F462781

General Info

Members Datasets Scaffolds Average Seq Length
552 288 1104 298

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0044162|Ga0501032_0044162_742_1605
Length 272
Sequence VDGFGDLTDITYHRHVDDATVRVAFDRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRPYTAEQMHQMGAVNAVVDHAELESEAIAWAREINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLEKRDPDWSRFPRYF

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
104 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
131 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
132 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2547132424 Nocardia nova SH22a Isolate Unclassified
260 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
261 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
262 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
263 2643221692 Nocardia sp. Root136 Isolate Unclassified
264 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
265 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
266 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
267 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
268 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
269 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
270 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
271 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
272 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
273 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
274 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
275 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
276 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
277 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
278 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
279 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
280 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
281 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
282 2922554459 Rhodococcus sp. 66b Isolate Unclassified
283 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
284 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
285 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
286 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
287 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
288 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.57
Metatranscriptomes 0
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 5.07
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0044162 3300049569 Bacteria 3017
2 SwRhRL2b_contig_1399640 2162886007 Bacteria 30488
3 rootH1_10031061 3300003323 Bacteria 6831
4 rootH1_10058451 3300003323 Bacteria 14255
5 Ga0055540_1001045 3300003792 Bacteria 17649
6 Ga0065704_10070148 3300005289 Bacteria 264542
7 Ga0070683_100056574 3300005329 Bacteria 3643
8 Ga0070683_100151703 3300005329 Bacteria 2197
9 Ga0068868_100001090 3300005338 Bacteria 18589
10 Ga0070660_100102254 3300005339 Bacteria 2271
11 Ga0070660_100109351 3300005339 Bacteria 2198
12 Ga0070687_100100843 3300005343 Bacteria 1616
13 Ga0070675_100115042 3300005354 Bacteria 2280
14 Ga0070714_100006931 3300005435 Bacteria 8786
15 Ga0070714_100047828 3300005435 Bacteria 3636
16 Ga0070713_100017666 3300005436 Bacteria 5402
17 Ga0070713_100036792 3300005436 Bacteria 3953
18 Ga0070663_100004398 3300005455 Bacteria 8278
19 Ga0070663_100257816 3300005455 Bacteria 1382
20 Ga0070662_100097087 3300005457 Bacteria 2224
21 Ga0070681_10039603 3300005458 Bacteria 4723
22 Ga0068867_100009052 3300005459 Bacteria 7025
23 Ga0070707_100019514 3300005468 Bacteria 6386
24 Ga0070698_100009265 3300005471 Bacteria 10562
25 Ga0070679_100114551 3300005530 Bacteria 2681
26 Ga0070679_100157861 3300005530 Bacteria 2243
27 Ga0068853_100053822 3300005539 Bacteria 3467
28 Ga0068855_100000068 3300005563 Bacteria 124575
29 Ga0068855_100009760 3300005563 Bacteria 11581
30 Ga0068857_100060323 3300005577 Bacteria 3369
31 Ga0068857_100292298 3300005577 Bacteria 1501
32 Ga0068856_100013637 3300005614 Bacteria 7863
33 Ga0068856_100066419 3300005614 Bacteria 3564
34 Ga0068852_100084043 3300005616 Bacteria 2832
35 Ga0068859_100466088 3300005617 Bacteria 1359
36 Ga0068866_10005985 3300005718 Bacteria 5061
37 Ga0068861_100092538 3300005719 Bacteria 2389
38 Ga0068870_10085100 3300005840 Bacteria 1757
39 Ga0081455_10000845 3300005937 Bacteria 39490
40 Ga0081455_10010118 3300005937 Bacteria 9614
41 Ga0081455_10059250 3300005937 Bacteria 3234
42 Ga0081455_10072083 3300005937 Bacteria 2862
43 Ga0081538_10009208 3300005981 Bacteria 8273
44 Ga0081538_10015271 3300005981 Bacteria 5954
45 Ga0070717_10049018 3300006028 Bacteria 3466
46 Ga0070717_10058336 3300006028 Bacteria 3192
47 Ga0075363_100170414 3300006048 Bacteria 1236
48 Ga0075364_10043549 3300006051 Bacteria 2919
49 Ga0070712_100095929 3300006175 Bacteria 2183
50 Ga0075367_10176359 3300006178 Bacteria 1332
51 Ga0097621_100069700 3300006237 Bacteria 2903
52 Ga0097621_100080850 3300006237 Bacteria 2704
53 Ga0075370_10005847 3300006353 Bacteria 6147
54 Ga0075428_100001171 3300006844 Bacteria 28061
55 Ga0075430_100062632 3300006846 Bacteria 3124
56 Ga0075431_100089140 3300006847 Bacteria 3184
57 Ga0075431_100466589 3300006847 Bacteria 1257
58 Ga0075429_100013838 3300006880 Bacteria 6997
59 Ga0075429_100079847 3300006880 Bacteria 2851
