.120.430
ID Description Score Start End GO Terms
AF-A0A3D6EXX9-F1-model_v4 DM13 domain-containing protein 0.9337 33 156
AF-A0A832BN76-F1-model_v4 DM13 domain-containing protein 0.9294 47 154
AF-A0A328LQY9-F1-model_v4 DM13 domain-containing protein 0.928 51 157
AF-A0A3B8WDN3-F1-model_v4 DM13 domain-containing protein 0.9257 31 154
AF-A0A385SIT6-F1-model_v4 DM13 domain-containing protein 0.9245 31 156

Feature Viewer

pLDDT pTM Quality
76 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map