F462817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 248 | 553 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10084601|Ga0065704_100846012 |
| Length | 165 |
| Sequence | MSNRLKVILLALIVVVGAAWYAFRPDRIFTNQRVNEQFPTASAAMSTQLAAGEFHSGAHETKGTATVFQLADGKKTLRLTNFATSNGPDVHVYLVAATDAKDNAVTNAGFVDLGSLKGNIGDQNYELPANADLAKYRAVTIWCKRFSVNFGTAPLNSAMQSMNVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 154 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 155 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 177 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 178 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 179 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 180 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 181 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 182 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 183 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 184 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 185 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 203 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 204 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 205 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 208 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 212 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 213 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 216 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 217 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 218 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 221 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 223 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 224 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 227 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 229 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 231 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 232 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 233 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 234 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 236 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 237 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 238 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 239 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 240 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 241 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.59 |
| Metatranscriptomes | 7.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.99 |
| Rhizosphere | 97.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2076090 | 2162886007 | Unclassified | 2981 |
| 2 | JGI24736J21556_1008527 | 3300001904 | Bacteria | 1703 |
| 3 | JGI24751J29686_10000179 | 3300002459 | Bacteria | 29149 |
| 4 | JGI25406J46586_10017735 | 3300003203 | Bacteria | 2937 |
| 5 | JGI25406J46586_10041338 | 3300003203 | Bacteria | 1624 |
| 6 | rootH2_10242219 | 3300003320 | Bacteria | 1134 |
| 7 | Ga0065714_10064440 | 3300005288 | Bacteria | 109986 |
| 8 | Ga0065704_10084601 | 3300005289 | Unclassified | 3316 |
| 9 | Ga0065704_10369489 | 3300005289 | Bacteria | 772 |
| 10 | Ga0065712_10000120 | 3300005290 | Bacteria | 105792 |
| 11 | Ga0065712_10032263 | 3300005290 | Bacteria | 1440 |
| 12 | Ga0065712_10080463 | 3300005290 | Bacteria | 3103 |
| 13 | Ga0065712_10235170 | 3300005290 | Bacteria | 1000 |
| 14 | Ga0065712_10266639 | 3300005290 | Bacteria | 918 |
| 15 | Ga0065712_10461956 | 3300005290 | Bacteria | 677 |
| 16 | Ga0065715_10045410 | 3300005293 | Bacteria | 1310 |
| 17 | Ga0065715_10090220 | 3300005293 | Bacteria | 7427 |
| 18 | Ga0065715_10091105 | 3300005293 | Bacteria | 6105 |
| 19 | Ga0065715_10096605 | 3300005293 | Bacteria | 3850 |
| 20 | Ga0065715_10109897 | 3300005293 | Bacteria | 2646 |
| 21 | Ga0065715_10352974 | 3300005293 | Unclassified | 928 |
| 22 | Ga0065715_10434764 | 3300005293 | Bacteria | 810 |
| 23 | Ga0065715_10493834 | 3300005293 | Bacteria | 786 |
| 24 | Ga0065707_10003499 | 3300005295 | Bacteria | 5998 |
| 25 | Ga0065707_10110990 | 3300005295 | Bacteria | 2401 |
| 26 | Ga0070676_10651264 | 3300005328 | Bacteria | 765 |
| 27 | Ga0070670_100000188 | 3300005331 | Bacteria | 56512 |
| 28 | Ga0070670_100067788 | 3300005331 | Bacteria | 3062 |
| 29 | Ga0068869_100214069 | 3300005334 | Bacteria | 1525 |
| 30 | Ga0068869_100306854 | 3300005334 | Bacteria | 1283 |
| 31 | Ga0068869_100571872 | 3300005334 | Bacteria | 952 |
| 32 | Ga0068869_101254875 | 3300005334 | Bacteria | 653 |
| 33 | Ga0070666_11159879 | 3300005335 | Unclassified | 575 |
| 34 | Ga0070680_100105569 | 3300005336 | Bacteria | 2341 |
| 35 | Ga0070682_100006213 | 3300005337 | Bacteria | 6695 |
| 36 | Ga0070682_100563575 | 3300005337 | Bacteria | 893 |
| 37 | Ga0068868_100548998 | 3300005338 | Bacteria | 1018 |
| 38 | Ga0070687_100574065 | 3300005343 | Unclassified | 771 |
| 39 | Ga0070687_100713555 | 3300005343 | Unclassified | 702 |
| 40 | Ga0070661_100037957 | 3300005344 | Bacteria | 3506 |
| 41 | Ga0070661_100760467 | 3300005344 | Bacteria | 793 |
| 42 | Ga0070692_10084724 | 3300005345 | Bacteria | 1713 |
| 43 | Ga0070669_100080582 | 3300005353 | Bacteria | 2423 |
| 44 | Ga0070669_100845167 | 3300005353 | Unclassified | 780 |
| 45 | Ga0070675_100810057 | 3300005354 | Bacteria | 856 |
| 46 | Ga0070675_100958173 | 3300005354 | Unclassified | 785 |
| 47 | Ga0070671_100075842 | 3300005355 | Unclassified | 2809 |
| 48 | Ga0070673_100024940 | 3300005364 | Bacteria | 4392 |
| 49 | Ga0070673_100088944 | 3300005364 | Bacteria | 2520 |
| 50 | Ga0070673_101519551 | 3300005364 | Unclassified | 632 |
| 51 | Ga0070673_101767336 | 3300005364 | Unclassified | 586 |
| 52 | Ga0070659_100108442 | 3300005366 | Bacteria | 2240 |
| 53 | Ga0070703_10012555 | 3300005406 | Bacteria | 2400 |
| 54 | Ga0070703_10053666 | 3300005406 | Bacteria | 1297 |
| 55 | Ga0070714_100025283 | 3300005435 | Unclassified | 4898 |
| 56 | Ga0070701_10023785 | 3300005438 | Bacteria | 2955 |
| 57 | Ga0070705_100020961 | 3300005440 | Bacteria | 3470 |
| 58 | Ga0070705_100417478 | 3300005440 | Unclassified | 998 |
| 59 | Ga0070705_101344027 | 3300005440 | Unclassified | 594 |
| 60 | Ga0070700_100011925 | 3300005441 | Bacteria | 4828 |
| 61 | Ga0070700_101618028 | 3300005441 | Unclassified | 554 |
| 62 | Ga0070694_100014470 | 3300005444 | Bacteria | 4940 |
| 63 | Ga0070694_100015767 | 3300005444 | Bacteria | 4753 |
| 64 | Ga0070694_100324134 | 3300005444 | Bacteria | 1186 |
| 65 | Ga0070694_100565728 | 3300005444 | Bacteria | 912 |
| 66 | Ga0070694_100886737 | 3300005444 | Bacteria | 736 |
| 67 | Ga0070708_100000311 | 3300005445 | Bacteria | 36596 |
| 68 | Ga0070681_10004020 | 3300005458 | Bacteria | 13871 |
| 69 | Ga0070681_10091319 | 3300005458 | Bacteria | 2995 |
| 70 | Ga0070681_10142360 | 3300005458 | Bacteria | 2327 |
| 71 | Ga0068867_100030742 | 3300005459 | Bacteria | 3874 |
| 72 | Ga0068867_100130124 | 3300005459 | Bacteria | 1955 |
| 73 | Ga0070706_100001871 | 3300005467 | Bacteria | 21735 |
| 74 | Ga0070706_100110752 | 3300005467 | Bacteria | 2555 |
| 75 | Ga0070707_100072312 | 3300005468 | Bacteria | 3323 |
| 76 | Ga0070698_100003522 | 3300005471 | Bacteria | 17232 |
| 77 | Ga0070698_100003912 | 3300005471 | Bacteria | 16380 |
| 78 | Ga0070698_100039997 | 3300005471 | Bacteria | 4821 |
| 79 | Ga0070698_101564630 | 3300005471 | Bacteria | 611 |
| 80 | Ga0070699_100006602 | 3300005518 | Bacteria | 10086 |
| 81 | Ga0070699_100361073 | 3300005518 | Bacteria | 1309 |
| 82 | Ga0070679_100023851 | 3300005530 | Bacteria | 5994 |
| 83 | Ga0070697_100000082 | 3300005536 | Bacteria | 77550 |
| 84 | Ga0070697_100051584 | 3300005536 | Bacteria | 3342 |
| 85 | Ga0070697_100160187 | 3300005536 | Bacteria | 1901 |
| 86 | Ga0070697_100592645 | 3300005536 | Bacteria | 974 |
| 87 | Ga0068853_100017115 | 3300005539 | Bacteria | 5979 |
| 88 | Ga0068853_100061098 | 3300005539 | Bacteria | 3259 |
| 89 | Ga0068853_100245341 | 3300005539 | Bacteria | 1642 |
| 90 | Ga0070695_100025154 | 3300005545 | Unclassified | 3674 |
| 91 | Ga0070695_100237117 | 3300005545 | Bacteria | 1321 |
| 92 | Ga0070695_100721390 | 3300005545 | Unclassified | 793 |
| 93 | Ga0070695_100836106 | 3300005545 | Bacteria | 740 |
| 94 | Ga0070696_100561712 | 3300005546 | Bacteria | 916 |
| 95 | Ga0070704_100039783 | 3300005549 | Bacteria | 3230 |
| 96 | Ga0070704_100159989 | 3300005549 | Bacteria | 1780 |
| 97 | Ga0070704_100448371 | 3300005549 | Bacteria | 1110 |
| 98 | Ga0070704_100584283 | 3300005549 | Bacteria | 980 |
| 99 | Ga0070704_101055155 | 3300005549 | Bacteria | 737 |
| 100 | Ga0068855_100304988 | 3300005563 | Bacteria | 1763 |
| 101 | Ga0070664_101582683 | 3300005564 | Bacteria | 621 |
| 102 | Ga0068857_100007599 | 3300005577 | Bacteria | 9330 |
| 103 | Ga0068857_100029693 | 3300005577 | Bacteria | 4825 |
| 104 | Ga0068857_100124039 | 3300005577 | Bacteria | 2327 |
| 105 | Ga0068857_100900180 | 3300005577 | Bacteria | 848 |
| 106 | Ga0068854_100193209 | 3300005578 | Bacteria | 1596 |
| 107 | Ga0068854_100695383 | 3300005578 | Bacteria | 877 |
| 108 | Ga0068854_101065505 | 3300005578 | Bacteria | 719 |
| 109 | Ga0070702_100027019 | 3300005615 | Bacteria | 3092 |
| 110 | Ga0070702_100188428 | 3300005615 | Bacteria | 1355 |
| 111 | Ga0070702_100251893 | 3300005615 | Bacteria | 1197 |
| 112 | Ga0070702_100461246 | 3300005615 | Bacteria | 924 |
| 113 | Ga0068852_100082494 | 3300005616 | Bacteria | 2857 |
| 114 | Ga0068859_100003607 | 3300005617 | Bacteria | 15781 |
| 115 | Ga0068859_100023360 | 3300005617 | Bacteria | 6207 |
| 116 | Ga0068859_100086330 | 3300005617 | Bacteria | 3184 |
| 117 | Ga0068859_100348971 | 3300005617 | Bacteria | 1575 |
| 118 | Ga0068859_100386770 | 3300005617 | Bacteria | 1495 |