60 Ga0068865_100057090 3300006881 Bacteria 2722
61 Ga0097620_100078223 3300006931 Bacteria 3348
62 Ga0097620_100466058 3300006931 Bacteria 1359
63 Ga0111539_10019124 3300009094 Bacteria 8465
64 Ga0105245_10000008 3300009098 Bacteria 279925
65 Ga0105245_10329169 3300009098 Bacteria 1507
66 Ga0114129_10000201 3300009147 Bacteria 66395
67 Ga0114129_10017962 3300009147 Bacteria 10071
68 Ga0105243_10004610 3300009148 Bacteria 10867
69 Ga0105242_10014127 3300009176 Bacteria 6182
70 Ga0105238_10123573 3300009551 Bacteria 2568
71 Ga0105249_10615149 3300009553 Bacteria 1142
72 Ga0105239_10413835 3300010375 Bacteria 1527
73 Ga0157369_10026140 3300013105 Bacteria 6477
74 Ga0157374_10378819 3300013296 Bacteria 1409
75 Ga0163162_10559173 3300013306 Bacteria 1272
76 Ga0157375_10230051 3300013308 Bacteria 2013
77 Ga0163161_10022461 3300017792 Bacteria 4443
78 Ga0213873_10000032 3300021358 Bacteria 36510
79 Ga0213876_10054432 3300021384 Bacteria 2113
80 Ga0213875_10000159 3300021388 Bacteria 71303
81 Ga0213875_10000439 3300021388 Bacteria 36385
82 Ga0209051_1001486 3300025303 Bacteria 19702
83 Ga0209051_1002389 3300025303 Bacteria 13544
84 Ga0207642_10037562 3300025899 Bacteria 2088
85 Ga0207647_10011802 3300025904 Bacteria 6107
86 Ga0207693_10072574 3300025915 Bacteria 2695
87 Ga0207693_10247918 3300025915 Bacteria 1398
88 Ga0207662_10014239 3300025918 Bacteria 4459
89 Ga0207657_10071960 3300025919 Bacteria 2926
90 Ga0207657_10078744 3300025919 Bacteria 2774
91 Ga0207657_10138214 3300025919 Bacteria 1992
92 Ga0207652_10286194 3300025921 Bacteria 1487
93 Ga0207646_10064228 3300025922 Bacteria 3276
94 Ga0207646_10107186 3300025922 Bacteria 2507
95 Ga0207687_10000160 3300025927 Bacteria 45423
96 Ga0207700_10021606 3300025928 Bacteria 4398
97 Ga0207700_10053997 3300025928 Bacteria 3014
98 Ga0207664_10004324 3300025929 Bacteria 9624
99 Ga0207664_10009026 3300025929 Bacteria 6983
100 Ga0207664_10097179 3300025929 Bacteria 2426
101 Ga0207709_10003092 3300025935 Bacteria 10039
102 Ga0207709_10029450 3300025935 Bacteria 3185
103 Ga0207670_10036467 3300025936 Bacteria 3197
104 Ga0207661_10124311 3300025944 Bacteria 2201
105 Ga0207667_10000057 3300025949 Bacteria 202301
106 Ga0207667_10009009 3300025949 Bacteria 11803
107 Ga0207668_10067494 3300025972 Bacteria 2539
108 Ga0207658_10011951 3300025986 Bacteria 5919
109 Ga0207639_10242317 3300026041 Bacteria 1568
110 Ga0207678_10000657 3300026067 Bacteria 31782
111 Ga0207678_10014088 3300026067 Bacteria 7030
112 Ga0207702_10050976 3300026078 Bacteria 3496
113 Ga0207648_10004773 3300026089 Bacteria 13846
114 Ga0207648_10022103 3300026089 Bacteria 5714
115 Ga0207674_10154613 3300026116 Bacteria 2249
116 Ga0207674_10416519 3300026116 Bacteria 1298
117 Ga0207683_10235966 3300026121 Bacteria 1668
118 Ga0207698_10184044 3300026142 Bacteria 1854
119 Ga0268264_10152079 3300028381 Bacteria 2076
120 Ga0265334_10022549 3300028573 Bacteria 2564
121 Ga0307515_10204500 3300028794 Bacteria 1839
122 Ga0307511_10030027 3300030521 Bacteria 4890
123 Ga0265320_10001604 3300031240 Bacteria 16231
124 Ga0265327_10000624 3300031251 Bacteria 58153
125 Ga0265327_10004897 3300031251 Bacteria 11564
126 Ga0307408_100021381 3300031548 Bacteria 4378
127 Ga0316575_10030959 3300031665 Bacteria 2093
128 Ga0265314_10017039 3300031711 Bacteria 5713
129 Ga0316578_10006618 3300031728 Bacteria 5739
130 Ga0316578_10012469 3300031728 Bacteria 4483
131 Ga0316578_10082517 3300031728 Bacteria 1913
132 Ga0307405_10051888 3300031731 Bacteria 2547
133 Ga0316577_10008087 3300031733 Bacteria 5623
134 Ga0316577_10054282 3300031733 Bacteria 2236
135 Ga0307410_10081713 3300031852 Bacteria 2271
136 Ga0307406_10000232 3300031901 Bacteria 33842
137 Ga0307406_10009286 3300031901 Bacteria 5509
138 Ga0307406_10386966 3300031901 Bacteria 1104
139 Ga0307407_10155350 3300031903 Bacteria 1491
140 Ga0307409_100000004 3300031995 Bacteria 84332
141 Ga0307416_100063971 3300032002 Bacteria 3015
142 Ga0307414_10037316 3300032004 Bacteria 3252
143 Ga0307414_10056976 3300032004 Bacteria 2744
144 Ga0307415_100437156 3300032126 Bacteria 1127
145 Ga0316585_10020121 3300032137 Bacteria 2040
146 Ga0316580_10018081 3300032139 Bacteria 2168
147 Ga0316580_10044077 3300032139 Bacteria 1376
148 Ga0307507_10013426 3300033179 Bacteria 9945
149 Ga0373934_0027350 3300035086 Bacteria 2215
150 Ga0373923_0063200 3300035111 Bacteria 1576
151 Ga0373936_0048768 3300035113 Bacteria 1710
152 Ga0373953_0005883 3300035117 Bacteria 4007
153 Ga0373954_0105410 3300035118 Bacteria 1361
154 Ga0373956_0053702 3300035119 Bacteria 1814
155 Ga0373957_0001217 3300035120 Bacteria 6870
156 Ga0373946_0015132 3300035171 Bacteria 2919
157 Ga0373955_0037185 3300035172 Bacteria 2587
158 Ga0316574_0000029 3300035398 Bacteria 35891
159 Ga0316574_0079943 3300035398 Bacteria 2074
160 Ga0316574_0283893 3300035398 Bacteria 1054
161 Ga0373924_0018443 3300035410 Bacteria 2688
162 Ga0373935_0080312 3300035692 Bacteria 2118
163 Ga0373927_0180600 3300035695 Bacteria 1384
164 Ga0373933_0061357 3300035724 Bacteria 2268
165 Ga0373937_0147519 3300036401 Bacteria 2203
166 Ga0316582_0017627 3300036647 Bacteria 4137
167 Ga0316584_0010117 3300036712 Bacteria 6579
168 Ga0316584_0064111 3300036712 Bacteria 2751
169 Ga0316584_0123571 3300036712 Bacteria 1933
170 Ga0373925_0000017 3300037068 Bacteria 174289