| 119 | Ga0068859_100420507 | 3300005617 | Bacteria | 1433 |
| 120 | Ga0068859_100611332 | 3300005617 | Bacteria | 1183 |
| 121 | Ga0068859_100657456 | 3300005617 | Bacteria | 1140 |
| 122 | Ga0068864_100014735 | 3300005618 | Bacteria | 6494 |
| 123 | Ga0068864_100044473 | 3300005618 | Unclassified | 3807 |
| 124 | Ga0068864_100098800 | 3300005618 | Bacteria | 2585 |
| 125 | Ga0068864_100165786 | 3300005618 | Bacteria | 2011 |
| 126 | Ga0068864_100613361 | 3300005618 | Bacteria | 1057 |
| 127 | Ga0068864_100837412 | 3300005618 | Unclassified | 906 |
| 128 | Ga0068864_101286223 | 3300005618 | Bacteria | 731 |
| 129 | Ga0068864_101374613 | 3300005618 | Unclassified | 707 |
| 130 | Ga0068851_10066056 | 3300005834 | Unclassified | 1863 |
| 131 | Ga0068870_10011636 | 3300005840 | Bacteria | 4088 |
| 132 | Ga0068870_10229793 | 3300005840 | Unclassified | 1140 |
| 133 | Ga0068870_10410105 | 3300005840 | Bacteria | 884 |
| 134 | Ga0068863_100070159 | 3300005841 | Bacteria | 3314 |
| 135 | Ga0068863_100295491 | 3300005841 | Bacteria | 1571 |
| 136 | Ga0068863_100306861 | 3300005841 | Bacteria | 1540 |
| 137 | Ga0068863_100340929 | 3300005841 | Bacteria | 1458 |
| 138 | Ga0068863_100566505 | 3300005841 | Bacteria | 1122 |
| 139 | Ga0068858_100062528 | 3300005842 | Bacteria | 3442 |
| 140 | Ga0068858_100069703 | 3300005842 | Bacteria | 3259 |
| 141 | Ga0068858_100121070 | 3300005842 | Unclassified | 2447 |
| 142 | Ga0068858_100155516 | 3300005842 | Unclassified | 2151 |
| 143 | Ga0068858_100156710 | 3300005842 | Bacteria | 2143 |
| 144 | Ga0068858_100252085 | 3300005842 | Bacteria | 1677 |
| 145 | Ga0068858_100270604 | 3300005842 | Bacteria | 1617 |
| 146 | Ga0068860_100017324 | 3300005843 | Bacteria | 7019 |
| 147 | Ga0068860_100079084 | 3300005843 | Bacteria | 3127 |
| 148 | Ga0068860_100139821 | 3300005843 | Bacteria | 2326 |
| 149 | Ga0068860_100493492 | 3300005843 | Bacteria | 1222 |
| 150 | Ga0068860_100931109 | 3300005843 | Bacteria | 886 |
| 151 | Ga0068860_101198281 | 3300005843 | Bacteria | 779 |
| 152 | Ga0081455_10256151 | 3300005937 | Bacteria | 1277 |
| 153 | Ga0081539_10001316 | 3300005985 | Bacteria | 43426 |
| 154 | Ga0081539_10007208 | 3300005985 | Bacteria | 10235 |
| 155 | Ga0081539_10036177 | 3300005985 | Bacteria | 2958 |
| 156 | Ga0081539_10112844 | 3300005985 | Bacteria | 1364 |
| 157 | Ga0070715_10000002 | 3300006163 | Bacteria | 389554 |
| 158 | Ga0070712_100576502 | 3300006175 | Bacteria | 950 |
| 159 | Ga0097621_100006835 | 3300006237 | Bacteria | 8107 |
| 160 | Ga0097621_100027684 | 3300006237 | Bacteria | 4460 |
| 161 | Ga0097621_100821699 | 3300006237 | Bacteria | 862 |
| 162 | Ga0068871_100029282 | 3300006358 | Bacteria | 4322 |
| 163 | Ga0075433_10127954 | 3300006852 | Bacteria | 2256 |
| 164 | Ga0075434_100025315 | 3300006871 | Bacteria | 5806 |
| 165 | Ga0075434_100188043 | 3300006871 | Unclassified | 2085 |
| 166 | Ga0075434_100284157 | 3300006871 | Bacteria | 1674 |
| 167 | Ga0075429_100061539 | 3300006880 | Bacteria | 3270 |
| 168 | Ga0075436_100053070 | 3300006914 | Bacteria | 2798 |
| 169 | Ga0097620_100003607 | 3300006931 | Bacteria | 15781 |
| 170 | Ga0097620_100023362 | 3300006931 | Bacteria | 6207 |
| 171 | Ga0097620_100086335 | 3300006931 | Bacteria | 3184 |
| 172 | Ga0097620_100348976 | 3300006931 | Bacteria | 1575 |
| 173 | Ga0097620_100386761 | 3300006931 | Bacteria | 1495 |
| 174 | Ga0097620_100420521 | 3300006931 | Bacteria | 1433 |
| 175 | Ga0097620_100611277 | 3300006931 | Bacteria | 1183 |
| 176 | Ga0097620_100657415 | 3300006931 | Bacteria | 1140 |
| 177 | Ga0105251_10045443 | 3300009011 | Bacteria | 2117 |
| 178 | Ga0105240_10273656 | 3300009093 | Unclassified | 1943 |
| 179 | Ga0105240_10796373 | 3300009093 | Bacteria | 1024 |
| 180 | Ga0111539_10001110 | 3300009094 | Bacteria | 35527 |
| 181 | Ga0105245_10303943 | 3300009098 | Bacteria | 1566 |
| 182 | Ga0105245_10641929 | 3300009098 | Unclassified | 1091 |
| 183 | Ga0105245_11082842 | 3300009098 | Bacteria | 847 |
| 184 | Ga0105245_11745229 | 3300009098 | Unclassified | 675 |
| 185 | Ga0105245_12258921 | 3300009098 | Unclassified | 598 |
| 186 | Ga0105247_10000326 | 3300009101 | Bacteria | 42400 |
| 187 | Ga0105247_10031464 | 3300009101 | Unclassified | 3220 |
| 188 | Ga0105247_10071196 | 3300009101 | Bacteria | 2174 |
| 189 | Ga0105247_10641551 | 3300009101 | Bacteria | 792 |
| 190 | Ga0105247_11260410 | 3300009101 | Unclassified | 592 |
| 191 | Ga0105247_11345650 | 3300009101 | Bacteria | 575 |
| 192 | Ga0114129_10030268 | 3300009147 | Bacteria | 7663 |
| 193 | Ga0114129_10187983 | 3300009147 | Bacteria | 2806 |
| 194 | Ga0114129_11109037 | 3300009147 | Bacteria | 990 |
| 195 | Ga0105243_10001215 | 3300009148 | Bacteria | 23194 |
| 196 | Ga0105243_10034462 | 3300009148 | Bacteria | 3919 |
| 197 | Ga0105243_10040245 | 3300009148 | Archaea | 3648 |
| 198 | Ga0105243_10254513 | 3300009148 | Bacteria | 1569 |
| 199 | Ga0105243_10920380 | 3300009148 | Bacteria | 871 |
| 200 | Ga0105243_11792793 | 3300009148 | Unclassified | 645 |
| 201 | Ga0105241_10033380 | 3300009174 | Bacteria | 3864 |
| 202 | Ga0105241_10071817 | 3300009174 | Bacteria | 2688 |
| 203 | Ga0105241_10079793 | 3300009174 | Bacteria | 2560 |
| 204 | Ga0105241_10102755 | 3300009174 | Bacteria | 2275 |
| 205 | Ga0105241_10121684 | 3300009174 | Bacteria | 2102 |
| 206 | Ga0105241_10558613 | 3300009174 | Bacteria | 1029 |
| 207 | Ga0105241_11093166 | 3300009174 | Unclassified | 750 |
| 208 | Ga0105242_10003233 | 3300009176 | Bacteria | 12700 |
| 209 | Ga0105242_10293770 | 3300009176 | Bacteria | 1481 |
| 210 | Ga0105248_10002791 | 3300009177 | Bacteria | 19407 |
| 211 | Ga0105248_10022887 | 3300009177 | Bacteria | 6938 |
| 212 | Ga0105248_10038646 | 3300009177 | Bacteria | 5342 |
| 213 | Ga0105248_10236121 | 3300009177 | Unclassified | 2058 |
| 214 | Ga0105248_10482372 | 3300009177 | Bacteria | 1397 |
| 215 | Ga0105237_10003293 | 3300009545 | Bacteria | 19288 |
| 216 | Ga0105237_10239894 | 3300009545 | Bacteria | 1814 |
| 217 | Ga0105237_10808157 | 3300009545 | Bacteria | 944 |
| 218 | Ga0105237_12008799 | 3300009545 | Bacteria | 587 |
| 219 | Ga0105238_10095434 | 3300009551 | Unclassified | 2961 |
| 220 | Ga0105238_10329272 | 3300009551 | Unclassified | 1514 |
| 221 | Ga0105249_10010826 | 3300009553 | Bacteria | 8014 |
| 222 | Ga0105249_11398597 | 3300009553 | Unclassified | 772 |
| 223 | Ga0105239_10099847 | 3300010375 | Bacteria | 3209 |
| 224 | Ga0105239_10303470 | 3300010375 | Bacteria | 1798 |
| 225 | Ga0105239_10381770 | 3300010375 | Bacteria | 1593 |
| 226 | Ga0105239_10408373 | 3300010375 | Bacteria | 1537 |
| 227 | Ga0105239_10678799 | 3300010375 | Bacteria | 1177 |
| 228 | Ga0105239_10679333 | 3300010375 | Bacteria | 1177 |
| 229 | Ga0105246_10335123 | 3300011119 | Bacteria | 1234 |
| 230 | Ga0105246_11174519 | 3300011119 | Bacteria | 705 |
| 231 | Ga0157373_10023592 | 3300013100 | Bacteria | 4458 |
| 232 | Ga0157373_10169252 | 3300013100 | Bacteria | 1537 |
| 233 | Ga0157373_10186999 | 3300013100 | Bacteria | 1459 |
| 234 | Ga0157373_10850558 | 3300013100 | Archaea | 675 |
| 235 | Ga0157378_10000105 | 3300013297 | Bacteria | 79945 |
| 236 | Ga0157378_10433528 | 3300013297 | Bacteria | 1301 |
| 237 | Ga0163162_10428131 | 3300013306 | Bacteria | 1455 |
| 238 | Ga0163162_11216260 | 3300013306 | Bacteria | 855 |
| 239 | Ga0157372_10052061 | 3300013307 | Bacteria | 4557 |
| 240 | Ga0157372_10751819 | 3300013307 | Bacteria | 1134 |
| 241 | Ga0157372_10837672 | 3300013307 | Bacteria | 1068 |
| 242 | Ga0157372_11172907 | 3300013307 | Unclassified | 888 |
| 243 | Ga0157372_11345500 | 3300013307 | Bacteria | 824 |
| 244 | Ga0157372_11512626 | 3300013307 | Unclassified | 773 |
| 245 | Ga0157375_10005309 | 3300013308 | Bacteria | 11193 |
| 246 | Ga0157375_10140088 | 3300013308 | Bacteria | 2545 |
| 247 | Ga0157375_10200809 | 3300013308 | Bacteria | 2150 |
| 248 | Ga0163163_10019265 | 3300014325 | Bacteria | 6406 |
| 249 | Ga0163163_10290364 | 3300014325 | Bacteria | 1687 |
| 250 | Ga0163163_10796421 | 3300014325 | Bacteria | 1008 |
| 251 | Ga0163163_11034322 | 3300014325 | Unclassified | 885 |
| 252 | Ga0163163_11147152 | 3300014325 | Bacteria | 840 |
| 253 | Ga0163163_12543604 | 3300014325 | Unclassified | 570 |
| 254 | Ga0157380_10514661 | 3300014326 | Bacteria | 1166 |
| 255 | Ga0157377_10092959 | 3300014745 | Bacteria | 1784 |
| 256 | Ga0157379_10018565 | 3300014968 | Bacteria | 6134 |
| 257 | Ga0157379_10154257 | 3300014968 | Bacteria | 2071 |
| 258 | Ga0157376_10392713 | 3300014969 | Bacteria | 1339 |
| 259 | Ga0207653_10005200 | 3300025885 | Bacteria | 4067 |
| 260 | Ga0207710_10000291 | 3300025900 | Bacteria | 40580 |
| 261 | Ga0207710_10320044 | 3300025900 | Bacteria | 786 |
| 262 | Ga0207688_10245893 | 3300025901 | Bacteria | 1083 |
| 263 | Ga0207647_10004426 | 3300025904 | Bacteria | 10414 |
| 264 | Ga0207647_10116335 | 3300025904 | Bacteria | 1578 |
| 265 | Ga0207647_10146470 | 3300025904 | Bacteria | 1382 |
| 266 | Ga0207685_10000030 | 3300025905 | Bacteria | 89606 |
| 267 | Ga0207643_10005258 | 3300025908 | Bacteria | 6921 |
| 268 | Ga0207684_10005120 | 3300025910 | Bacteria | 12210 |
| 269 | Ga0207684_10112357 | 3300025910 | Bacteria | 2332 |
| 270 | Ga0207654_10055464 | 3300025911 | Unclassified | 2294 |
| 271 | Ga0207654_10126138 | 3300025911 | Bacteria | 1614 |
| 272 | Ga0207654_10353051 | 3300025911 | Bacteria | 1013 |
| 273 | Ga0207707_10041783 | 3300025912 | Bacteria | 4004 |
| 274 | Ga0207707_10160160 | 3300025912 | Unclassified | 1968 |
| 275 | Ga0207707_10387921 | 3300025912 | Bacteria | 1200 |
| 276 | Ga0207695_10121921 | 3300025913 | Bacteria | 2574 |
| 277 | Ga0207671_10051644 | 3300025914 | Bacteria | 3047 |
| 278 | Ga0207671_10130715 | 3300025914 | Bacteria | 1927 |
| 279 | Ga0207671_10866104 | 3300025914 | Unclassified | 715 |
| 280 | Ga0207657_10869492 | 3300025919 | Bacteria | 695 |
| 281 | Ga0207652_10858357 | 3300025921 | Bacteria | 804 |
| 282 | Ga0207646_10412493 | 3300025922 | Unclassified | 1219 |
| 283 | Ga0207681_10036514 | 3300025923 | Bacteria | 3242 |
| 284 | Ga0207694_10053205 | 3300025924 | Bacteria | 3139 |
| 285 | Ga0207694_10063974 | 3300025924 | Bacteria | 2866 |
| 286 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 287 | Ga0207650_10567678 | 3300025925 | Unclassified | 952 |
| 288 | Ga0207650_10987326 | 3300025925 | Unclassified | 716 |
| 289 | Ga0207687_10321760 | 3300025927 | Bacteria | 1252 |
| 290 | Ga0207687_10758414 | 3300025927 | Bacteria | 826 |
| 291 | Ga0207687_11025109 | 3300025927 | Unclassified | 708 |
| 292 | Ga0207664_10423110 | 3300025929 | Bacteria | 1187 |
| 293 | Ga0207690_10892563 | 3300025932 | Unclassified | 737 |
| 294 | Ga0207706_10686251 | 3300025933 | Bacteria | 875 |
| 295 | Ga0207686_10011703 | 3300025934 | Archaea | 4812 |
| 296 | Ga0207686_10284902 | 3300025934 | Bacteria | 1221 |
| 297 | Ga0207709_10011194 | 3300025935 | Bacteria | 4947 |
| 298 | Ga0207709_10011268 | 3300025935 | Unclassified | 4932 |
| 299 | Ga0207709_10107335 | 3300025935 | Bacteria | 1859 |
| 300 | Ga0207709_10568209 | 3300025935 | Bacteria | 894 |
| 301 | Ga0207709_10976610 | 3300025935 | Bacteria | 691 |
| 302 | Ga0207670_10221110 | 3300025936 | Bacteria | 1450 |
| 303 | Ga0207670_10276996 | 3300025936 | Bacteria | 1306 |
| 304 | Ga0207704_10407201 | 3300025938 | Bacteria | 1075 |
| 305 | Ga0207665_10149238 | 3300025939 | Unclassified | 1673 |
| 306 | Ga0207665_10736843 | 3300025939 | Bacteria | 776 |
| 307 | Ga0207691_10376662 | 3300025940 | Bacteria | 1212 |
| 308 | Ga0207691_10379423 | 3300025940 | Bacteria | 1207 |
| 309 | Ga0207691_10796125 | 3300025940 | Bacteria | 794 |
| 310 | Ga0207711_10067511 | 3300025941 | Unclassified | 3096 |
| 311 | Ga0207711_10081221 | 3300025941 | Bacteria | 2833 |
| 312 | Ga0207711_10248318 | 3300025941 | Bacteria | 1633 |
| 313 | Ga0207711_10875866 | 3300025941 | Bacteria | 835 |
| 314 | Ga0207689_10204395 | 3300025942 | Bacteria | 1631 |
| 315 | Ga0207689_10264296 | 3300025942 | Bacteria | 1424 |
| 316 | Ga0207689_10299469 | 3300025942 | Bacteria | 1333 |
| 317 | Ga0207689_10310778 | 3300025942 | Bacteria | 1307 |
| 318 | Ga0207689_10989810 | 3300025942 | Bacteria | 709 |
| 319 | Ga0207679_10772241 | 3300025945 | Bacteria | 875 |
| 320 | Ga0207667_10121607 | 3300025949 | Bacteria | 2690 |
| 321 | Ga0207651_10017400 | 3300025960 | Bacteria | 4248 |
| 322 | Ga0207651_10114069 | 3300025960 | Bacteria | 2035 |
| 323 | Ga0207712_10010848 | 3300025961 | Bacteria | 5798 |
| 324 | Ga0207712_11197615 | 3300025961 | Unclassified | 678 |
| 325 | Ga0207640_10558690 | 3300025981 | Bacteria | 963 |
| 326 | Ga0207640_10925934 | 3300025981 | Bacteria | 763 |
| 327 | Ga0207703_10035528 | 3300026035 | Bacteria | 3960 |
| 328 | Ga0207703_10066390 | 3300026035 | Bacteria | 2968 |
| 329 | Ga0207703_10101601 | 3300026035 | Unclassified | 2438 |
| 330 | Ga0207703_10179388 | 3300026035 | Unclassified | 1868 |
| 331 | Ga0207703_10621746 | 3300026035 | Bacteria | 1023 |
| 332 | Ga0207703_11646732 | 3300026035 | Unclassified | 617 |
| 333 | Ga0207639_10202005 | 3300026041 | Bacteria | 1705 |
| 334 | Ga0207639_10878753 | 3300026041 | Bacteria | 837 |
| 335 | Ga0207708_10013886 | 3300026075 | Bacteria | 6020 |
| 336 | Ga0207708_10042178 | 3300026075 | Bacteria | 3479 |
| 337 | Ga0207708_10374018 | 3300026075 | Bacteria | 1173 |
| 338 | Ga0207708_10589628 | 3300026075 | Unclassified | 941 |
| 339 | Ga0207641_10260353 | 3300026088 | Bacteria | 1624 |
| 340 | Ga0207641_11016013 | 3300026088 | Bacteria | 826 |
| 341 | Ga0207641_11307772 | 3300026088 | Unclassified | 725 |
| 342 | Ga0207648_10055934 | 3300026089 | Bacteria | 3444 |
| 343 | Ga0207648_10118355 | 3300026089 | Bacteria | 2328 |
| 344 | Ga0207676_10014677 | 3300026095 | Bacteria | 5642 |
| 345 | Ga0207676_10090221 | 3300026095 | Bacteria | 2514 |
| 346 | Ga0207676_10153725 | 3300026095 | Unclassified | 1985 |
| 347 | Ga0207676_10679896 | 3300026095 | Bacteria | 995 |
| 348 | Ga0207676_10722216 | 3300026095 | Bacteria | 967 |
| 349 | Ga0207674_10033731 | 3300026116 | Bacteria | 5358 |
| 350 | Ga0207674_10173959 | 3300026116 | Bacteria | 2106 |
| 351 | Ga0207674_11033717 | 3300026116 | Unclassified | 791 |
| 352 | Ga0207674_11104768 | 3300026116 | Bacteria | 762 |
| 353 | Ga0207675_100051587 | 3300026118 | Bacteria | 3838 |
| 354 | Ga0207698_10025182 | 3300026142 | Bacteria | 4187 |
| 355 | Ga0207428_10020242 | 3300027907 | Bacteria | 5656 |
| 356 | Ga0207428_10745500 | 3300027907 | Unclassified | 698 |
| 357 | Ga0268265_10356961 | 3300028380 | Bacteria | 1337 |
| 358 | Ga0268265_10560317 | 3300028380 | Bacteria | 1086 |
| 359 | Ga0268265_11841326 | 3300028380 | Unclassified | 612 |
| 360 | Ga0268264_10027849 | 3300028381 | Bacteria | 4619 |
| 361 | Ga0268264_10038533 | 3300028381 | Bacteria | 3946 |
| 362 | Ga0268264_10214453 | 3300028381 | Bacteria | 1769 |
| 363 | Ga0268264_10260833 | 3300028381 | Bacteria | 1614 |
| 364 | Ga0268264_10751731 | 3300028381 | Unclassified | 971 |
| 365 | Ga0268264_10769393 | 3300028381 | Bacteria | 960 |
| 366 | Ga0268264_11478470 | 3300028381 | Bacteria | 690 |
| 367 | Ga0307408_100543519 | 3300031548 | Bacteria | 1024 |
| 368 | Ga0307408_101156191 | 3300031548 | Unclassified | 720 |
| 369 | Ga0307405_10020166 | 3300031731 | Bacteria | 3720 |
| 370 | Ga0307405_10122340 | 3300031731 | Bacteria | 1783 |
| 371 | Ga0307405_10285068 | 3300031731 | Bacteria | 1245 |
| 372 | Ga0307413_10066118 | 3300031824 | Bacteria | 2255 |
| 373 | Ga0307413_10235009 | 3300031824 | Bacteria | 1349 |
| 374 | Ga0307410_10040938 | 3300031852 | Unclassified | 3052 |
| 375 | Ga0307410_10076197 | 3300031852 | Unclassified | 2341 |
| 376 | Ga0307406_10013540 | 3300031901 | Bacteria | 4674 |
| 377 | Ga0307412_10045754 | 3300031911 | Unclassified | 2863 |
| 378 | Ga0307412_10077603 | 3300031911 | Bacteria | 2285 |
| 379 | Ga0307412_10402366 | 3300031911 | Bacteria | 1115 |
| 380 | Ga0307412_10423426 | 3300031911 | Bacteria | 1090 |
| 381 | Ga0307409_100169508 | 3300031995 | Unclassified | 1920 |
| 382 | Ga0307416_100038058 | 3300032002 | Bacteria | 3707 |
| 383 | Ga0307416_100061642 | 3300032002 | Unclassified | 3062 |
| 384 | Ga0307414_10101570 | 3300032004 | Unclassified | 2166 |
| 385 | Ga0307414_10110093 | 3300032004 | Bacteria | 2094 |
| 386 | Ga0307414_10298588 | 3300032004 | Bacteria | 1361 |
| 387 | Ga0307411_10049939 | 3300032005 | Bacteria | 2722 |
| 388 | Ga0307415_100004550 | 3300032126 | Bacteria | 7225 |
| 389 | Ga0307415_101096734 | 3300032126 | Bacteria | 745 |
| 390 | Ga0395900_0310855 | 3300037418 | Bacteria | 1559 |
| 391 | Ga0395900_0962595 | 3300037418 | Bacteria | 775 |
| 392 | Ga0395898_0265578 | 3300037466 | Unclassified | 1637 |
| 393 | Ga0395898_0555645 | 3300037466 | Unclassified | 1090 |
| 394 | Ga0242420_005601 | 3300038996 | Unclassified | 1952 |
| 395 | Ga0242420_015287 | 3300038996 | Bacteria | 1326 |
| 396 | Ga0439448_0053035 | 3300042005 | Bacteria | 1330 |
| 397 | Ga0439458_0038702 | 3300042157 | Bacteria | 1152 |
| 398 | Ga0453683_0196205 | 3300044673 | Unclassified | 1282 |
| 399 | Ga0451576_0189959 | 3300045051 | Bacteria | 2145 |
| 400 | Ga0451576_0409212 | 3300045051 | Unclassified | 1423 |
| 401 | Ga0451576_0615804 | 3300045051 | Bacteria | 1141 |
| 402 | Ga0451576_2010803 | 3300045051 | Unclassified | 595 |
| 403 | Ga0495643_0204237 | 3300046522 | Unclassified | 947 |
| 404 | Ga0495672_0188011 | 3300047320 | Bacteria | 1041 |
| 405 | Ga0496104_0256720 | 3300048907 | Bacteria | 1661 |
| 406 | Ga0496106_0024737 | 3300048909 | Unclassified | 4465 |
| 407 | Ga0496107_0179105 | 3300048910 | Unclassified | 1574 |
| 408 | Ga0496108_1053906 | 3300048911 | Bacteria | 693 |
| 409 | Ga0496110_0421622 | 3300048913 | Bacteria | 1217 |
| 410 | Ga0496111_0138302 | 3300048914 | Bacteria | 1805 |
| 411 | Ga0496112_0834977 | 3300048915 | Bacteria | 845 |
| 412 | Ga0496112_1108397 | 3300048915 | Bacteria | 710 |
| 413 | Ga0496112_1420923 | 3300048915 | Bacteria | 608 |
| 414 | Ga0496113_0148947 | 3300048916 | Bacteria | 1845 |
| 415 | Ga0496113_1371926 | 3300048916 | Bacteria | 548 |
| 416 | Ga0501306_001972 | 3300049127 | Bacteria | 2030 |
| 417 | Ga0501306_002365 | 3300049127 | Unclassified | 1925 |
| 418 | Ga0501306_063325 | 3300049127 | Unclassified | 613 |
| 419 | Ga0501306_070909 | 3300049127 | Unclassified | 588 |
| 420 | Ga0501309_003794 | 3300049129 | Unclassified | 1732 |
| 421 | Ga0501309_004298 | 3300049129 | Bacteria | 1654 |
| 422 | Ga0501309_024542 | 3300049129 | Bacteria | 862 |
| 423 | Ga0501309_043229 | 3300049129 | Bacteria | 693 |
| 424 | Ga0501309_072418 | 3300049129 | Unclassified | 568 |
| 425 | Ga0501341_08994 | 3300049131 | Bacteria | 643 |
| 426 | Ga0501343_005479 | 3300049132 | Unclassified | 974 |
| 427 | Ga0501343_015511 | 3300049132 | Bacteria | 649 |
| 428 | Ga0501343_021187 | 3300049132 | Unclassified | 575 |
| 429 | Ga0501344_06568 | 3300049133 | Bacteria | 674 |
| 430 | Ga0501345_01722 | 3300049134 | Bacteria | 859 |
| 431 | Ga0501305_068866 | 3300049161 | Bacteria | 620 |
| 432 | Ga0501305_092260 | 3300049161 | Unclassified | 556 |
| 433 | Ga0501307_007639 | 3300049162 | Bacteria | 1197 |
| 434 | Ga0501307_043974 | 3300049162 | Bacteria | 656 |
| 435 | Ga0501307_055067 | 3300049162 | Bacteria | 606 |
| 436 | Ga0501290_019043 | 3300049513 | Unclassified | 929 |
| 437 | Ga0501291_038332 | 3300049514 | Bacteria | 834 |