171 Ga0373925_0437789 3300037068 Bacteria 1069
172 Ga0395899_0337633 3300037312 Bacteria 1011
173 Ga0395898_0046192 3300037466 Bacteria 4277
174 Ga0395905_0000582 3300037471 Bacteria 49196
175 Ga0395905_0099665 3300037471 Bacteria 2728
176 Ga0395905_0154688 3300037471 Bacteria 2157
177 Ga0316581_0019894 3300037588 Bacteria 1961
178 Ga0436364_0154596 3300037853 Bacteria 62862
179 Ga0436364_0629970 3300037853 Bacteria 987
180 Ga0436364_0789043 3300037853 Bacteria 48837
181 Ga0395901_0333444 3300038443 Bacteria 1568
182 Ga0400484_05243 3300038725 Bacteria 5213
183 Ga0400490_11918 3300038726 Bacteria 4227
184 Ga0400490_31998 3300038726 Bacteria 20941
185 Ga0400485_03085 3300038735 Bacteria 3756
186 Ga0400483_048213 3300039062 Bacteria 49637
187 Ga0400483_114555 3300039062 Bacteria 13767
188 Ga0400483_200780 3300039062 Bacteria 45688
189 Ga0436365_1346750 3300039437 Bacteria 5549
190 Ga0436360_0542964 3300039438 Bacteria 1077
191 Ga0436362_0405432 3300039453 Bacteria 89010
192 Ga0436362_0977183 3300039453 Bacteria 1096
193 Ga0451791_1038276 3300041451 Bacteria 1178
194 Ga0451797_0270985 3300041453 Bacteria 6348
195 Ga0451807_0452327 3300041486 Bacteria 21296
196 Ga0451837_0057995 3300041494 Bacteria 1315
197 Ga0439444_0013803 3300042437 Bacteria 1342
198 Ga0439444_0020938 3300042437 Bacteria 1155
199 Ga0439464_0002489 3300042439 Bacteria 4540
200 Ga0439460_0001732 3300042461 Bacteria 5182
201 Ga0451577_0379501 3300042876 Bacteria 1283
202 Ga0466969_0017291 3300044656 Bacteria 3767
203 Ga0466966_0002361 3300044684 Bacteria 12330
204 Ga0466966_0017833 3300044684 Bacteria 4687
205 Ga0466966_0188633 3300044684 Bacteria 1249
206 Ga0466961_0007428 3300044693 Bacteria 6975
207 Ga0466963_0030940 3300044694 Bacteria 3457
208 Ga0466963_0064034 3300044694 Bacteria 2462
209 Ga0466963_0278919 3300044694 Bacteria 1174
210 Ga0453684_0139083 3300044712 Bacteria 2903
211 Ga0466970_0015474 3300044765 Bacteria 3923
212 Ga0466970_0050078 3300044765 Bacteria 2228
213 Ga0466970_0281077 3300044765 Bacteria 936
214 Ga0466959_0001446 3300045049 Bacteria 14548
215 Ga0466959_0143275 3300045049 Bacteria 1687
216 Ga0466958_0111456 3300045836 Bacteria 1708
217 Ga0466967_0016850 3300045976 Bacteria 5778
218 Ga0466967_0017808 3300045976 Bacteria 5656
219 Ga0466967_0021428 3300045976 Bacteria 5249
220 Ga0466967_0194993 3300045976 Bacteria 1916
221 Ga0466967_0231237 3300045976 Bacteria 1760
222 Ga0466967_0259983 3300045976 Bacteria 1661
223 Ga0466967_0413281 3300045976 Bacteria 1314
224 Ga0495592_0026105 3300046454 Bacteria 4431
225 Ga0495651_0077846 3300046462 Bacteria 2509
226 Ga0495653_0070858 3300046463 Bacteria 2607
227 Ga0495580_0277769 3300046472 Bacteria 1143
228 Ga0495662_0095536 3300046476 Bacteria 1452
229 Ga0495664_0046273 3300046477 Bacteria 2581
230 Ga0495594_0025489 3300046499 Bacteria 3178
231 Ga0495607_0039025 3300046501 Bacteria 2839
232 Ga0495608_0050356 3300046511 Bacteria 2763
233 Ga0495628_0220493 3300046516 Bacteria 1424
234 Ga0495630_0071256 3300046517 Bacteria 2615
235 Ga0495652_0218792 3300046529 Bacteria 1432
236 Ga0495665_0003197 3300046531 Bacteria 8869
237 Ga0495665_0214457 3300046531 Bacteria 996
238 Ga0495640_0232313 3300046533 Bacteria 1159
239 Ga0495586_0053296 3300046535 Bacteria 2191
240 Ga0495587_0033147 3300046536 Bacteria 3119
241 Ga0495645_0061689 3300046543 Bacteria 2716
242 Ga0495667_0021069 3300046559 Bacteria 4397
243 Ga0495656_0007033 3300046615 Bacteria 3963
244 Ga0495668_0023838 3300046616 Bacteria 3484
245 Ga0495635_0056829 3300046663 Bacteria 2693
246 Ga0495659_0000676 3300046664 Bacteria 12390
247 Ga0495659_0045036 3300046664 Bacteria 1588
248 Ga0495588_0040181 3300046674 Bacteria 2385
249 Ga0495588_0182724 3300046674 Bacteria 1108
250 Ga0495657_0055247 3300046675 Bacteria 2649
251 Ga0495623_0037567 3300046679 Bacteria 3098
252 Ga0495646_0039402 3300046680 Bacteria 2913
253 Ga0495600_0051462 3300046809 Bacteria 2688
254 Ga0495581_0042418 3300047315 Bacteria 2633
255 Ga0495581_0144931 3300047315 Bacteria 1386
256 Ga0495604_0156078 3300047317 Bacteria 1616
257 Ga0495636_0027176 3300047318 Bacteria 2331
258 Ga0495636_0075261 3300047318 Bacteria 1447
259 Ga0495674_0033095 3300047319 Bacteria 4685
260 Ga0495680_0048728 3300047322 Bacteria 3325
261 Ga0495680_0053466 3300047322 Bacteria 3142
262 Ga0495683_0000314 3300047323 Bacteria 40788
263 Ga0495675_0130587 3300047444 Bacteria 1561
264 Ga0495684_0058448 3300047471 Bacteria 2937
265 Ga0495602_0030905 3300048088 Bacteria 5070
266 Ga0496100_0143547 3300048903 Bacteria 1695
267 Ga0496100_0209518 3300048903 Bacteria 1425
268 Ga0496101_0002474 3300048904 Bacteria 11347
269 Ga0496102_0065053 3300048905 Bacteria 3341
270 Ga0496103_0033304 3300048906 Bacteria 3147
271 Ga0496103_0083971 3300048906 Bacteria 2005
272 Ga0496104_0007142 3300048907 Bacteria 9846
273 Ga0496105_0174336 3300048908 Bacteria 1762
274 Ga0496107_0064795 3300048910 Bacteria 2649
275 Ga0496108_0007593 3300048911 Bacteria 8782
276 Ga0496108_0215557 3300048911 Bacteria 1667
277 Ga0496108_0233990 3300048911 Bacteria 1598
278 Ga0496109_0043012 3300048912 Bacteria 4094
279 Ga0496109_0153828 3300048912 Bacteria 2154
280 Ga0496109_0192947 3300048912 Bacteria 1914
281 Ga0496110_0001157 3300048913 Bacteria 18713
282 Ga0496110_0155480 3300048913 Bacteria 2071