| 438 | Ga0501291_078200 | 3300049514 | Unclassified | 654 |
| 439 | Ga0501293_015297 | 3300049516 | Unclassified | 705 |
| 440 | Ga0501295_001752 | 3300049518 | Bacteria | 2321 |
| 441 | Ga0501296_001135 | 3300049519 | Bacteria | 2671 |
| 442 | Ga0501296_001534 | 3300049519 | Bacteria | 2346 |
| 443 | Ga0501297_015234 | 3300049520 | Bacteria | 918 |
| 444 | Ga0501298_001496 | 3300049521 | Bacteria | 3438 |
| 445 | Ga0501299_006163 | 3300049522 | Bacteria | 1873 |
| 446 | Ga0501299_011471 | 3300049522 | Unclassified | 1497 |
| 447 | Ga0501300_011270 | 3300049523 | Bacteria | 1303 |
| 448 | Ga0501311_061141 | 3300049527 | Bacteria | 609 |
| 449 | Ga0501311_082380 | 3300049527 | Unclassified | 549 |
| 450 | Ga0501312_070655 | 3300049528 | Bacteria | 618 |
| 451 | Ga0501312_071294 | 3300049528 | Bacteria | 616 |
| 452 | Ga0501315_056295 | 3300049531 | Bacteria | 628 |
| 453 | Ga0501317_062118 | 3300049533 | Bacteria | 615 |
| 454 | Ga0501320_017327 | 3300049536 | Bacteria | 804 |
| 455 | Ga0501321_003607 | 3300049537 | Bacteria | 1429 |
| 456 | Ga0501321_040587 | 3300049537 | Bacteria | 653 |
| 457 | Ga0501321_056180 | 3300049537 | Bacteria | 586 |
| 458 | Ga0501321_062818 | 3300049537 | Unclassified | 564 |
| 459 | Ga0501323_029472 | 3300049539 | Bacteria | 764 |
| 460 | Ga0501325_019544 | 3300049541 | Bacteria | 703 |
| 461 | Ga0501334_10380 | 3300049550 | Bacteria | 672 |
| 462 | Ga0501335_009185 | 3300049551 | Bacteria | 939 |
| 463 | Ga0501336_007395 | 3300049552 | Bacteria | 832 |
| 464 | Ga0501336_007799 | 3300049552 | Bacteria | 818 |
| 465 | Ga0501336_012038 | 3300049552 | Bacteria | 710 |
| 466 | Ga0501337_013802 | 3300049553 | Bacteria | 613 |
| 467 | Ga0501340_009041 | 3300049556 | Bacteria | 711 |
| 468 | Ga0501067_0166067 | 3300049583 | Bacteria | 1229 |
| 469 | Ga0501077_0578073 | 3300049593 | Unclassified | 721 |
| 470 | Ga0501198_004990 | 3300049649 | Unclassified | 1858 |
| 471 | Ga0501198_008570 | 3300049649 | Bacteria | 1487 |
| 472 | Ga0501198_022372 | 3300049649 | Bacteria | 1012 |
| 473 | Ga0501198_024111 | 3300049649 | Bacteria | 983 |
| 474 | Ga0501201_008422 | 3300049651 | Bacteria | 996 |
| 475 | Ga0501202_023216 | 3300049652 | Bacteria | 1250 |
| 476 | Ga0501202_038456 | 3300049652 | Bacteria | 1025 |
| 477 | Ga0501202_130969 | 3300049652 | Unclassified | 639 |
| 478 | Ga0501206_014721 | 3300049653 | Bacteria | 1077 |
| 479 | Ga0501207_001884 | 3300049654 | Unclassified | 2674 |
| 480 | Ga0501207_006265 | 3300049654 | Bacteria | 1666 |
| 481 | Ga0501207_017534 | 3300049654 | Bacteria | 1118 |
| 482 | Ga0501207_039635 | 3300049654 | Bacteria | 816 |
| 483 | Ga0501209_024173 | 3300049656 | Bacteria | 1477 |
| 484 | Ga0501216_005806 | 3300049660 | Bacteria | 1873 |
| 485 | Ga0501216_043760 | 3300049660 | Unclassified | 863 |
| 486 | Ga0501217_000272 | 3300049661 | Bacteria | 8088 |
| 487 | Ga0501217_007774 | 3300049661 | Bacteria | 2303 |
| 488 | Ga0501217_027858 | 3300049661 | Bacteria | 1373 |
| 489 | Ga0501223_003122 | 3300049663 | Bacteria | 3620 |
| 490 | Ga0501223_008588 | 3300049663 | Bacteria | 2081 |
| 491 | Ga0501223_013459 | 3300049663 | Bacteria | 1629 |
| 492 | Ga0501224_013593 | 3300049664 | Bacteria | 1202 |
| 493 | Ga0501224_017743 | 3300049664 | Unclassified | 1058 |
| 494 | Ga0501227_000627 | 3300049665 | Bacteria | 7681 |
| 495 | Ga0501227_018313 | 3300049665 | Bacteria | 1588 |
| 496 | Ga0501228_036638 | 3300049666 | Unclassified | 623 |
| 497 | Ga0501230_001762 | 3300049667 | Unclassified | 2647 |
| 498 | Ga0501230_106121 | 3300049667 | Unclassified | 610 |
| 499 | Ga0501233_016488 | 3300049668 | Bacteria | 1533 |
| 500 | Ga0501233_020546 | 3300049668 | Bacteria | 1410 |
| 501 | Ga0501233_021061 | 3300049668 | Bacteria | 1396 |
| 502 | Ga0501235_001808 | 3300049669 | Bacteria | 4593 |
| 503 | Ga0501235_008297 | 3300049669 | Bacteria | 2266 |
| 504 | Ga0501235_119498 | 3300049669 | Unclassified | 658 |
| 505 | Ga0501240_059710 | 3300049673 | Unclassified | 670 |
| 506 | Ga0501240_106495 | 3300049673 | Unclassified | 544 |
| 507 | Ga0501243_007124 | 3300049675 | Bacteria | 1704 |
| 508 | Ga0501243_010138 | 3300049675 | Bacteria | 1468 |
| 509 | Ga0501243_011612 | 3300049675 | Bacteria | 1383 |
| 510 | Ga0501246_016503 | 3300049676 | Bacteria | 728 |
| 511 | Ga0501247_030518 | 3300049677 | Bacteria | 734 |
| 512 | Ga0501249_007843 | 3300049679 | Bacteria | 2214 |
| 513 | Ga0501249_028396 | 3300049679 | Bacteria | 1240 |
| 514 | Ga0501250_000960 | 3300049680 | Bacteria | 2198 |
| 515 | Ga0501250_040398 | 3300049680 | Bacteria | 682 |
| 516 | Ga0501251_007821 | 3300049681 | Bacteria | 1197 |
| 517 | Ga0501253_025145 | 3300049683 | Bacteria | 1086 |
| 518 | Ga0501257_025680 | 3300049686 | Bacteria | 1402 |
| 519 | Ga0501259_015377 | 3300049688 | Bacteria | 1306 |
| 520 | Ga0501261_019719 | 3300049690 | Unclassified | 960 |
| 521 | Ga0501221_009074 | 3300049704 | Bacteria | 1740 |
| 522 | Ga0501225_0007355 | 3300049705 | Unclassified | 3192 |
| 523 | Ga0501225_0040500 | 3300049705 | Bacteria | 1284 |
| 524 | Ga0501225_0092555 | 3300049705 | Bacteria | 877 |
| 525 | Ga0501229_026747 | 3300049706 | Bacteria | 779 |
| 526 | Ga0501234_014225 | 3300049707 | Bacteria | 1249 |
| 527 | Ga0501234_019526 | 3300049707 | Bacteria | 1075 |
| 528 | Ga0501245_011544 | 3300049708 | Bacteria | 1286 |
| 529 | Ga0501263_010458 | 3300049760 | Bacteria | 1138 |
| 530 | Ga0501268_021034 | 3300049765 | Bacteria | 1117 |
| 531 | Ga0501270_006880 | 3300049767 | Bacteria | 1385 |
| 532 | Ga0501271_002012 | 3300049768 | Bacteria | 1785 |
| 533 | Ga0501272_004202 | 3300049769 | Bacteria | 1491 |
| 534 | Ga0501273_002151 | 3300049770 | Bacteria | 1983 |
| 535 | Ga0501274_009820 | 3300049771 | Bacteria | 875 |
| 536 | Ga0501274_010871 | 3300049771 | Unclassified | 844 |
| 537 | Ga0501276_014803 | 3300049773 | Bacteria | 696 |
| 538 | Ga0501279_027183 | 3300049775 | Bacteria | 837 |
| 539 | Ga0501283_001783 | 3300049779 | Bacteria | 2792 |
| 540 | Ga0501283_009913 | 3300049779 | Bacteria | 1396 |
| 541 | Ga0501212_009800 | 3300049851 | Bacteria | 1357 |
| 542 | Ga0501226_005756 | 3300049853 | Bacteria | 1408 |
| 543 | nmdc:mga05p37_220295_c1 | 3300050507 | Bacteria | 2290 |
| 544 | nmdc:mga05p37_49976_c1 | 3300050507 | Bacteria | 5143 |
| 545 | nmdc:mga09592_714313_c1 | 3300050508 | Bacteria | 852 |
| 546 | nmdc:mga08y16_606_c1 | 3300050511 | Bacteria | 33436 |
| 547 | nmdc:mga08y16_695471_c1 | 3300050511 | Unclassified | 1017 |
| 548 | nmdc:mga0n895_1035146_c1 | 3300050512 | Bacteria | 801 |
| 549 | nmdc:mga0n895_122789_c1 | 3300050512 | Unclassified | 2619 |
| 550 | nmdc:mga0a205_36669_c2 | 3300050515 | Bacteria | 4370 |
| 551 | nmdc:mga0a205_414014_c1 | 3300050515 | Unclassified | 1210 |
| 552 | nmdc:mga0a205_58137_c1 | 3300050515 | Bacteria | 3735 |
| 553 | Ga0587086_087920 | 3300059507 | Unclassified | 557 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005546 | Ga0070696_100561712 | Ga0070696_1005617122 | 154 |
| 2 | 3300009174 | Ga0105241_10558613 | Ga0105241_105586132 | 154 |
| 3 | 3300006163 | Ga0070715_10000002 | Ga0070715_1000000227 | 155 |
| 4 | 3300025905 | Ga0207685_10000030 | Ga0207685_1000003026 | 155 |
| 5 | 3300049537 | Ga0501321_062818 | Ga0501321_062818_23_496 | 155 |
| 6 | 3300025921 | Ga0207652_10858357 | Ga0207652_108583572 | 158 |
| 7 | 3300049131 | Ga0501341_08994 | Ga0501341_08994_35_517 | 158 |
| 8 | 3300005336 | Ga0070680_100105569 | Ga0070680_1001055691 | 159 |
| 9 | 3300005337 | Ga0070682_100563575 | Ga0070682_1005635751 | 159 |
| 10 | 3300005344 | Ga0070661_100037957 | Ga0070661_1000379575 | 159 |
| 11 | 3300005354 | Ga0070675_100810057 | Ga0070675_1008100571 | 159 |
| 12 | 3300005458 | Ga0070681_10142360 | Ga0070681_101423601 | 159 |
| 13 | 3300005530 | Ga0070679_100023851 | Ga0070679_1000238512 | 159 |
| 14 | 3300005539 | Ga0068853_100061098 | Ga0068853_1000610982 | 159 |
| 15 | 3300005577 | Ga0068857_100007599 | Ga0068857_1000075999 | 159 |
| 16 | 3300005618 | Ga0068864_101374613 | Ga0068864_1013746131 | 159 |
| 17 | 3300009174 | Ga0105241_10102755 | Ga0105241_101027551 | 159 |
| 18 | 3300013100 | Ga0157373_10169252 | Ga0157373_101692521 | 159 |
| 19 | 3300013307 | Ga0157372_10837672 | Ga0157372_108376721 | 159 |
| 20 | 3300013308 | Ga0157375_10200809 | Ga0157375_102008091 | 159 |
| 21 | 3300014325 | Ga0163163_11034322 | Ga0163163_110343221 | 159 |
| 22 | 3300049519 | Ga0501296_001135 | Ga0501296_001135_1975_2460 | 159 |
| 23 | 3300049675 | Ga0501243_007124 | Ga0501243_007124_652_1137 | 159 |
| 24 | 3300005355 | Ga0070671_100075842 | Ga0070671_1000758422 | 160 |
| 25 | 3300048916 | Ga0496113_1371926 | Ga0496113_1371926_11_499 | 160 |
| 26 | 3300005471 | Ga0070698_100003522 | Ga0070698_1000035223 | 161 |
| 27 | 3300045051 | Ga0451576_0409212 | Ga0451576_0409212_851_1351 | 161 |
| 28 | 3300049583 | Ga0501067_0166067 | Ga0501067_0166067_320_820 | 161 |
| 29 | 3300005328 | Ga0070676_10651264 | Ga0070676_106512642 | 162 |
| 30 | 3300005331 | Ga0070670_100067788 | Ga0070670_1000677883 | 162 |
| 31 | 3300005343 | Ga0070687_100713555 | Ga0070687_1007135551 | 162 |
| 32 | 3300005364 | Ga0070673_100088944 | Ga0070673_1000889443 | 162 |
| 33 | 3300005435 | Ga0070714_100025283 | Ga0070714_1000252835 | 162 |
| 34 | 3300005444 | Ga0070694_100015767 | Ga0070694_1000157674 | 162 |
| 35 | 3300005536 | Ga0070697_100592645 | Ga0070697_1005926452 | 162 |
| 36 | 3300005578 | Ga0068854_100695383 | Ga0068854_1006953832 | 162 |
| 37 | 3300005617 | Ga0068859_100023360 | Ga0068859_1000233602 | 162 |
| 38 | 3300005842 | Ga0068858_100155516 | Ga0068858_1001555161 | 162 |
| 39 | 3300005843 | Ga0068860_101198281 | Ga0068860_1011982811 | 162 |
| 40 | 3300006880 | Ga0075429_100061539 | Ga0075429_1000615393 | 162 |