283 Ga0496111_0024566 3300048914 Bacteria 4245
284 Ga0496111_0085450 3300048914 Bacteria 2307
285 Ga0496111_0180196 3300048914 Bacteria 1570
286 Ga0496112_0019039 3300048915 Bacteria 6471
287 Ga0496113_0024122 3300048916 Bacteria 4319
288 Ga0496113_0047356 3300048916 Bacteria 3195
289 Ga0496114_0007960 3300048917 Bacteria 8387
290 Ga0496114_0013168 3300048917 Bacteria 6629
291 Ga0496124_0000001 3300048927 Bacteria 1747840
292 Ga0496125_0034110 3300048928 Bacteria 4490
293 Ga0496126_0020708 3300048929 Bacteria 6441
294 Ga0496126_0041611 3300048929 Bacteria 4250
295 Ga0496126_0058023 3300048929 Bacteria 3491
296 Ga0496126_0210586 3300048929 Bacteria 1637
297 Ga0496126_0454127 3300048929 Bacteria 1031
298 Ga0501290_009205 3300049513 Bacteria 1255
299 Ga0501031_0003257 3300049568 Bacteria 10436
300 Ga0501031_0080037 3300049568 Bacteria 2130
301 Ga0501031_0087058 3300049568 Bacteria 2037
302 Ga0501031_0237326 3300049568 Bacteria 1185
303 Ga0501032_0059834 3300049569 Bacteria 2556
304 Ga0501032_0092057 3300049569 Bacteria 2011
305 Ga0501033_0003522 3300049570 Bacteria 12814
306 Ga0501033_0019923 3300049570 Bacteria 5070
307 Ga0501033_0037701 3300049570 Bacteria 3617
308 Ga0501033_0049918 3300049570 Bacteria 3105
309 Ga0501033_0332777 3300049570 Bacteria 1065
310 Ga0501034_0000603 3300049571 Bacteria 56634
311 Ga0501034_0016148 3300049571 Bacteria 7659
312 Ga0501034_0229948 3300049571 Bacteria 1804
313 Ga0501036_0002741 3300049572 Bacteria 13933
314 Ga0501036_0003902 3300049572 Bacteria 11966
315 Ga0501036_0004284 3300049572 Bacteria 11523
316 Ga0501036_0005713 3300049572 Bacteria 10093
317 Ga0501036_0083282 3300049572 Bacteria 2704
318 Ga0501036_0158655 3300049572 Bacteria 1908
319 Ga0501036_0201404 3300049572 Bacteria 1674
320 Ga0501036_0351562 3300049572 Bacteria 1231
321 Ga0501036_0380413 3300049572 Bacteria 1178
322 Ga0501037_0016489 3300049573 Bacteria 5438
323 Ga0501037_0033133 3300049573 Bacteria 3817
324 Ga0501037_0249649 3300049573 Bacteria 1242
325 Ga0501038_0015008 3300049574 Bacteria 7055
326 Ga0501038_0015040 3300049574 Bacteria 7048
327 Ga0501038_0088973 3300049574 Bacteria 2591
328 Ga0501038_0117281 3300049574 Bacteria 2199
329 Ga0501038_0125137 3300049574 Bacteria 2116
330 Ga0501038_0175722 3300049574 Bacteria 1731
331 Ga0501038_0262883 3300049574 Bacteria 1363
332 Ga0501039_0011554 3300049575 Bacteria 6721
333 Ga0501039_0014689 3300049575 Bacteria 5990
334 Ga0501040_0003589 3300049576 Bacteria 10037
335 Ga0501040_0004335 3300049576 Bacteria 9219
336 Ga0501040_0018569 3300049576 Bacteria 4617
337 Ga0501040_0020769 3300049576 Bacteria 4379
338 Ga0501040_0030256 3300049576 Bacteria 3657
339 Ga0501040_0337130 3300049576 Bacteria 1079
340 Ga0501041_0003679 3300049577 Bacteria 8815
341 Ga0501041_0005714 3300049577 Bacteria 7269
342 Ga0501041_0008793 3300049577 Bacteria 5943
343 Ga0501041_0016278 3300049577 Bacteria 4420
344 Ga0501041_0279127 3300049577 Bacteria 1051
345 Ga0501042_0003210 3300049578 Bacteria 10210
346 Ga0501042_0003639 3300049578 Bacteria 9718
347 Ga0501042_0065729 3300049578 Bacteria 2592
348 Ga0501042_0218822 3300049578 Bacteria 1373
349 Ga0501043_0021957 3300049579 Bacteria 5006
350 Ga0501046_0003088 3300049580 Bacteria 15385
351 Ga0501046_0003109 3300049580 Bacteria 15316
352 Ga0501046_0003609 3300049580 Bacteria 14171
353 Ga0501046_0023561 3300049580 Bacteria 5062
354 Ga0501046_0026146 3300049580 Bacteria 4768
355 Ga0501046_0107948 3300049580 Bacteria 2129
356 Ga0501046_0189699 3300049580 Bacteria 1534
357 Ga0501047_0008756 3300049581 Bacteria 9549
358 Ga0501047_0083260 3300049581 Bacteria 3074
359 Ga0501048_0014556 3300049582 Bacteria 5821
360 Ga0501048_0015388 3300049582 Bacteria 5649
361 Ga0501048_0016677 3300049582 Bacteria 5416
362 Ga0501048_0023492 3300049582 Bacteria 4504
363 Ga0501048_0177687 3300049582 Bacteria 1509
364 Ga0501048_0181282 3300049582 Bacteria 1493
365 Ga0501048_0304667 3300049582 Bacteria 1133
366 Ga0501067_0015098 3300049583 Bacteria 4274
367 Ga0501068_0007111 3300049584 Bacteria 6194
368 Ga0501068_0008366 3300049584 Bacteria 5754
369 Ga0501068_0036624 3300049584 Bacteria 2935
370 Ga0501068_0038486 3300049584 Bacteria 2866
371 Ga0501068_0051773 3300049584 Bacteria 2485
372 Ga0501068_0097400 3300049584 Bacteria 1820
373 Ga0501069_0004472 3300049585 Bacteria 7220
374 Ga0501069_0006486 3300049585 Bacteria 6118
375 Ga0501069_0172152 3300049585 Bacteria 1249
376 Ga0501070_0001187 3300049586 Bacteria 23296
377 Ga0501070_0001192 3300049586 Bacteria 23236
378 Ga0501070_0018867 3300049586 Bacteria 5786
379 Ga0501070_0088824 3300049586 Bacteria 2558
380 Ga0501070_0138915 3300049586 Bacteria 2006
381 Ga0501071_0000924 3300049587 Bacteria 15913
382 Ga0501071_0011394 3300049587 Bacteria 5990
383 Ga0501071_0017554 3300049587 Bacteria 4938
384 Ga0501071_0020964 3300049587 Bacteria 4548
385 Ga0501071_0060945 3300049587 Bacteria 2732
386 Ga0501071_0225871 3300049587 Bacteria 1410
387 Ga0501071_0263215 3300049587 Bacteria 1303
388 Ga0501071_0473331 3300049587 Bacteria 960
389 Ga0501072_0001169 3300049588 Bacteria 19529
390 Ga0501072_0001251 3300049588 Bacteria 18961
391 Ga0501072_0001632 3300049588 Bacteria 16787
392 Ga0501072_0020541 3300049588 Bacteria 5118
393 Ga0501072_0026908 3300049588 Bacteria 4488
394 Ga0501072_0057895 3300049588 Bacteria 3055