| 41 | 3300006931 | Ga0097620_100023362 | Ga0097620_1000233622 | 162 |
| 42 | 3300009101 | Ga0105247_10031464 | Ga0105247_100314641 | 162 |
| 43 | 3300009147 | Ga0114129_11109037 | Ga0114129_111090372 | 162 |
| 44 | 3300009177 | Ga0105248_10022887 | Ga0105248_100228878 | 162 |
| 45 | 3300009177 | Ga0105248_10236121 | Ga0105248_102361212 | 162 |
| 46 | 3300010375 | Ga0105239_10408373 | Ga0105239_104083732 | 162 |
| 47 | 3300013306 | Ga0163162_10428131 | Ga0163162_104281312 | 162 |
| 48 | 3300014745 | Ga0157377_10092959 | Ga0157377_100929592 | 162 |
| 49 | 3300014968 | Ga0157379_10018565 | Ga0157379_100185657 | 162 |
| 50 | 3300025922 | Ga0207646_10412493 | Ga0207646_104124932 | 162 |
| 51 | 3300025929 | Ga0207664_10423110 | Ga0207664_104231102 | 162 |
| 52 | 3300025941 | Ga0207711_10248318 | Ga0207711_102483182 | 162 |
| 53 | 3300026035 | Ga0207703_10179388 | Ga0207703_101793881 | 162 |
| 54 | 3300026035 | Ga0207703_11646732 | Ga0207703_116467321 | 162 |
| 55 | 3300026075 | Ga0207708_10374018 | Ga0207708_103740181 | 162 |
| 56 | 3300026118 | Ga0207675_100051587 | Ga0207675_1000515874 | 162 |
| 57 | 3300028380 | Ga0268265_11841326 | Ga0268265_118413261 | 162 |
| 58 | 3300028381 | Ga0268264_10214453 | Ga0268264_102144532 | 162 |
| 59 | 3300037418 | Ga0395900_0962595 | Ga0395900_0962595_197_691 | 162 |
| 60 | 3300037466 | Ga0395898_0265578 | Ga0395898_0265578_204_698 | 162 |
| 61 | 3300045051 | Ga0451576_0189959 | Ga0451576_0189959_511_1005 | 162 |
| 62 | 3300046522 | Ga0495643_0204237 | Ga0495643_0204237_273_767 | 162 |
| 63 | 3300047320 | Ga0495672_0188011 | Ga0495672_0188011_404_907 | 162 |
| 64 | 3300049127 | Ga0501306_063325 | Ga0501306_063325_33_527 | 162 |
| 65 | 3300049129 | Ga0501309_004298 | Ga0501309_004298_21_515 | 162 |
| 66 | 3300049537 | Ga0501321_056180 | Ga0501321_056180_23_517 | 162 |
| 67 | 3300049552 | Ga0501336_007799 | Ga0501336_007799_254_748 | 162 |
| 68 | 3300049593 | Ga0501077_0578073 | Ga0501077_0578073_27_521 | 162 |
| 69 | 3300050507 | nmdc:mga05p37_220295_c1 | nmdc:mga05p37_220295_c1_582_1085 | 162 |
| 70 | 3300050508 | nmdc:mga09592_714313_c1 | nmdc:mga09592_714313_c1_100_603 | 162 |
| 71 | 3300050515 | nmdc:mga0a205_414014_c1 | nmdc:mga0a205_414014_c1_94_597 | 162 |
| 72 | 3300005288 | Ga0065714_10064440 | Ga0065714_1006444078 | 163 |
| 73 | 3300005290 | Ga0065712_10000120 | Ga0065712_1000012010 | 163 |
| 74 | 3300005290 | Ga0065712_10235170 | Ga0065712_102351701 | 163 |
| 75 | 3300005293 | Ga0065715_10090220 | Ga0065715_100902203 | 163 |
| 76 | 3300005293 | Ga0065715_10352974 | Ga0065715_103529741 | 163 |
| 77 | 3300005295 | Ga0065707_10110990 | Ga0065707_101109901 | 163 |
| 78 | 3300005334 | Ga0068869_100214069 | Ga0068869_1002140692 | 163 |
| 79 | 3300005334 | Ga0068869_100306854 | Ga0068869_1003068542 | 163 |
| 80 | 3300005338 | Ga0068868_100548998 | Ga0068868_1005489982 | 163 |
| 81 | 3300005343 | Ga0070687_100574065 | Ga0070687_1005740651 | 163 |
| 82 | 3300005353 | Ga0070669_100845167 | Ga0070669_1008451672 | 163 |
| 83 | 3300005354 | Ga0070675_100958173 | Ga0070675_1009581731 | 163 |
| 84 | 3300005406 | Ga0070703_10053666 | Ga0070703_100536662 | 163 |
| 85 | 3300005440 | Ga0070705_100417478 | Ga0070705_1004174781 | 163 |
| 86 | 3300005440 | Ga0070705_101344027 | Ga0070705_1013440271 | 163 |
| 87 | 3300005445 | Ga0070708_100000311 | Ga0070708_10000031118 | 163 |
| 88 | 3300005467 | Ga0070706_100001871 | Ga0070706_10000187123 | 163 |
| 89 | 3300005467 | Ga0070706_100110752 | Ga0070706_1001107522 | 163 |
| 90 | 3300005468 | Ga0070707_100072312 | Ga0070707_1000723123 | 163 |
| 91 | 3300005471 | Ga0070698_100003912 | Ga0070698_10000391212 | 163 |
| 92 | 3300005471 | Ga0070698_101564630 | Ga0070698_1015646301 | 163 |
| 93 | 3300005518 | Ga0070699_100006602 | Ga0070699_1000066027 | 163 |
| 94 | 3300005536 | Ga0070697_100000082 | Ga0070697_10000008234 | 163 |
| 95 | 3300005536 | Ga0070697_100051584 | Ga0070697_1000515842 | 163 |
| 96 | 3300005549 | Ga0070704_100584283 | Ga0070704_1005842832 | 163 |
| 97 | 3300005549 | Ga0070704_101055155 | Ga0070704_1010551551 | 163 |
| 98 | 3300005617 | Ga0068859_100657456 | Ga0068859_1006574561 | 163 |
| 99 | 3300005618 | Ga0068864_101286223 | Ga0068864_1012862231 | 163 |
| 100 | 3300005842 | Ga0068858_100121070 | Ga0068858_1001210703 | 163 |
| 101 | 3300005985 | Ga0081539_10112844 | Ga0081539_101128442 | 163 |
| 102 | 3300006237 | Ga0097621_100821699 | Ga0097621_1008216991 | 163 |
| 103 | 3300006871 | Ga0075434_100284157 | Ga0075434_1002841571 | 163 |
| 104 | 3300006931 | Ga0097620_100657415 | Ga0097620_1006574151 | 163 |
| 105 | 3300009011 | Ga0105251_10045443 | Ga0105251_100454431 | 163 |
| 106 | 3300009101 | Ga0105247_11345650 | Ga0105247_113456501 | 163 |
| 107 | 3300009147 | Ga0114129_10187983 | Ga0114129_101879834 | 163 |
| 108 | 3300009148 | Ga0105243_10040245 | Ga0105243_100402453 | 163 |
| 109 | 3300009148 | Ga0105243_10254513 | Ga0105243_102545132 | 163 |
| 110 | 3300009176 | Ga0105242_10003233 | Ga0105242_100032338 | 163 |
| 111 | 3300009177 | Ga0105248_10038646 | Ga0105248_100386463 | 163 |
| 112 | 3300009177 | Ga0105248_10482372 | Ga0105248_104823722 | 163 |
| 113 | 3300013297 | Ga0157378_10000105 | Ga0157378_1000010528 | 163 |
| 114 | 3300013308 | Ga0157375_10005309 | Ga0157375_100053093 | 163 |
| 115 | 3300014325 | Ga0163163_10290364 | Ga0163163_102903642 | 163 |
| 116 | 3300014325 | Ga0163163_12543604 | Ga0163163_125436041 | 163 |
| 117 | 3300025900 | Ga0207710_10320044 | Ga0207710_103200441 | 163 |
| 118 | 3300025910 | Ga0207684_10005120 | Ga0207684_100051202 | 163 |
| 119 | 3300025910 | Ga0207684_10112357 | Ga0207684_101123572 | 163 |
| 120 | 3300025934 | Ga0207686_10011703 | Ga0207686_100117031 | 163 |
| 121 | 3300025935 | Ga0207709_10011268 | Ga0207709_100112683 | 163 |
| 122 | 3300025940 | Ga0207691_10379423 | Ga0207691_103794232 | 163 |
| 123 | 3300025941 | Ga0207711_10081221 | Ga0207711_100812213 | 163 |
| 124 | 3300025942 | Ga0207689_10299469 | Ga0207689_102994692 | 163 |
| 125 | 3300026035 | Ga0207703_10101601 | Ga0207703_101016012 | 163 |
| 126 | 3300026095 | Ga0207676_10679896 | Ga0207676_106798962 | 163 |
| 127 | 3300027907 | Ga0207428_10745500 | Ga0207428_107455001 | 163 |
| 128 | 3300031548 | Ga0307408_101156191 | Ga0307408_1011561911 | 163 |
| 129 | 3300031911 | Ga0307412_10423426 | Ga0307412_104234262 | 163 |
| 130 | 3300048909 | Ga0496106_0024737 | Ga0496106_0024737_2861_3358 | 163 |
| 131 | 3300048910 | Ga0496107_0179105 | Ga0496107_0179105_1057_1554 | 163 |
| 132 | 3300049129 | Ga0501309_072418 | Ga0501309_072418_61_558 | 163 |
| 133 | 3300050511 | nmdc:mga08y16_695471_c1 | nmdc:mga08y16_695471_c1_171_677 | 163 |
| 134 | 3300050512 | nmdc:mga0n895_1035146_c1 | nmdc:mga0n895_1035146_c1_209_706 | 163 |
| 135 | 3300001904 | JGI24736J21556_1008527 | JGI24736J21556_10085272 | 164 |
| 136 | 3300002459 | JGI24751J29686_10000179 | JGI24751J29686_1000017921 | 164 |
| 137 | 3300003203 | JGI25406J46586_10017735 | JGI25406J46586_100177351 | 164 |
| 138 | 3300003203 | JGI25406J46586_10041338 | JGI25406J46586_100413382 | 164 |
| 139 | 3300003320 | rootH2_10242219 | rootH2_102422192 | 164 |
| 140 | 3300005289 | Ga0065704_10369489 | Ga0065704_103694891 | 164 |
| 141 | 3300005290 | Ga0065712_10032263 | Ga0065712_100322632 | 164 |
| 142 | 3300005290 | Ga0065712_10080463 | Ga0065712_100804633 | 164 |
| 143 | 3300005290 | Ga0065712_10266639 | Ga0065712_102666391 | 164 |
| 144 | 3300005293 | Ga0065715_10045410 | Ga0065715_100454101 | 164 |
| 145 | 3300005293 | Ga0065715_10091105 | Ga0065715_100911053 | 164 |
| 146 | 3300005293 | Ga0065715_10096605 | Ga0065715_100966055 | 164 |
| 147 | 3300005293 | Ga0065715_10109897 | Ga0065715_101098972 | 164 |
| 148 | 3300005293 | Ga0065715_10434764 | Ga0065715_104347641 | 164 |
| 149 | 3300005293 | Ga0065715_10493834 | Ga0065715_104938341 | 164 |
| 150 | 3300005331 | Ga0070670_100000188 | Ga0070670_10000018842 | 164 |
| 151 | 3300005334 | Ga0068869_100571872 | Ga0068869_1005718722 | 164 |
| 152 | 3300005334 | Ga0068869_101254875 | Ga0068869_1012548751 | 164 |
| 153 | 3300005335 | Ga0070666_11159879 | Ga0070666_111598791 | 164 |
| 154 | 3300005337 | Ga0070682_100006213 | Ga0070682_1000062133 | 164 |
| 155 | 3300005345 | Ga0070692_10084724 | Ga0070692_100847242 | 164 |
| 156 | 3300005353 | Ga0070669_100080582 | Ga0070669_1000805822 | 164 |
| 157 | 3300005364 | Ga0070673_100024940 | Ga0070673_1000249403 | 164 |
| 158 | 3300005364 | Ga0070673_101767336 | Ga0070673_1017673361 | 164 |
| 159 | 3300005366 | Ga0070659_100108442 | Ga0070659_1001084423 | 164 |
| 160 | 3300005406 | Ga0070703_10012555 | Ga0070703_100125551 | 164 |
| 161 | 3300005438 | Ga0070701_10023785 | Ga0070701_100237852 | 164 |
| 162 | 3300005440 | Ga0070705_100020961 | Ga0070705_1000209612 | 164 |
| 163 | 3300005441 | Ga0070700_100011925 | Ga0070700_1000119252 | 164 |
| 164 | 3300005441 | Ga0070700_101618028 | Ga0070700_1016180281 | 164 |
| 165 | 3300005444 | Ga0070694_100014470 | Ga0070694_1000144702 | 164 |
| 166 | 3300005444 | Ga0070694_100324134 | Ga0070694_1003241342 | 164 |
| 167 | 3300005444 | Ga0070694_100565728 | Ga0070694_1005657281 | 164 |
| 168 | 3300005444 | Ga0070694_100886737 | Ga0070694_1008867371 | 164 |
| 169 | 3300005458 | Ga0070681_10004020 | Ga0070681_100040202 | 164 |
| 170 | 3300005458 | Ga0070681_10091319 | Ga0070681_100913193 | 164 |
| 171 | 3300005459 | Ga0068867_100030742 | Ga0068867_1000307422 | 164 |
| 172 | 3300005459 | Ga0068867_100130124 | Ga0068867_1001301242 | 164 |
| 173 | 3300005539 | Ga0068853_100017115 | Ga0068853_1000171153 | 164 |
| 174 | 3300005539 | Ga0068853_100245341 | Ga0068853_1002453412 | 164 |
| 175 | 3300005545 | Ga0070695_100025154 | Ga0070695_1000251541 | 164 |
| 176 | 3300005545 | Ga0070695_100237117 | Ga0070695_1002371172 | 164 |
| 177 | 3300005545 | Ga0070695_100721390 | Ga0070695_1007213901 | 164 |
| 178 | 3300005545 | Ga0070695_100836106 | Ga0070695_1008361062 | 164 |
| 179 | 3300005549 | Ga0070704_100039783 | Ga0070704_1000397834 | 164 |
| 180 | 3300005549 | Ga0070704_100159989 | Ga0070704_1001599892 | 164 |
| 181 | 3300005549 | Ga0070704_100448371 | Ga0070704_1004483711 | 164 |
| 182 | 3300005563 | Ga0068855_100304988 | Ga0068855_1003049882 | 164 |
| 183 | 3300005577 | Ga0068857_100124039 | Ga0068857_1001240392 | 164 |
| 184 | 3300005578 | Ga0068854_100193209 | Ga0068854_1001932091 | 164 |
| 185 | 3300005578 | Ga0068854_101065505 | Ga0068854_1010655051 | 164 |
| 186 | 3300005615 | Ga0070702_100027019 | Ga0070702_1000270192 | 164 |
| 187 | 3300005615 | Ga0070702_100188428 | Ga0070702_1001884282 | 164 |
| 188 | 3300005615 | Ga0070702_100251893 | Ga0070702_1002518931 | 164 |
| 189 | 3300005615 | Ga0070702_100461246 | Ga0070702_1004612462 | 164 |
| 190 | 3300005616 | Ga0068852_100082494 | Ga0068852_1000824941 | 164 |
| 191 | 3300005617 | Ga0068859_100003607 | Ga0068859_1000036073 | 164 |
| 192 | 3300005617 | Ga0068859_100086330 | Ga0068859_1000863302 | 164 |
| 193 | 3300005617 | Ga0068859_100348971 | Ga0068859_1003489712 | 164 |
| 194 | 3300005617 | Ga0068859_100386770 | Ga0068859_1003867701 | 164 |
| 195 | 3300005617 | Ga0068859_100420507 | Ga0068859_1004205071 | 164 |
| 196 | 3300005617 | Ga0068859_100611332 | Ga0068859_1006113322 | 164 |
| 197 | 3300005618 | Ga0068864_100044473 | Ga0068864_1000444735 | 164 |
| 198 | 3300005618 | Ga0068864_100098800 | Ga0068864_1000988003 | 164 |
| 199 | 3300005618 | Ga0068864_100165786 | Ga0068864_1001657862 | 164 |
| 200 | 3300005618 | Ga0068864_100613361 | Ga0068864_1006133612 | 164 |
| 201 | 3300005618 | Ga0068864_100837412 | Ga0068864_1008374121 | 164 |
| 202 | 3300005834 | Ga0068851_10066056 | Ga0068851_100660561 | 164 |
| 203 | 3300005840 | Ga0068870_10011636 | Ga0068870_100116362 | 164 |
| 204 | 3300005840 | Ga0068870_10229793 | Ga0068870_102297932 | 164 |
| 205 | 3300005840 | Ga0068870_10410105 | Ga0068870_104101051 | 164 |
| 206 | 3300005841 | Ga0068863_100070159 | Ga0068863_1000701595 | 164 |
| 207 | 3300005841 | Ga0068863_100306861 | Ga0068863_1003068612 | 164 |
| 208 | 3300005841 | Ga0068863_100340929 | Ga0068863_1003409292 | 164 |
| 209 | 3300005841 | Ga0068863_100566505 | Ga0068863_1005665052 | 164 |
| 210 | 3300005842 | Ga0068858_100062528 | Ga0068858_1000625281 | 164 |
| 211 | 3300005842 | Ga0068858_100069703 | Ga0068858_1000697032 | 164 |
| 212 | 3300005842 | Ga0068858_100156710 | Ga0068858_1001567102 | 164 |
| 213 | 3300005842 | Ga0068858_100252085 | Ga0068858_1002520851 | 164 |
| 214 | 3300005842 | Ga0068858_100270604 | Ga0068858_1002706042 | 164 |
| 215 | 3300005843 | Ga0068860_100017324 | Ga0068860_1000173245 | 164 |
| 216 | 3300005843 | Ga0068860_100079084 | Ga0068860_1000790842 | 164 |
| 217 | 3300005843 | Ga0068860_100139821 | Ga0068860_1001398212 | 164 |
| 218 | 3300005843 | Ga0068860_100493492 | Ga0068860_1004934922 | 164 |
| 219 | 3300005937 | Ga0081455_10256151 | Ga0081455_102561512 | 164 |
| 220 | 3300005985 | Ga0081539_10001316 | Ga0081539_1000131622 | 164 |
| 221 | 3300005985 | Ga0081539_10007208 | Ga0081539_100072084 | 164 |
| 222 | 3300006175 | Ga0070712_100576502 | Ga0070712_1005765022 | 164 |
| 223 | 3300006237 | Ga0097621_100006835 | Ga0097621_1000068352 | 164 |
| 224 | 3300006237 | Ga0097621_100027684 | Ga0097621_1000276846 | 164 |
| 225 | 3300006358 | Ga0068871_100029282 | Ga0068871_1000292822 | 164 |
| 226 | 3300006852 | Ga0075433_10127954 | Ga0075433_101279544 | 164 |
| 227 | 3300006871 | Ga0075434_100025315 | Ga0075434_1000253158 | 164 |
| 228 | 3300006871 | Ga0075434_100188043 | Ga0075434_1001880432 | 164 |
| 229 | 3300006914 | Ga0075436_100053070 | Ga0075436_1000530703 | 164 |
| 230 | 3300006931 | Ga0097620_100003607 | Ga0097620_10000360720 | 164 |
| 231 | 3300006931 | Ga0097620_100086335 | Ga0097620_1000863352 | 164 |
| 232 | 3300006931 | Ga0097620_100348976 | Ga0097620_1003489762 | 164 |
| 233 | 3300006931 | Ga0097620_100386761 | Ga0097620_1003867611 | 164 |
| 234 | 3300006931 | Ga0097620_100420521 | Ga0097620_1004205212 | 164 |
| 235 | 3300006931 | Ga0097620_100611277 | Ga0097620_1006112772 | 164 |
| 236 | 3300009093 | Ga0105240_10273656 | Ga0105240_102736563 | 164 |
| 237 | 3300009093 | Ga0105240_10796373 | Ga0105240_107963731 | 164 |
| 238 | 3300009098 | Ga0105245_10303943 | Ga0105245_103039432 | 164 |
| 239 | 3300009098 | Ga0105245_10641929 | Ga0105245_106419291 | 164 |
| 240 | 3300009098 | Ga0105245_11082842 | Ga0105245_110828422 | 164 |
| 241 | 3300009098 | Ga0105245_11745229 | Ga0105245_117452291 | 164 |
| 242 | 3300009098 | Ga0105245_12258921 | Ga0105245_122589211 | 164 |
| 243 | 3300009101 | Ga0105247_10000326 | Ga0105247_100003268 | 164 |
| 244 | 3300009101 | Ga0105247_10071196 | Ga0105247_100711962 | 164 |
| 245 | 3300009101 | Ga0105247_11260410 | Ga0105247_112604101 | 164 |
| 246 | 3300009147 | Ga0114129_10030268 | Ga0114129_100302684 | 164 |
| 247 | 3300009148 | Ga0105243_10001215 | Ga0105243_1000121516 | 164 |
| 248 | 3300009148 | Ga0105243_10034462 | Ga0105243_100344622 | 164 |
| 249 | 3300009148 | Ga0105243_10920380 | Ga0105243_109203801 | 164 |
| 250 | 3300009148 | Ga0105243_11792793 | Ga0105243_117927931 | 164 |
| 251 | 3300009174 | Ga0105241_10033380 | Ga0105241_100333802 | 164 |
| 252 | 3300009174 | Ga0105241_10071817 | Ga0105241_100718172 | 164 |
| 253 | 3300009174 | Ga0105241_10079793 | Ga0105241_100797933 | 164 |
| 254 | 3300009174 | Ga0105241_10121684 | Ga0105241_101216842 | 164 |
| 255 | 3300009176 | Ga0105242_10293770 | Ga0105242_102937702 | 164 |
| 256 | 3300009177 | Ga0105248_10002791 | Ga0105248_1000279119 | 164 |
| 257 | 3300009545 | Ga0105237_10003293 | Ga0105237_1000329310 | 164 |
| 258 | 3300009545 | Ga0105237_10239894 | Ga0105237_102398942 | 164 |
| 259 | 3300009545 | Ga0105237_10808157 | Ga0105237_108081572 | 164 |
| 260 | 3300009545 | Ga0105237_12008799 | Ga0105237_120087991 | 164 |
| 261 | 3300009551 | Ga0105238_10329272 | Ga0105238_103292721 | 164 |
| 262 | 3300009553 | Ga0105249_10010826 | Ga0105249_100108266 | 164 |
| 263 | 3300009553 | Ga0105249_11398597 | Ga0105249_113985971 | 164 |
| 264 | 3300010375 | Ga0105239_10099847 | Ga0105239_100998472 | 164 |
| 265 | 3300010375 | Ga0105239_10303470 | Ga0105239_103034701 | 164 |
| 266 | 3300010375 | Ga0105239_10381770 | Ga0105239_103817702 | 164 |
| 267 | 3300010375 | Ga0105239_10678799 | Ga0105239_106787991 | 164 |
| 268 | 3300011119 | Ga0105246_10335123 | Ga0105246_103351232 | 164 |
| 269 | 3300011119 | Ga0105246_11174519 | Ga0105246_111745191 | 164 |
| 270 | 3300013100 | Ga0157373_10023592 | Ga0157373_100235922 | 164 |
| 271 | 3300013100 | Ga0157373_10186999 | Ga0157373_101869992 | 164 |
| 272 | 3300013100 | Ga0157373_10850558 | Ga0157373_108505582 | 164 |
| 273 | 3300013306 | Ga0163162_11216260 | Ga0163162_112162601 | 164 |
| 274 | 3300013307 | Ga0157372_10052061 | Ga0157372_100520611 | 164 |
| 275 | 3300013307 | Ga0157372_10751819 | Ga0157372_107518193 | 164 |
| 276 | 3300013307 | Ga0157372_11172907 | Ga0157372_111729071 | 164 |
| 277 | 3300013307 | Ga0157372_11345500 | Ga0157372_113455002 | 164 |
| 278 | 3300013307 | Ga0157372_11512626 | Ga0157372_115126261 | 164 |
| 279 | 3300013308 | Ga0157375_10140088 | Ga0157375_101400882 | 164 |
| 280 | 3300014325 | Ga0163163_10019265 | Ga0163163_100192654 | 164 |
| 281 | 3300014325 | Ga0163163_10796421 | Ga0163163_107964212 | 164 |
| 282 | 3300014325 | Ga0163163_11147152 | Ga0163163_111471522 | 164 |
| 283 | 3300014326 | Ga0157380_10514661 | Ga0157380_105146612 | 164 |
| 284 | 3300014968 | Ga0157379_10154257 | Ga0157379_101542573 | 164 |
| 285 | 3300014969 | Ga0157376_10392713 | Ga0157376_103927131 | 164 |
| 286 | 3300025885 | Ga0207653_10005200 | Ga0207653_100052002 | 164 |
| 287 | 3300025900 | Ga0207710_10000291 | Ga0207710_1000029111 | 164 |
| 288 | 3300025901 | Ga0207688_10245893 | Ga0207688_102458932 | 164 |
| 289 | 3300025904 | Ga0207647_10004426 | Ga0207647_100044262 | 164 |
| 290 | 3300025904 | Ga0207647_10116335 | Ga0207647_101163353 | 164 |
| 291 | 3300025904 | Ga0207647_10146470 | Ga0207647_101464702 | 164 |
| 292 | 3300025908 | Ga0207643_10005258 | Ga0207643_100052582 | 164 |
| 293 | 3300025911 | Ga0207654_10055464 | Ga0207654_100554642 | 164 |
| 294 | 3300025911 | Ga0207654_10126138 | Ga0207654_101261382 | 164 |
| 295 | 3300025911 | Ga0207654_10353051 | Ga0207654_103530512 | 164 |
| 296 | 3300025912 | Ga0207707_10041783 | Ga0207707_100417836 | 164 |
| 297 | 3300025912 | Ga0207707_10160160 | Ga0207707_101601602 | 164 |
| 298 | 3300025912 | Ga0207707_10387921 | Ga0207707_103879212 | 164 |
| 299 | 3300025913 | Ga0207695_10121921 | Ga0207695_101219211 | 164 |
| 300 | 3300025914 | Ga0207671_10051644 | Ga0207671_100516443 | 164 |
| 301 | 3300025914 | Ga0207671_10130715 | Ga0207671_101307152 | 164 |
| 302 | 3300025914 | Ga0207671_10866104 | Ga0207671_108661042 | 164 |
| 303 | 3300025919 | Ga0207657_10869492 | Ga0207657_108694921 | 164 |
| 304 | 3300025923 | Ga0207681_10036514 | Ga0207681_100365143 | 164 |
| 305 | 3300025924 | Ga0207694_10053205 | Ga0207694_100532052 | 164 |
| 306 | 3300025925 | Ga0207650_10000007 | Ga0207650_100000071 | 164 |
| 307 | 3300025925 | Ga0207650_10567678 | Ga0207650_105676782 | 164 |
| 308 | 3300025925 | Ga0207650_10987326 | Ga0207650_109873261 | 164 |
| 309 | 3300025927 | Ga0207687_10321760 | Ga0207687_103217601 | 164 |
| 310 | 3300025927 | Ga0207687_10758414 | Ga0207687_107584142 | 164 |
| 311 | 3300025927 | Ga0207687_11025109 | Ga0207687_110251091 | 164 |