395 Ga0501072_0070400 3300049588 Bacteria 2762
396 Ga0501072_0120624 3300049588 Bacteria 2089
397 Ga0501072_0279047 3300049588 Bacteria 1329
398 Ga0501072_0434137 3300049588 Bacteria 1040
399 Ga0501073_0009076 3300049589 Bacteria 7340
400 Ga0501073_0025588 3300049589 Bacteria 4230
401 Ga0501073_0089471 3300049589 Bacteria 2140
402 Ga0501074_0003220 3300049590 Bacteria 11529
403 Ga0501074_0011001 3300049590 Bacteria 6569
404 Ga0501074_0024048 3300049590 Bacteria 4427
405 Ga0501074_0027220 3300049590 Bacteria 4146
406 Ga0501074_0034944 3300049590 Bacteria 3642
407 Ga0501074_0071223 3300049590 Bacteria 2499
408 Ga0501074_0085989 3300049590 Bacteria 2253
409 Ga0501074_0188873 3300049590 Bacteria 1469
410 Ga0501075_0020165 3300049591 Bacteria 4844
411 Ga0501075_0033444 3300049591 Bacteria 3825
412 Ga0501075_0049335 3300049591 Bacteria 3164
413 Ga0501075_0053657 3300049591 Bacteria 3031
414 Ga0501075_0101010 3300049591 Bacteria 2190
415 Ga0501075_0267191 3300049591 Bacteria 1304
416 Ga0501075_0339954 3300049591 Bacteria 1144
417 Ga0501076_0001029 3300049592 Bacteria 18341
418 Ga0501076_0001272 3300049592 Bacteria 16811
419 Ga0501076_0002611 3300049592 Bacteria 12407
420 Ga0501076_0003635 3300049592 Bacteria 10832
421 Ga0501076_0014991 3300049592 Bacteria 5851
422 Ga0501076_0015779 3300049592 Bacteria 5713
423 Ga0501076_0023931 3300049592 Bacteria 4713
424 Ga0501076_0045917 3300049592 Bacteria 3450
425 Ga0501076_0165521 3300049592 Bacteria 1802
426 Ga0501076_0485330 3300049592 Bacteria 1018
427 Ga0501077_0007753 3300049593 Bacteria 6623
428 Ga0501077_0038881 3300049593 Bacteria 3030
429 Ga0501077_0043751 3300049593 Bacteria 2846
430 Ga0501077_0046257 3300049593 Bacteria 2765
431 Ga0501077_0082324 3300049593 Bacteria 2040
432 Ga0501077_0140830 3300049593 Bacteria 1530
433 Ga0501209_049200 3300049656 Bacteria 1145
434 Ga0501079_0003247 3300049741 Bacteria 11912
435 Ga0501079_0003462 3300049741 Bacteria 11598
436 Ga0501079_0011798 3300049741 Bacteria 6672
437 Ga0501079_0031531 3300049741 Bacteria 4074
438 Ga0501079_0046803 3300049741 Bacteria 3338
439 Ga0501079_0049768 3300049741 Bacteria 3235
440 Ga0501079_0067496 3300049741 Bacteria 2760
441 Ga0501079_0074871 3300049741 Bacteria 2618
442 Ga0501079_0126008 3300049741 Bacteria 1992
443 Ga0501079_0180703 3300049741 Bacteria 1646
444 Ga0501080_0011792 3300049742 Bacteria 8009
445 Ga0501080_0021174 3300049742 Bacteria 6018
446 Ga0501080_0056178 3300049742 Bacteria 3667
447 Ga0501080_0063083 3300049742 Bacteria 3449
448 Ga0501080_0075963 3300049742 Bacteria 3125
449 Ga0501080_0131232 3300049742 Bacteria 2319
450 Ga0501080_0151680 3300049742 Bacteria 2142
451 Ga0501080_0275923 3300049742 Bacteria 1529
452 Ga0501080_0362099 3300049742 Bacteria 1308
453 Ga0501080_0515245 3300049742 Bacteria 1068
454 Ga0501081_0000904 3300049743 Bacteria 17618
455 Ga0501081_0001734 3300049743 Bacteria 13522
456 Ga0501081_0010282 3300049743 Bacteria 6108
457 Ga0501081_0010409 3300049743 Bacteria 6065
458 Ga0501081_0021199 3300049743 Bacteria 4337
459 Ga0501081_0049169 3300049743 Bacteria 2903
460 Ga0501081_0052714 3300049743 Bacteria 2808
461 Ga0501081_0159564 3300049743 Bacteria 1624
462 Ga0501081_0172477 3300049743 Bacteria 1562
463 Ga0501081_0184144 3300049743 Bacteria 1511
464 Ga0501083_0004878 3300049744 Bacteria 9491
465 Ga0501083_0012035 3300049744 Bacteria 6058
466 Ga0501083_0014199 3300049744 Bacteria 5571
467 Ga0501083_0018857 3300049744 Bacteria 4804
468 Ga0501083_0024814 3300049744 Bacteria 4153
469 Ga0501083_0039690 3300049744 Bacteria 3197
470 Ga0501083_0118878 3300049744 Bacteria 1734
471 Ga0501083_0293207 3300049744 Bacteria 1058
472 Ga0501035_0001587 3300049822 Bacteria 23029
473 Ga0501035_0036674 3300049822 Bacteria 4442
474 Ga0501035_0150130 3300049822 Bacteria 2023
475 Ga0501044_0001705 3300049823 Bacteria 25782
476 Ga0501044_0187769 3300049823 Bacteria 2031
477 Ga0501045_0001456 3300049824 Bacteria 15731
478 Ga0501045_0005147 3300049824 Bacteria 9050
479 Ga0501045_0010519 3300049824 Bacteria 6480
480 Ga0501045_0032395 3300049824 Bacteria 3787
481 Ga0501045_0104869 3300049824 Bacteria 2094
482 Ga0501045_0150859 3300049824 Bacteria 1729
483 Ga0501045_0217980 3300049824 Bacteria 1421
484 Ga0501045_0341614 3300049824 Bacteria 1114
485 nmdc:mga00v17_55676_c1 3300050491 Bacteria 2416
486 nmdc:mga0yw44_135182_c1 3300050492 Bacteria 1599
487 nmdc:mga07m45_49082_c1 3300050496 Bacteria 2375
488 nmdc:mga07m45_58453_c1 3300050496 Bacteria 2181
489 nmdc:mga05p37_10570_c1 3300050507 Bacteria 10944
490 nmdc:mga09592_34950_c1 3300050508 Bacteria 4204
491 nmdc:mga09592_69271_c1 3300050508 Bacteria 2992
492 nmdc:mga0qj67_14491_c1 3300050509 Bacteria 5962
493 nmdc:mga06r32_162868_c1 3300050510 Bacteria 2213
494 nmdc:mga06r32_33420_c1 3300050510 Bacteria 4844
495 nmdc:mga08y16_3776_c1 3300050511 Bacteria 15775
496 Ga0495601_0155266 3300053077 Bacteria 1494
497 Ga0495612_0026661 3300053078 Bacteria 2322
498 Ga0500643_000448 3300053087 Bacteria 30598
499 Ga0500644_0090115 3300053088 Bacteria 1146
500 Ga0500568_0002978 3300053139 Bacteria 9694
501 Ga0500573_0004827 3300053140 Bacteria 7143
502 Ga0501084_0003542 3300054114 Bacteria 12676
503 Ga0501084_0039609 3300054114 Bacteria 3941
504 Ga0501084_0042319 3300054114 Bacteria 3810
505 Ga0501084_0044269 3300054114 Bacteria 3726
506 Ga0501084_0123225 3300054114 Bacteria 2180
507 Ga0501084_0129964 3300054114 Bacteria 2120
508 Ga0501084_0283132 3300054114 Bacteria 1400
509 Ga0501084_0284972 3300054114 Bacteria 1395
510 Ga0590071_036201 3300059421 Bacteria 1183
511 Ga0501082_0024968 3300060353 Bacteria 5149
512 Ga0501082_0028196 3300060353 Bacteria 4838
513 Ga0501082_0039167 3300060353 Bacteria 4089
514 Ga0501082_0041500 3300060353 Bacteria 3967
515 Ga0501082_0059703 3300060353 Bacteria 3286
516 Ga0501082_0060483 3300060353 Bacteria 3261
517 Ga0501082_0070229 3300060353 Bacteria 3016
518 Ga0501082_0123360 3300060353 Bacteria 2246
519 Ga0530510_0002142 3300061734 Bacteria 13559
520 Ga0530510_0007584 3300061734 Bacteria 7558
521 Ga0530510_0076394 3300061734 Bacteria 2433
522 Ga0530510_0157491 3300061734 Bacteria 1679
523 2548699239 2547132424 Bacteria 8348532
524 2552111039 2551306166 Bacteria 9731570
525 2566992618 2565956761 Bacteria 6601618
526 2644487181 2643221687 Bacteria 6500351
527 2644514121 2643221692 Bacteria 7282860
528 2731908844 2731639228 Bacteria 4187555
529 2738887623 2738541308 Bacteria 7020677
530 2739202666 2738543005 Bacteria 5278128
531 2739236693 2738543011 Bacteria 5731169
532 2739366581 2738543034 Bacteria 6084756
533 2744957366 2744054611 Bacteria 5611514
534 2889305586 2889300758 Bacteria 5690814
535 2890805533 2890804823 Bacteria 3717572
536 2902794565 2902792274 Bacteria 7270173
537 2902839265 2902837492 Bacteria 6697721
538 2904541520 2904535858 Bacteria 6308016
539 2904767539 2904765812 Bacteria 5369154
540 2904774884 2904770941 Bacteria 5580202
541 2908813182 2908811453 Bacteria 5478616
542 2919424517 2919420072 Bacteria 5390363
543 2919437102 2919432681 Bacteria 5390474
544 2919501277 2919497567 Bacteria 4408621
545 2919717190 2919713450 Bacteria 7431245
546 2922560104 2922554459 Bacteria 6683962
547 2939743721 2939743619 Bacteria 5762299
548 2956940900 2956939328 Bacteria 3474458
549 3001120588 3001119090 Bacteria 3449530
550 3003004167 3002998708 Bacteria 11715108
551 8003316388 8003314358 Bacteria 10575343
552 8015559440 8015556637 Bacteria 3582323
553 Ga0501032_0044162
554 SwRhRL2b_contig_1399640
555 rootH1_10031061
556 rootH1_10058451
557 Ga0055540_1001045
558 Ga0065704_10070148
559 Ga0070683_100056574
560 Ga0070683_100151703
561 Ga0068868_100001090
562 Ga0070660_100102254
563 Ga0070660_100109351
564 Ga0070687_100100843
565 Ga0070675_100115042
566 Ga0070714_100006931
567 Ga0070714_100047828
568 Ga0070713_100017666
569 Ga0070713_100036792
570 Ga0070663_100004398
571 Ga0070663_100257816
572 Ga0070662_100097087
573 Ga0070681_10039603
574 Ga0068867_100009052
575 Ga0070707_100019514
576 Ga0070698_100009265
577 Ga0070679_100114551
578 Ga0070679_100157861
579 Ga0068853_100053822
580 Ga0068855_100000068
581 Ga0068855_100009760
582 Ga0068857_100060323
583 Ga0068857_100292298
584 Ga0068856_100013637
585 Ga0068856_100066419
586 Ga0068852_100084043
587 Ga0068859_100466088
588 Ga0068866_10005985
589 Ga0068861_100092538
590 Ga0068870_10085100
591 Ga0081455_10000845
592 Ga0081455_10010118
593 Ga0081455_10059250
594 Ga0081455_10072083
595 Ga0081538_10009208
596 Ga0081538_10015271
597 Ga0070717_10049018
598 Ga0070717_10058336
599 Ga0075363_100170414
600 Ga0075364_10043549
601 Ga0070712_100095929
602 Ga0075367_10176359
603 Ga0097621_100069700
604 Ga0097621_100080850
605 Ga0075370_10005847
606 Ga0075428_100001171
607 Ga0075430_100062632
608 Ga0075431_100089140
609 Ga0075431_100466589
610 Ga0075429_100013838
611 Ga0075429_100079847
612 Ga0068865_100057090
613 Ga0097620_100078223
614 Ga0097620_100466058
615 Ga0111539_10019124
616 Ga0105245_10000008
617 Ga0105245_10329169
618 Ga0114129_10000201
619 Ga0114129_10017962
620 Ga0105243_10004610
621 Ga0105242_10014127
622 Ga0105238_10123573
623 Ga0105249_10615149
624 Ga0105239_10413835
625 Ga0157369_10026140
626 Ga0157374_10378819
627 Ga0163162_10559173
628 Ga0157375_10230051
629 Ga0163161_10022461
630 Ga0213873_10000032
631 Ga0213876_10054432
632 Ga0213875_10000159
633 Ga0213875_10000439
634 Ga0209051_1001486
635 Ga0209051_1002389
636 Ga0207642_10037562
637 Ga0207647_10011802
638 Ga0207693_10072574
639 Ga0207693_10247918
640 Ga0207662_10014239
641 Ga0207657_10071960
642 Ga0207657_10078744
643 Ga0207657_10138214
644 Ga0207652_10286194
645 Ga0207646_10064228
646 Ga0207646_10107186
647 Ga0207687_10000160
648 Ga0207700_10021606
649 Ga0207700_10053997
650 Ga0207664_10004324
651 Ga0207664_10009026
652 Ga0207664_10097179
653 Ga0207709_10003092
654 Ga0207709_10029450
655 Ga0207670_10036467
656 Ga0207661_10124311
657 Ga0207667_10000057
658 Ga0207667_10009009
659 Ga0207668_10067494
660 Ga0207658_10011951
661 Ga0207639_10242317
662 Ga0207678_10000657
663 Ga0207678_10014088
664 Ga0207702_10050976
665 Ga0207648_10004773
666 Ga0207648_10022103
667 Ga0207674_10154613
668 Ga0207674_10416519
669 Ga0207683_10235966
670 Ga0207698_10184044
671 Ga0268264_10152079
672 Ga0265334_10022549
673 Ga0307515_10204500
674 Ga0307511_10030027
675 Ga0265320_10001604
676 Ga0265327_10000624
677 Ga0265327_10004897
678 Ga0307408_100021381
679 Ga0316575_10030959
680 Ga0265314_10017039
681 Ga0316578_10006618
682 Ga0316578_10012469
683 Ga0316578_10082517
684 Ga0307405_10051888
685 Ga0316577_10008087
686 Ga0316577_10054282
687 Ga0307410_10081713
688 Ga0307406_10000232
689 Ga0307406_10009286