| 312 | 3300025932 | Ga0207690_10892563 | Ga0207690_108925632 | 164 |
| 313 | 3300025933 | Ga0207706_10686251 | Ga0207706_106862512 | 164 |
| 314 | 3300025934 | Ga0207686_10284902 | Ga0207686_102849023 | 164 |
| 315 | 3300025935 | Ga0207709_10011194 | Ga0207709_100111942 | 164 |
| 316 | 3300025935 | Ga0207709_10107335 | Ga0207709_101073352 | 164 |
| 317 | 3300025935 | Ga0207709_10568209 | Ga0207709_105682092 | 164 |
| 318 | 3300025935 | Ga0207709_10976610 | Ga0207709_109766102 | 164 |
| 319 | 3300025936 | Ga0207670_10221110 | Ga0207670_102211102 | 164 |
| 320 | 3300025936 | Ga0207670_10276996 | Ga0207670_102769962 | 164 |
| 321 | 3300025938 | Ga0207704_10407201 | Ga0207704_104072012 | 164 |
| 322 | 3300025939 | Ga0207665_10149238 | Ga0207665_101492382 | 164 |
| 323 | 3300025939 | Ga0207665_10736843 | Ga0207665_107368432 | 164 |
| 324 | 3300025940 | Ga0207691_10376662 | Ga0207691_103766622 | 164 |
| 325 | 3300025940 | Ga0207691_10796125 | Ga0207691_107961252 | 164 |
| 326 | 3300025941 | Ga0207711_10067511 | Ga0207711_100675114 | 164 |
| 327 | 3300025941 | Ga0207711_10875866 | Ga0207711_108758662 | 164 |
| 328 | 3300025942 | Ga0207689_10204395 | Ga0207689_102043952 | 164 |
| 329 | 3300025942 | Ga0207689_10264296 | Ga0207689_102642963 | 164 |
| 330 | 3300025942 | Ga0207689_10310778 | Ga0207689_103107782 | 164 |
| 331 | 3300025945 | Ga0207679_10772241 | Ga0207679_107722412 | 164 |
| 332 | 3300025949 | Ga0207667_10121607 | Ga0207667_101216072 | 164 |
| 333 | 3300025960 | Ga0207651_10017400 | Ga0207651_100174004 | 164 |
| 334 | 3300025960 | Ga0207651_10114069 | Ga0207651_101140692 | 164 |
| 335 | 3300025961 | Ga0207712_10010848 | Ga0207712_100108486 | 164 |
| 336 | 3300025961 | Ga0207712_11197615 | Ga0207712_111976151 | 164 |
| 337 | 3300025981 | Ga0207640_10558690 | Ga0207640_105586902 | 164 |
| 338 | 3300025981 | Ga0207640_10925934 | Ga0207640_109259341 | 164 |
| 339 | 3300026035 | Ga0207703_10035528 | Ga0207703_100355282 | 164 |
| 340 | 3300026035 | Ga0207703_10066390 | Ga0207703_100663902 | 164 |
| 341 | 3300026035 | Ga0207703_10621746 | Ga0207703_106217461 | 164 |
| 342 | 3300026041 | Ga0207639_10202005 | Ga0207639_102020052 | 164 |
| 343 | 3300026041 | Ga0207639_10878753 | Ga0207639_108787531 | 164 |
| 344 | 3300026075 | Ga0207708_10013886 | Ga0207708_100138861 | 164 |
| 345 | 3300026075 | Ga0207708_10042178 | Ga0207708_100421783 | 164 |
| 346 | 3300026075 | Ga0207708_10589628 | Ga0207708_105896282 | 164 |
| 347 | 3300026088 | Ga0207641_10260353 | Ga0207641_102603531 | 164 |
| 348 | 3300026088 | Ga0207641_11016013 | Ga0207641_110160131 | 164 |
| 349 | 3300026089 | Ga0207648_10055934 | Ga0207648_100559342 | 164 |
| 350 | 3300026089 | Ga0207648_10118355 | Ga0207648_101183552 | 164 |
| 351 | 3300026095 | Ga0207676_10014677 | Ga0207676_100146772 | 164 |
| 352 | 3300026095 | Ga0207676_10153725 | Ga0207676_101537252 | 164 |
| 353 | 3300026095 | Ga0207676_10722216 | Ga0207676_107222161 | 164 |
| 354 | 3300026116 | Ga0207674_10173959 | Ga0207674_101739591 | 164 |
| 355 | 3300026116 | Ga0207674_11104768 | Ga0207674_111047681 | 164 |
| 356 | 3300026142 | Ga0207698_10025182 | Ga0207698_100251824 | 164 |
| 357 | 3300028380 | Ga0268265_10356961 | Ga0268265_103569612 | 164 |
| 358 | 3300028380 | Ga0268265_10560317 | Ga0268265_105603172 | 164 |
| 359 | 3300028381 | Ga0268264_10027849 | Ga0268264_100278492 | 164 |
| 360 | 3300028381 | Ga0268264_10038533 | Ga0268264_100385332 | 164 |
| 361 | 3300028381 | Ga0268264_10260833 | Ga0268264_102608332 | 164 |
| 362 | 3300028381 | Ga0268264_10751731 | Ga0268264_107517311 | 164 |
| 363 | 3300031731 | Ga0307405_10020166 | Ga0307405_100201662 | 164 |
| 364 | 3300031731 | Ga0307405_10122340 | Ga0307405_101223401 | 164 |
| 365 | 3300031824 | Ga0307413_10066118 | Ga0307413_100661182 | 164 |
| 366 | 3300031852 | Ga0307410_10040938 | Ga0307410_100409383 | 164 |
| 367 | 3300031901 | Ga0307406_10013540 | Ga0307406_100135402 | 164 |
| 368 | 3300031911 | Ga0307412_10077603 | Ga0307412_100776032 | 164 |
| 369 | 3300031911 | Ga0307412_10402366 | Ga0307412_104023662 | 164 |
| 370 | 3300032002 | Ga0307416_100061642 | Ga0307416_1000616421 | 164 |
| 371 | 3300032004 | Ga0307414_10110093 | Ga0307414_101100932 | 164 |
| 372 | 3300032004 | Ga0307414_10298588 | Ga0307414_102985881 | 164 |
| 373 | 3300032005 | Ga0307411_10049939 | Ga0307411_100499392 | 164 |
| 374 | 3300032126 | Ga0307415_100004550 | Ga0307415_1000045505 | 164 |
| 375 | 3300032126 | Ga0307415_101096734 | Ga0307415_1010967341 | 164 |
| 376 | 3300037418 | Ga0395900_0310855 | Ga0395900_0310855_669_1169 | 164 |
| 377 | 3300037466 | Ga0395898_0555645 | Ga0395898_0555645_128_664 | 164 |
| 378 | 3300038996 | Ga0242420_005601 | Ga0242420_005601_1211_1708 | 164 |
| 379 | 3300038996 | Ga0242420_015287 | Ga0242420_015287_290_787 | 164 |
| 380 | 3300042005 | Ga0439448_0053035 | Ga0439448_0053035_133_633 | 164 |
| 381 | 3300042157 | Ga0439458_0038702 | Ga0439458_0038702_283_783 | 164 |
| 382 | 3300044673 | Ga0453683_0196205 | Ga0453683_0196205_43_543 | 164 |
| 383 | 3300045051 | Ga0451576_0615804 | Ga0451576_0615804_187_684 | 164 |
| 384 | 3300045051 | Ga0451576_2010803 | Ga0451576_2010803_58_558 | 164 |
| 385 | 3300048907 | Ga0496104_0256720 | Ga0496104_0256720_245_862 | 164 |
| 386 | 3300048911 | Ga0496108_1053906 | Ga0496108_1053906_103_600 | 164 |
| 387 | 3300048913 | Ga0496110_0421622 | Ga0496110_0421622_65_682 | 164 |
| 388 | 3300048914 | Ga0496111_0138302 | Ga0496111_0138302_521_1018 | 164 |
| 389 | 3300048915 | Ga0496112_0834977 | Ga0496112_0834977_296_793 | 164 |
| 390 | 3300048915 | Ga0496112_1108397 | Ga0496112_1108397_150_647 | 164 |
| 391 | 3300048915 | Ga0496112_1420923 | Ga0496112_1420923_95_592 | 164 |
| 392 | 3300048916 | Ga0496113_0148947 | Ga0496113_0148947_506_1003 | 164 |
| 393 | 3300049127 | Ga0501306_001972 | Ga0501306_001972_1508_2008 | 164 |
| 394 | 3300049127 | Ga0501306_002365 | Ga0501306_002365_20_520 | 164 |
| 395 | 3300049127 | Ga0501306_070909 | Ga0501306_070909_68_565 | 164 |
| 396 | 3300049129 | Ga0501309_003794 | Ga0501309_003794_16_516 | 164 |
| 397 | 3300049129 | Ga0501309_024542 | Ga0501309_024542_111_611 | 164 |
| 398 | 3300049129 | Ga0501309_043229 | Ga0501309_043229_171_671 | 164 |
| 399 | 3300049132 | Ga0501343_005479 | Ga0501343_005479_228_728 | 164 |
| 400 | 3300049132 | Ga0501343_015511 | Ga0501343_015511_137_637 | 164 |
| 401 | 3300049132 | Ga0501343_021187 | Ga0501343_021187_62_562 | 164 |
| 402 | 3300049133 | Ga0501344_06568 | Ga0501344_06568_13_513 | 164 |
| 403 | 3300049134 | Ga0501345_01722 | Ga0501345_01722_204_704 | 164 |
| 404 | 3300049161 | Ga0501305_068866 | Ga0501305_068866_20_520 | 164 |
| 405 | 3300049161 | Ga0501305_092260 | Ga0501305_092260_14_514 | 164 |
| 406 | 3300049162 | Ga0501307_007639 | Ga0501307_007639_16_516 | 164 |
| 407 | 3300049162 | Ga0501307_043974 | Ga0501307_043974_20_520 | 164 |
| 408 | 3300049162 | Ga0501307_055067 | Ga0501307_055067_25_525 | 164 |
| 409 | 3300049513 | Ga0501290_019043 | Ga0501290_019043_34_534 | 164 |
| 410 | 3300049514 | Ga0501291_038332 | Ga0501291_038332_196_696 | 164 |
| 411 | 3300049514 | Ga0501291_078200 | Ga0501291_078200_64_564 | 164 |
| 412 | 3300049518 | Ga0501295_001752 | Ga0501295_001752_634_1134 | 164 |
| 413 | 3300049519 | Ga0501296_001534 | Ga0501296_001534_908_1408 | 164 |
| 414 | 3300049520 | Ga0501297_015234 | Ga0501297_015234_70_567 | 164 |
| 415 | 3300049521 | Ga0501298_001496 | Ga0501298_001496_1954_2454 | 164 |
| 416 | 3300049522 | Ga0501299_006163 | Ga0501299_006163_1307_1807 | 164 |
| 417 | 3300049523 | Ga0501300_011270 | Ga0501300_011270_708_1208 | 164 |
| 418 | 3300049527 | Ga0501311_061141 | Ga0501311_061141_20_520 | 164 |
| 419 | 3300049527 | Ga0501311_082380 | Ga0501311_082380_30_527 | 164 |
| 420 | 3300049528 | Ga0501312_070655 | Ga0501312_070655_16_516 | 164 |
| 421 | 3300049528 | Ga0501312_071294 | Ga0501312_071294_15_515 | 164 |
| 422 | 3300049531 | Ga0501315_056295 | Ga0501315_056295_110_610 | 164 |
| 423 | 3300049533 | Ga0501317_062118 | Ga0501317_062118_13_513 | 164 |
| 424 | 3300049536 | Ga0501320_017327 | Ga0501320_017327_292_792 | 164 |
| 425 | 3300049537 | Ga0501321_003607 | Ga0501321_003607_15_515 | 164 |
| 426 | 3300049537 | Ga0501321_040587 | Ga0501321_040587_132_632 | 164 |
| 427 | 3300049539 | Ga0501323_029472 | Ga0501323_029472_147_647 | 164 |
| 428 | 3300049541 | Ga0501325_019544 | Ga0501325_019544_13_513 | 164 |
| 429 | 3300049550 | Ga0501334_10380 | Ga0501334_10380_13_513 | 164 |
| 430 | 3300049551 | Ga0501335_009185 | Ga0501335_009185_229_729 | 164 |
| 431 | 3300049552 | Ga0501336_007395 | Ga0501336_007395_205_705 | 164 |
| 432 | 3300049552 | Ga0501336_012038 | Ga0501336_012038_198_698 | 164 |
| 433 | 3300049553 | Ga0501337_013802 | Ga0501337_013802_101_601 | 164 |
| 434 | 3300049556 | Ga0501340_009041 | Ga0501340_009041_81_581 | 164 |
| 435 | 3300049649 | Ga0501198_008570 | Ga0501198_008570_759_1259 | 164 |
| 436 | 3300049649 | Ga0501198_022372 | Ga0501198_022372_434_934 | 164 |
| 437 | 3300049649 | Ga0501198_024111 | Ga0501198_024111_322_819 | 164 |
| 438 | 3300049651 | Ga0501201_008422 | Ga0501201_008422_400_900 | 164 |
| 439 | 3300049652 | Ga0501202_023216 | Ga0501202_023216_400_900 | 164 |
| 440 | 3300049652 | Ga0501202_038456 | Ga0501202_038456_393_890 | 164 |
| 441 | 3300049652 | Ga0501202_130969 | Ga0501202_130969_118_618 | 164 |
| 442 | 3300049653 | Ga0501206_014721 | Ga0501206_014721_554_1054 | 164 |
| 443 | 3300049654 | Ga0501207_006265 | Ga0501207_006265_418_918 | 164 |
| 444 | 3300049654 | Ga0501207_017534 | Ga0501207_017534_211_711 | 164 |
| 445 | 3300049654 | Ga0501207_039635 | Ga0501207_039635_266_766 | 164 |
| 446 | 3300049656 | Ga0501209_024173 | Ga0501209_024173_718_1218 | 164 |