690 Ga0307406_10386966
691 Ga0307407_10155350
692 Ga0307409_100000004
693 Ga0307416_100063971
694 Ga0307414_10037316
695 Ga0307414_10056976
696 Ga0307415_100437156
697 Ga0316585_10020121
698 Ga0316580_10018081
699 Ga0316580_10044077
700 Ga0307507_10013426
701 Ga0373934_0027350
702 Ga0373923_0063200
703 Ga0373936_0048768
704 Ga0373953_0005883
705 Ga0373954_0105410
706 Ga0373956_0053702
707 Ga0373957_0001217
708 Ga0373946_0015132
709 Ga0373955_0037185
710 Ga0316574_0000029
711 Ga0316574_0079943
712 Ga0316574_0283893
713 Ga0373924_0018443
714 Ga0373935_0080312
715 Ga0373927_0180600
716 Ga0373933_0061357
717 Ga0373937_0147519
718 Ga0316582_0017627
719 Ga0316584_0010117
720 Ga0316584_0064111
721 Ga0316584_0123571
722 Ga0373925_0000017
723 Ga0373925_0437789
724 Ga0395899_0337633
725 Ga0395898_0046192
726 Ga0395905_0000582
727 Ga0395905_0099665
728 Ga0395905_0154688
729 Ga0316581_0019894
730 Ga0436364_0154596
731 Ga0436364_0629970
732 Ga0436364_0789043
733 Ga0395901_0333444
734 Ga0400484_05243
735 Ga0400490_11918
736 Ga0400490_31998
737 Ga0400485_03085
738 Ga0400483_048213
739 Ga0400483_114555
740 Ga0400483_200780
741 Ga0436365_1346750
742 Ga0436360_0542964
743 Ga0436362_0405432
744 Ga0436362_0977183
745 Ga0451791_1038276
746 Ga0451797_0270985
747 Ga0451807_0452327
748 Ga0451837_0057995
749 Ga0439444_0013803
750 Ga0439444_0020938
751 Ga0439464_0002489
752 Ga0439460_0001732
753 Ga0451577_0379501
754 Ga0466969_0017291
755 Ga0466966_0002361
756 Ga0466966_0017833
757 Ga0466966_0188633
758 Ga0466961_0007428
759 Ga0466963_0030940
760 Ga0466963_0064034
761 Ga0466963_0278919
762 Ga0453684_0139083
763 Ga0466970_0015474
764 Ga0466970_0050078
765 Ga0466970_0281077
766 Ga0466959_0001446
767 Ga0466959_0143275
768 Ga0466958_0111456
769 Ga0466967_0016850
770 Ga0466967_0017808
771 Ga0466967_0021428
772 Ga0466967_0194993
773 Ga0466967_0231237
774 Ga0466967_0259983
775 Ga0466967_0413281
776 Ga0495592_0026105
777 Ga0495651_0077846
778 Ga0495653_0070858
779 Ga0495580_0277769
780 Ga0495662_0095536
781 Ga0495664_0046273
782 Ga0495594_0025489
783 Ga0495607_0039025
784 Ga0495608_0050356
785 Ga0495628_0220493
786 Ga0495630_0071256
787 Ga0495652_0218792
788 Ga0495665_0003197
789 Ga0495665_0214457
790 Ga0495640_0232313
791 Ga0495586_0053296
792 Ga0495587_0033147
793 Ga0495645_0061689
794 Ga0495667_0021069
795 Ga0495656_0007033
796 Ga0495668_0023838
797 Ga0495635_0056829
798 Ga0495659_0000676
799 Ga0495659_0045036
800 Ga0495588_0040181
801 Ga0495588_0182724
802 Ga0495657_0055247
803 Ga0495623_0037567
804 Ga0495646_0039402
805 Ga0495600_0051462
806 Ga0495581_0042418
807 Ga0495581_0144931
808 Ga0495604_0156078
809 Ga0495636_0027176
810 Ga0495636_0075261
811 Ga0495674_0033095
812 Ga0495680_0048728
813 Ga0495680_0053466
814 Ga0495683_0000314
815 Ga0495675_0130587
816 Ga0495684_0058448
817 Ga0495602_0030905
818 Ga0496100_0143547
819 Ga0496100_0209518
820 Ga0496101_0002474
821 Ga0496102_0065053
822 Ga0496103_0033304
823 Ga0496103_0083971
824 Ga0496104_0007142
825 Ga0496105_0174336
826 Ga0496107_0064795
827 Ga0496108_0007593
828 Ga0496108_0215557
829 Ga0496108_0233990
830 Ga0496109_0043012
831 Ga0496109_0153828
832 Ga0496109_0192947
833 Ga0496110_0001157
834 Ga0496110_0155480
835 Ga0496111_0024566
836 Ga0496111_0085450
837 Ga0496111_0180196
838 Ga0496112_0019039
839 Ga0496113_0024122
840 Ga0496113_0047356
841 Ga0496114_0007960
842 Ga0496114_0013168
843 Ga0496124_0000001
844 Ga0496125_0034110
845 Ga0496126_0020708
846 Ga0496126_0041611
847 Ga0496126_0058023
848 Ga0496126_0210586
849 Ga0496126_0454127
850 Ga0501290_009205
851 Ga0501031_0003257
852 Ga0501031_0080037
853 Ga0501031_0087058
854 Ga0501031_0237326
855 Ga0501032_0059834
856 Ga0501032_0092057
857 Ga0501033_0003522
858 Ga0501033_0019923
859 Ga0501033_0037701
860 Ga0501033_0049918
861 Ga0501033_0332777
862 Ga0501034_0000603
863 Ga0501034_0016148
864 Ga0501034_0229948
865 Ga0501036_0002741
866 Ga0501036_0003902
867 Ga0501036_0004284
868 Ga0501036_0005713
869 Ga0501036_0083282
870 Ga0501036_0158655
871 Ga0501036_0201404
872 Ga0501036_0351562
873 Ga0501036_0380413
874 Ga0501037_0016489
875 Ga0501037_0033133
876 Ga0501037_0249649
877 Ga0501038_0015008
878 Ga0501038_0015040
879 Ga0501038_0088973
880 Ga0501038_0117281
881 Ga0501038_0125137
882 Ga0501038_0175722
883 Ga0501038_0262883
884 Ga0501039_0011554
885 Ga0501039_0014689
886 Ga0501040_0003589
887 Ga0501040_0004335
888 Ga0501040_0018569
889 Ga0501040_0020769
890 Ga0501040_0030256
891 Ga0501040_0337130
892 Ga0501041_0003679
893 Ga0501041_0005714
894 Ga0501041_0008793
895 Ga0501041_0016278
896 Ga0501041_0279127
897 Ga0501042_0003210
898 Ga0501042_0003639
899 Ga0501042_0065729
900 Ga0501042_0218822
901 Ga0501043_0021957
902 Ga0501046_0003088
903 Ga0501046_0003109
904 Ga0501046_0003609
905 Ga0501046_0023561
906 Ga0501046_0026146
907 Ga0501046_0107948
908 Ga0501046_0189699
909 Ga0501047_0008756
910 Ga0501047_0083260
911 Ga0501048_0014556
912 Ga0501048_0015388
913 Ga0501048_0016677
914 Ga0501048_0023492
915 Ga0501048_0177687
916 Ga0501048_0181282
917 Ga0501048_0304667
918 Ga0501067_0015098
919 Ga0501068_0007111
920 Ga0501068_0008366
921 Ga0501068_0036624
922 Ga0501068_0038486
923 Ga0501068_0051773
924 Ga0501068_0097400
925 Ga0501069_0004472
926 Ga0501069_0006486
927 Ga0501069_0172152
928 Ga0501070_0001187
929 Ga0501070_0001192
930 Ga0501070_0018867
931 Ga0501070_0088824
932 Ga0501070_0138915
933 Ga0501071_0000924
934 Ga0501071_0011394
935 Ga0501071_0017554
936 Ga0501071_0020964
937 Ga0501071_0060945
938 Ga0501071_0225871
939 Ga0501071_0263215
940 Ga0501071_0473331
941 Ga0501072_0001169
942 Ga0501072_0001251
943 Ga0501072_0001632
944 Ga0501072_0020541
945 Ga0501072_0026908
946 Ga0501072_0057895
947 Ga0501072_0070400
948 Ga0501072_0120624
949 Ga0501072_0279047
950 Ga0501072_0434137
951 Ga0501073_0009076
952 Ga0501073_0025588
953 Ga0501073_0089471
954 Ga0501074_0003220
955 Ga0501074_0011001
956 Ga0501074_0024048
957 Ga0501074_0027220
958 Ga0501074_0034944
959 Ga0501074_0071223
960 Ga0501074_0085989
961 Ga0501074_0188873
962 Ga0501075_0020165
963 Ga0501075_0033444
964 Ga0501075_0049335
965 Ga0501075_0053657
966 Ga0501075_0101010
967 Ga0501075_0267191
968 Ga0501075_0339954
969 Ga0501076_0001029
970 Ga0501076_0001272
971 Ga0501076_0002611
972 Ga0501076_0003635
973 Ga0501076_0014991
974 Ga0501076_0015779
975 Ga0501076_0023931
976 Ga0501076_0045917
977 Ga0501076_0165521
978 Ga0501076_0485330
979 Ga0501077_0007753
980 Ga0501077_0038881
981 Ga0501077_0043751
982 Ga0501077_0046257
983 Ga0501077_0082324
984 Ga0501077_0140830
985 Ga0501209_049200
986 Ga0501079_0003247
987 Ga0501079_0003462
988 Ga0501079_0011798
989 Ga0501079_0031531
990 Ga0501079_0046803
991 Ga0501079_0049768
992 Ga0501079_0067496
993 Ga0501079_0074871
994 Ga0501079_0126008
995 Ga0501079_0180703
996 Ga0501080_0011792
997 Ga0501080_0021174
998 Ga0501080_0056178
999 Ga0501080_0063083
1000 Ga0501080_0075963
1001 Ga0501080_0131232
1002 Ga0501080_0151680
1003 Ga0501080_0275923
1004 Ga0501080_0362099
1005 Ga0501080_0515245
1006 Ga0501081_0000904
1007 Ga0501081_0001734
1008 Ga0501081_0010282
1009 Ga0501081_0010409
1010 Ga0501081_0021199
1011 Ga0501081_0049169
1012 Ga0501081_0052714
1013 Ga0501081_0159564
1014 Ga0501081_0172477
1015 Ga0501081_0184144
1016 Ga0501083_0004878
1017 Ga0501083_0012035
1018 Ga0501083_0014199
1019 Ga0501083_0018857
1020 Ga0501083_0024814
1021 Ga0501083_0039690
1022 Ga0501083_0118878
1023 Ga0501083_0293207
1024 Ga0501035_0001587
1025 Ga0501035_0036674
1026 Ga0501035_0150130
1027 Ga0501044_0001705
1028 Ga0501044_0187769
1029 Ga0501045_0001456
1030 Ga0501045_0005147
1031 Ga0501045_0010519
1032 Ga0501045_0032395
1033 Ga0501045_0104869
1034 Ga0501045_0150859
1035 Ga0501045_0217980
1036 Ga0501045_0341614
1037 nmdc:mga00v17_55676_c1
1038 nmdc:mga0yw44_135182_c1
1039 nmdc:mga07m45_49082_c1
1040 nmdc:mga07m45_58453_c1
1041 nmdc:mga05p37_10570_c1
1042 nmdc:mga09592_34950_c1
1043 nmdc:mga09592_69271_c1
1044 nmdc:mga0qj67_14491_c1
1045 nmdc:mga06r32_162868_c1
1046 nmdc:mga06r32_33420_c1
1047 nmdc:mga08y16_3776_c1
1048 Ga0495601_0155266
1049 Ga0495612_0026661
1050 Ga0500643_000448
1051 Ga0500644_0090115
1052 Ga0500568_0002978
1053 Ga0500573_0004827
1054 Ga0501084_0003542
1055 Ga0501084_0039609
1056 Ga0501084_0042319
1057 Ga0501084_0044269
1058 Ga0501084_0123225
1059 Ga0501084_0129964
1060 Ga0501084_0283132
1061 Ga0501084_0284972
1062 Ga0590071_036201
1063 Ga0501082_0024968
1064 Ga0501082_0028196
1065 Ga0501082_0039167
1066 Ga0501082_0041500
1067 Ga0501082_0059703
1068 Ga0501082_0060483
1069 Ga0501082_0070229
1070 Ga0501082_0123360
1071 Ga0530510_0002142
1072 Ga0530510_0007584
1073 Ga0530510_0076394
1074 Ga0530510_0157491
1075 2548699239
1076 2552111039
1077 2566992618
1078 2644487181
1079 2644514121
1080 2731908844
1081 2738887623
1082 2739202666
1083 2739236693
1084 2739366581
1085 2744957366
1086 2889305586
1087 2890805533
1088 2902794565
1089 2902839265
1090 2904541520
1091 2904767539
1092 2904774884
1093 2908813182
1094 2919424517
1095 2919437102
1096 2919501277
1097 2919717190
1098 2922560104
1099 2939743721
1100 2956940900
1101 3001120588
1102 3003004167
1103 8003316388
1104 8015559440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

16

267

0.94

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

20

266

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rjm-assembly1.cif.gz_B crystal structure of menb (rv0548c) from mycobacterium tuberculosis 0.9731 21 285
1rjm-assembly1.cif.gz_C-2 crystal structure of menb (rv0548c) from mycobacterium tuberculosis 0.9683 21 284
3t8a-assembly1.cif.gz_C-2 crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa 0.9681 21 291
3t8b-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly 0.9679 21 255
1rjn-assembly1.cif.gz_C-2 the crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa 0.9665 21 285
ID Description Score Start End Superfamily
3t8aA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9514 254 295 1.10.12.10
1q52B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9488 23 252 3.90.226.10
1q52B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9445 23 252 3.90.226.10
1rjnA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9424 254 296 1.10.12.10
af_Q2FZL5_3_210_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.94 27 251 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A523EWN3-F1-model_v4 deleted 0.9669 17 123
AF-A0A523EWN3-F1-model_v4 deleted 0.9581 17 123
AF-A0A829UAQ6-F1-model_v4 deleted 0.9496 27 281
AF-A0A5C7AE90-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36) 0.9412 27 315 GO:0008935
GO:0009234
AF-A0A3M1VGY0-F1-model_v4 deleted 0.9404 27 315

Map