| 447 | 3300049660 | Ga0501216_005806 | Ga0501216_005806_785_1285 | 164 |
| 448 | 3300049660 | Ga0501216_043760 | Ga0501216_043760_59_559 | 164 |
| 449 | 3300049661 | Ga0501217_000272 | Ga0501217_000272_6430_6930 | 164 |
| 450 | 3300049661 | Ga0501217_007774 | Ga0501217_007774_990_1487 | 164 |
| 451 | 3300049661 | Ga0501217_027858 | Ga0501217_027858_403_903 | 164 |
| 452 | 3300049663 | Ga0501223_003122 | Ga0501223_003122_2456_2953 | 164 |
| 453 | 3300049663 | Ga0501223_008588 | Ga0501223_008588_1045_1545 | 164 |
| 454 | 3300049664 | Ga0501224_013593 | Ga0501224_013593_488_985 | 164 |
| 455 | 3300049664 | Ga0501224_017743 | Ga0501224_017743_79_579 | 164 |
| 456 | 3300049665 | Ga0501227_000627 | Ga0501227_000627_6191_6691 | 164 |
| 457 | 3300049665 | Ga0501227_018313 | Ga0501227_018313_357_857 | 164 |
| 458 | 3300049666 | Ga0501228_036638 | Ga0501228_036638_27_524 | 164 |
| 459 | 3300049667 | Ga0501230_001762 | Ga0501230_001762_619_1119 | 164 |
| 460 | 3300049667 | Ga0501230_106121 | Ga0501230_106121_10_507 | 164 |
| 461 | 3300049668 | Ga0501233_016488 | Ga0501233_016488_1005_1502 | 164 |
| 462 | 3300049668 | Ga0501233_020546 | Ga0501233_020546_206_706 | 164 |
| 463 | 3300049668 | Ga0501233_021061 | Ga0501233_021061_783_1283 | 164 |
| 464 | 3300049669 | Ga0501235_001808 | Ga0501235_001808_4003_4503 | 164 |
| 465 | 3300049669 | Ga0501235_008297 | Ga0501235_008297_957_1457 | 164 |
| 466 | 3300049669 | Ga0501235_119498 | Ga0501235_119498_23_520 | 164 |
| 467 | 3300049673 | Ga0501240_059710 | Ga0501240_059710_29_529 | 164 |
| 468 | 3300049673 | Ga0501240_106495 | Ga0501240_106495_37_534 | 164 |
| 469 | 3300049675 | Ga0501243_010138 | Ga0501243_010138_813_1313 | 164 |
| 470 | 3300049675 | Ga0501243_011612 | Ga0501243_011612_178_678 | 164 |
| 471 | 3300049676 | Ga0501246_016503 | Ga0501246_016503_143_643 | 164 |
| 472 | 3300049677 | Ga0501247_030518 | Ga0501247_030518_29_526 | 164 |
| 473 | 3300049679 | Ga0501249_007843 | Ga0501249_007843_669_1169 | 164 |
| 474 | 3300049679 | Ga0501249_028396 | Ga0501249_028396_356_856 | 164 |
| 475 | 3300049680 | Ga0501250_000960 | Ga0501250_000960_775_1275 | 164 |
| 476 | 3300049680 | Ga0501250_040398 | Ga0501250_040398_131_631 | 164 |
| 477 | 3300049681 | Ga0501251_007821 | Ga0501251_007821_663_1163 | 164 |
| 478 | 3300049683 | Ga0501253_025145 | Ga0501253_025145_489_989 | 164 |
| 479 | 3300049686 | Ga0501257_025680 | Ga0501257_025680_34_534 | 164 |
| 480 | 3300049688 | Ga0501259_015377 | Ga0501259_015377_411_911 | 164 |
| 481 | 3300049690 | Ga0501261_019719 | Ga0501261_019719_67_564 | 164 |
| 482 | 3300049704 | Ga0501221_009074 | Ga0501221_009074_553_1053 | 164 |
| 483 | 3300049705 | Ga0501225_0007355 | Ga0501225_0007355_1642_2142 | 164 |
| 484 | 3300049705 | Ga0501225_0040500 | Ga0501225_0040500_122_622 | 164 |
| 485 | 3300049705 | Ga0501225_0092555 | Ga0501225_0092555_32_532 | 164 |
| 486 | 3300049706 | Ga0501229_026747 | Ga0501229_026747_100_597 | 164 |
| 487 | 3300049707 | Ga0501234_014225 | Ga0501234_014225_426_926 | 164 |
| 488 | 3300049707 | Ga0501234_019526 | Ga0501234_019526_35_535 | 164 |
| 489 | 3300049708 | Ga0501245_011544 | Ga0501245_011544_576_1076 | 164 |
| 490 | 3300049760 | Ga0501263_010458 | Ga0501263_010458_583_1083 | 164 |
| 491 | 3300049765 | Ga0501268_021034 | Ga0501268_021034_94_594 | 164 |
| 492 | 3300049768 | Ga0501271_002012 | Ga0501271_002012_775_1275 | 164 |
| 493 | 3300049769 | Ga0501272_004202 | Ga0501272_004202_776_1276 | 164 |
| 494 | 3300049770 | Ga0501273_002151 | Ga0501273_002151_1259_1759 | 164 |
| 495 | 3300049771 | Ga0501274_009820 | Ga0501274_009820_79_579 | 164 |
| 496 | 3300049773 | Ga0501276_014803 | Ga0501276_014803_155_655 | 164 |
| 497 | 3300049775 | Ga0501279_027183 | Ga0501279_027183_127_624 | 164 |
| 498 | 3300049779 | Ga0501283_001783 | Ga0501283_001783_147_647 | 164 |
| 499 | 3300049779 | Ga0501283_009913 | Ga0501283_009913_163_663 | 164 |
| 500 | 3300049851 | Ga0501212_009800 | Ga0501212_009800_143_643 | 164 |
| 501 | 3300049853 | Ga0501226_005756 | Ga0501226_005756_67_564 | 164 |
| 502 | 3300050507 | nmdc:mga05p37_49976_c1 | nmdc:mga05p37_49976_c1_76_576 | 164 |
| 503 | 3300050512 | nmdc:mga0n895_122789_c1 | nmdc:mga0n895_122789_c1_1662_2204 | 164 |
| 504 | 3300050515 | nmdc:mga0a205_36669_c2 | nmdc:mga0a205_36669_c2_3319_3819 | 164 |
| 505 | 3300050515 | nmdc:mga0a205_58137_c1 | nmdc:mga0a205_58137_c1_2778_3320 | 164 |
| 506 | 3300059507 | Ga0587086_087920 | Ga0587086_087920_17_514 | 164 |
| 507 | 2162886007 | SwRhRL2b_contig_2076090 | SwRhRL2b_0304.00003660 | 165 |
| 508 | 3300005289 | Ga0065704_10084601 | Ga0065704_100846012 | 165 |
| 509 | 3300005290 | Ga0065712_10461956 | Ga0065712_104619561 | 165 |
| 510 | 3300005295 | Ga0065707_10003499 | Ga0065707_100034992 | 165 |
| 511 | 3300005344 | Ga0070661_100760467 | Ga0070661_1007604671 | 165 |
| 512 | 3300005364 | Ga0070673_101519551 | Ga0070673_1015195511 | 165 |
| 513 | 3300005471 | Ga0070698_100039997 | Ga0070698_1000399974 | 165 |
| 514 | 3300005518 | Ga0070699_100361073 | Ga0070699_1003610732 | 165 |
| 515 | 3300005536 | Ga0070697_100160187 | Ga0070697_1001601872 | 165 |
| 516 | 3300005564 | Ga0070664_101582683 | Ga0070664_1015826831 | 165 |
| 517 | 3300005577 | Ga0068857_100029693 | Ga0068857_1000296933 | 165 |
| 518 | 3300005577 | Ga0068857_100900180 | Ga0068857_1009001801 | 165 |
| 519 | 3300005618 | Ga0068864_100014735 | Ga0068864_1000147353 | 165 |
| 520 | 3300005841 | Ga0068863_100295491 | Ga0068863_1002954911 | 165 |
| 521 | 3300005843 | Ga0068860_100931109 | Ga0068860_1009311091 | 165 |
| 522 | 3300005985 | Ga0081539_10036177 | Ga0081539_100361772 | 165 |
| 523 | 3300009094 | Ga0111539_10001110 | Ga0111539_1000111019 | 165 |
| 524 | 3300009101 | Ga0105247_10641551 | Ga0105247_106415511 | 165 |
| 525 | 3300009174 | Ga0105241_11093166 | Ga0105241_110931662 | 165 |
| 526 | 3300009551 | Ga0105238_10095434 | Ga0105238_100954343 | 165 |
| 527 | 3300010375 | Ga0105239_10679333 | Ga0105239_106793331 | 165 |
| 528 | 3300013297 | Ga0157378_10433528 | Ga0157378_104335282 | 165 |
| 529 | 3300025924 | Ga0207694_10063974 | Ga0207694_100639742 | 165 |
| 530 | 3300025942 | Ga0207689_10989810 | Ga0207689_109898102 | 165 |
| 531 | 3300026088 | Ga0207641_11307772 | Ga0207641_113077721 | 165 |
| 532 | 3300026095 | Ga0207676_10090221 | Ga0207676_100902213 | 165 |
| 533 | 3300026116 | Ga0207674_10033731 | Ga0207674_100337313 | 165 |
| 534 | 3300026116 | Ga0207674_11033717 | Ga0207674_110337171 | 165 |
| 535 | 3300027907 | Ga0207428_10020242 | Ga0207428_100202424 | 165 |
| 536 | 3300028381 | Ga0268264_10769393 | Ga0268264_107693932 | 165 |
| 537 | 3300028381 | Ga0268264_11478470 | Ga0268264_114784701 | 165 |
| 538 | 3300031548 | Ga0307408_100543519 | Ga0307408_1005435191 | 165 |
| 539 | 3300031731 | Ga0307405_10285068 | Ga0307405_102850682 | 165 |
| 540 | 3300031824 | Ga0307413_10235009 | Ga0307413_102350092 | 165 |
| 541 | 3300031852 | Ga0307410_10076197 | Ga0307410_100761972 | 165 |
| 542 | 3300031911 | Ga0307412_10045754 | Ga0307412_100457542 | 165 |
| 543 | 3300031995 | Ga0307409_100169508 | Ga0307409_1001695081 | 165 |
| 544 | 3300032002 | Ga0307416_100038058 | Ga0307416_1000380584 | 165 |
| 545 | 3300032004 | Ga0307414_10101570 | Ga0307414_101015702 | 165 |
| 546 | 3300049516 | Ga0501293_015297 | Ga0501293_015297_96_599 | 165 |
| 547 | 3300049522 | Ga0501299_011471 | Ga0501299_011471_156_659 | 165 |
| 548 | 3300049649 | Ga0501198_004990 | Ga0501198_004990_18_521 | 165 |
| 549 | 3300049654 | Ga0501207_001884 | Ga0501207_001884_540_1043 | 165 |
| 550 | 3300049663 | Ga0501223_013459 | Ga0501223_013459_774_1277 | 165 |
| 551 | 3300049767 | Ga0501270_006880 | Ga0501270_006880_720_1223 | 165 |
| 552 | 3300049771 | Ga0501274_010871 | Ga0501274_010871_265_768 | 165 |
| 553 | 3300050511 | nmdc:mga08y16_606_c1 | nmdc:mga08y16_606_c1_9391_9888 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h3h-assembly1.cif.gz_A | crystal structure of a snoal-like protein of unknown function (bth_ii0226) from burkholderia thailandensis e264 at 1.60 a resolution | 0.6266 | 46 | 128 |
| 3km1-assembly1.cif.gz_B | zinc-reconstituted tomato chloroplast superoxide dismutase | 0.6236 | 47 | 154 |
| 7wx0-assembly1.cif.gz_B | e40k variant of cu/zn-superoxide dismutase from dog (canis familiaris) | 0.6223 | 45 | 154 |
| 1xtl-assembly4.cif.gz_B | crystal structure of p104h mutant of sod-like protein from bacillus subtilis. | 0.6061 | 51 | 157 |
| 1xtm-assembly1.cif.gz_B | crystal structure of the double mutant y88h-p104h of a sod-like protein from bacillus subtilis. | 0.6007 | 47 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4I2N7_648_756_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9614 | 63 | 79 | 3.30.200.20 |
| af_A0A1D6JYK5_395_630_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.8689 | 63 | 79 | 3.40.1110.10 |
| af_Q2G2G0_55_145_2.60.120.430 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin | 0.8201 | 54 | 155 | 2.60.120.430 |
| af_Q9VXG6_732_895_3.40.1110.10 | Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N | 0.8057 | 46 | 79 | 3.40.1110.10 |
| af_Q2G2G0_55_145_2.60.120.430 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin | 0.8036 | 54 | 155 | 2.60.120.430 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D6EXX9-F1-model_v4 | DM13 domain-containing protein | 0.9337 | 33 | 156 |
|
| AF-A0A832BN76-F1-model_v4 | DM13 domain-containing protein | 0.9294 | 47 | 154 |
|
| AF-A0A328LQY9-F1-model_v4 | DM13 domain-containing protein | 0.928 | 51 | 157 |
|
| AF-A0A3B8WDN3-F1-model_v4 | DM13 domain-containing protein | 0.9257 | 31 | 154 |
|
| AF-A0A385SIT6-F1-model_v4 | DM13 domain-containing protein | 0.9245 | 31 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar