F462731

General Info

Members Datasets Scaffolds Average Seq Length
552 300 518 227

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10050798|Ga0213876_100507982
Length 247
Sequence MGGGLPRTQAGGKGREVQVVSDAEAQKRAAGEAAAGLIESGMVVGLGTGSTAAWFVKALAARKLDVTCVCTSEATAKLGSELGLRLAELGETREIDVTVDGADEIGPGLSLIKGGGAALLREKLVWEASRRCVVIADAAKVVPALGKFALPIEVVAFGHKTTALRICDALAECDIGIAPRLRMKDGQPVRTDGGNLIYDAACGRIAEPALLAAALKSVTGVVDHGLFLDLAEQALIGAPEGVQVLEP

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
12 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
13 2643221640 Caulobacter sp. Root342 Isolate Unclassified
14 2643221642 Caulobacter sp. Root343 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
17 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
24 2849560528 Caulobacter zeae 410 Isolate Unclassified
25 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
28 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
32 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
33 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
266 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
267 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
276 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
293 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
299 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
300 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0.18
Isolates 6.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.64
Nodule 0
Rhizoplane 3.44
Rhizosphere 64.13
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10038344 3300003215 Bacteria 1511
2 JGI25153J46596_10082874 3300003215 Bacteria 794
3 rootH2_10176393 3300003320 Bacteria 1214
4 Ga0006562J51391_1114709 3300003578 Bacteria 3030
5 Ga0055537_1001619 3300003773 Bacteria 8458
6 Ga0055524_1007881 3300003775 Bacteria 4477
7 Ga0055536_1000393 3300003781 Bacteria 31775
8 Ga0055536_1001223 3300003781 Bacteria 15907
9 Ga0055536_1001420 3300003781 Bacteria 14456
10 Ga0055536_1004944 3300003781 Bacteria 6638
11 Ga0055528_1006482 3300003790 Bacteria 5306
12 Ga0055530_10000188 3300003791 Bacteria 55307
13 Ga0055530_10003290 3300003791 Bacteria 9373
14 Ga0055530_10005883 3300003791 Bacteria 5667
15 Ga0055531_10001067 3300003794 Bacteria 21546
16 Ga0055531_10001676 3300003794 Bacteria 15946
17 Ga0055531_10001776 3300003794 Bacteria 15322
18 Ga0055531_10003003 3300003794 Bacteria 10952
19 Ga0055531_10040142 3300003794 Bacteria 1377
20 Ga0055543_1011440 3300004625 Bacteria 1816
21 Ga0065165_1000029 3300005262 Bacteria 220342
22 Ga0065165_1001558 3300005262 Bacteria 23817
23 Ga0065165_1011977 3300005262 Bacteria 3564
24 Ga0070658_10147533 3300005327 Bacteria 1968
25 Ga0070658_10449251 3300005327 Bacteria 1110
26 Ga0070670_100000050 3300005331 Bacteria 132470
27 Ga0070670_100043998 3300005331 Bacteria 3839
28 Ga0070670_100049662 3300005331 Bacteria 3607
29 Ga0070680_100021729 3300005336 Bacteria 5103
30 Ga0070680_100032004 3300005336 Bacteria 4231
31 Ga0070680_100036438 3300005336 Bacteria 3974
32 Ga0070680_100440860 3300005336 Bacteria 1112
33 Ga0070660_100203419 3300005339 Bacteria 1606
34 Ga0070660_100360374 3300005339 Bacteria 1198
35 Ga0070668_100000170 3300005347 Bacteria 41682
36 Ga0070668_100004210 3300005347 Bacteria 10670
37 Ga0070668_100005892 3300005347 Bacteria 9086
38 Ga0070668_100020499 3300005347 Bacteria 4990
39 Ga0070668_100039071 3300005347 Bacteria 3630
40 Ga0070669_100005143 3300005353 Bacteria 9457
41 Ga0070671_100004825 3300005355 Bacteria 10721
42 Ga0070671_100098164 3300005355 Bacteria 2457
43 Ga0070659_100003569 3300005366 Bacteria 11075
44 Ga0070659_100009258 3300005366 Bacteria 7229
45 Ga0070659_100063709 3300005366 Bacteria 2917
46 Ga0070667_100000140 3300005367 Bacteria 91817
47 Ga0070667_100010714 3300005367 Bacteria 7577
48 Ga0070667_100030544 3300005367 Bacteria 4494
49 Ga0070663_100307516 3300005455 Bacteria 1271
50 Ga0070678_100056052 3300005456 Bacteria 2880
51 Ga0070681_10006946 3300005458 Bacteria 11020
52 Ga0070681_10045247 3300005458 Bacteria 4403
53 Ga0070679_100011303 3300005530 Bacteria 8512
54 Ga0068853_100256163 3300005539 Bacteria 1607
55 Ga0070672_100520033 3300005543 Bacteria 1031
56 Ga0070665_100000248 3300005548 Bacteria 89239
57 Ga0070665_100000819 3300005548 Bacteria 40675
58 Ga0070665_100000923 3300005548 Bacteria 37614
59 Ga0070665_100054835 3300005548 Bacteria 3997
60 Ga0070665_100097260 3300005548 Bacteria 2949
61 Ga0070665_100165319 3300005548 Bacteria 2215
62 Ga0068855_100047390 3300005563 Bacteria 5077
63 Ga0068855_100096697 3300005563 Bacteria 3402
64 Ga0068855_100175085 3300005563 Bacteria 2428
65 Ga0070664_100064963 3300005564 Bacteria 3113
66 Ga0070664_100357910 3300005564 Bacteria 1329
67 Ga0068857_100150090 3300005577 Bacteria 2111
68 Ga0068856_100282780 3300005614 Bacteria 1676
69 Ga0068852_100508533 3300005616 Bacteria 1200
70 Ga0068852_100920134 3300005616 Bacteria 892
71 Ga0068859_100000177 3300005617 Bacteria 62179
72 Ga0068859_100059275 3300005617 Bacteria 3856
73 Ga0068859_100227594 3300005617 Bacteria 1953
74 Ga0068864_100000275 3300005618 Bacteria 45877
75 Ga0068864_100000525 3300005618 Bacteria 33067
76 Ga0068861_100563982 3300005719 Bacteria 1040
77 Ga0068863_100000292 3300005841 Bacteria 51956
78 Ga0068863_100000338 3300005841 Bacteria 47691
79 Ga0068863_100005365 3300005841 Bacteria 12642
80 Ga0068863_100027386 3300005841 Bacteria 5436
81 Ga0068863_100263361 3300005841 Bacteria 1667
82 Ga0068863_100388149 3300005841 Bacteria 1364
83 Ga0068863_100444512 3300005841 Bacteria 1272
84 Ga0068863_100509829 3300005841 Bacteria 1185
85 Ga0068858_100000098 3300005842 Bacteria 90747
86 Ga0068858_100004751 3300005842 Bacteria 13300
87 Ga0068858_100012403 3300005842 Bacteria 8036
88 Ga0068858_100403959 3300005842 Bacteria 1313
89 Ga0068860_100000517 3300005843 Bacteria 47364
90 Ga0068860_100000845 3300005843 Bacteria 34265
91 Ga0068862_100001028 3300005844 Bacteria 26829
92 Ga0068862_100015158 3300005844 Bacteria 6401
93 Ga0068862_100453379 3300005844 Bacteria 1210
94 Ga0070717_10242158 3300006028 Bacteria 1591
95 Ga0075365_10153477 3300006038 Bacteria 1602
96 Ga0075368_10000345 3300006042 Bacteria 13585
97 Ga0075363_100035980 3300006048 Bacteria 2595
98 Ga0075364_10010709 3300006051 Bacteria 5546
99 Ga0075367_10021501 3300006178 Bacteria 3606
100 Ga0075369_10037275 3300006186 Bacteria 2071
101 Ga0075366_10031817 3300006195 Bacteria 3105
102 Ga0075366_10249392 3300006195 Bacteria 1083
103 Ga0075370_10046517 3300006353 Bacteria 2455
104 Ga0075370_10164372 3300006353 Bacteria 1303
105 Ga0075370_10301561 3300006353 Bacteria 953
106 Ga0075430_100628433 3300006846 Bacteria 886
107 Ga0068865_100026275 3300006881 Bacteria 3837
108 Ga0097620_100000177 3300006931 Bacteria 62179
109 Ga0097620_100059277 3300006931 Bacteria 3856
110 Ga0097620_100227605 3300006931 Bacteria 1953
111 Ga0105250_10004695 3300009092 Bacteria 6240
112 Ga0105240_10000522 3300009093 Bacteria 70833
113 Ga0105240_10043875 3300009093 Bacteria 5686
114 Ga0105240_10354135 3300009093 Bacteria 1665
115 Ga0105240_10558891 3300009093 Bacteria 1265
116 Ga0105247_10031265 3300009101 Bacteria 3230
117 Ga0105241_10383958 3300009174 Bacteria 1228
118 Ga0105248_10002192 3300009177 Bacteria 21611
119 Ga0105248_10006463 3300009177 Bacteria 12858
120 Ga0105248_10124886 3300009177 Bacteria 2903
121 Ga0105248_10735334 3300009177 Bacteria 1113
122 Ga0105248_11426459 3300009177 Bacteria 784
123 Ga0105238_10762194 3300009551 Bacteria 982
124 Ga0105249_10012701 3300009553 Bacteria 7423
125 Ga0105239_11074519 3300010375 Bacteria 926
126 Ga0157373_10000586 3300013100 Bacteria 28347
127 Ga0157373_10003492 3300013100 Bacteria 11888
128 Ga0157370_10051382 3300013104 Bacteria 3937
129 Ga0157370_10198200 3300013104 Bacteria 1863
130 Ga0157369_10012338 3300013105 Bacteria 9702
131 Ga0157374_10123650 3300013296 Bacteria 2499
132 Ga0163162_10050997 3300013306 Bacteria 4151
133 Ga0163162_10058980 3300013306 Bacteria 3868
134 Ga0157372_10350664 3300013307 Bacteria 1719
135 Ga0157375_10077717 3300013308 Bacteria 3350
136 Ga0157375_10442141 3300013308 Bacteria 1466
137 Ga0163163_10003088 3300014325 Bacteria 14114
138 Ga0163163_10004095 3300014325 Bacteria 12440
139 Ga0163163_10157442 3300014325 Bacteria 2316
140 Ga0163163_10329031 3300014325 Bacteria 1582
141 Ga0163163_10447716 3300014325 Bacteria 1351
142 Ga0163163_10615263 3300014325 Bacteria 1149
143 Ga0157379_10000956 3300014968 Bacteria 23412
144 Ga0157379_10007852 3300014968 Bacteria 9242
145 Ga0157379_10192841 3300014968 Bacteria 1841
146 Ga0213872_10043179 3300021361 Bacteria 2055
147 Ga0213876_10050798 3300021384 Bacteria 2191
148 Ga0213876_10248628 3300021384 Bacteria 945
149 Ga0213875_10199564 3300021388 Bacteria 941
150 Ga0213871_10026137 3300021441 Bacteria 1491
151 Ga0209565_1000301 3300025263 Bacteria 46572
152 Ga0209673_1000652 3300025273 Bacteria 51310
153 Ga0209675_1009228 3300025291 Bacteria 3503
154 Ga0209676_1000291 3300025292 Bacteria 102996
155 Ga0209676_1000374 3300025292 Bacteria 82896
156 Ga0209676_1000733 3300025292 Bacteria 44859
157 Ga0209676_1001881 3300025292 Bacteria 17151
158 Ga0209564_1001598 3300025295 Bacteria 22095
159 Ga0209564_1029748 3300025295 Bacteria 1710
160 Ga0209758_1000649 3300025297 Bacteria 52785
161 Ga0209758_1001229 3300025297 Bacteria 32063
162 Ga0209758_1004447 3300025297 Bacteria 11656
163 Ga0209050_1000031 3300025298 Bacteria 458181
164 Ga0209050_1000327 3300025298 Bacteria 95283
165 Ga0209050_1000443 3300025298 Bacteria 75067
166 Ga0209050_1002696 3300025298 Bacteria 14433
167 Ga0209050_1008436 3300025298 Bacteria 5509
168 Ga0209256_1000592 3300025299 Bacteria 50393
169 Ga0209256_1002655 3300025299 Bacteria 14053
170 Ga0209256_1013992 3300025299 Bacteria 2928
171 Ga0209051_1002121 3300025303 Bacteria 14804
172 Ga0209257_1000066 3300025304 Bacteria 344166
173 Ga0209257_1000073 3300025304 Bacteria 325833
174 Ga0209257_1000345 3300025304 Bacteria 96513
175 Ga0209257_1000561 3300025304 Bacteria 63214
176 Ga0209257_1001589 3300025304 Bacteria 26085
177 Ga0209257_1009199 3300025304 Bacteria 5365
178 Ga0207696_1011837 3300025711 Bacteria 3119
179 Ga0207680_10045867 3300025903 Bacteria 2580
180 Ga0207705_10010270 3300025909 Bacteria 6814
181 Ga0207705_10183064 3300025909 Bacteria 1582
182 Ga0207707_10041365 3300025912 Bacteria 4025
183 Ga0207707_10058107 3300025912 Bacteria 3366
184 Ga0207695_10001134 3300025913 Bacteria 46205
185 Ga0207695_10048841 3300025913 Bacteria 4465
186 Ga0207695_10481795 3300025913 Bacteria 1123
187 Ga0207660_10003586 3300025917 Bacteria 10108
188 Ga0207660_10009948 3300025917 Bacteria 6161
189 Ga0207657_10008921 3300025919 Bacteria 10132
190 Ga0207657_10075310 3300025919 Bacteria 2848
191 Ga0207657_10304438 3300025919 Bacteria 1262
192 Ga0207652_10348199 3300025921 Bacteria 1337
193 Ga0207681_10002898 3300025923 Bacteria 10844
194 Ga0207694_10063437 3300025924 Bacteria 2878
195 Ga0207694_10165627 3300025924 Bacteria 1787
196 Ga0207650_10000133 3300025925 Bacteria 90953
197 Ga0207650_10037797 3300025925 Bacteria 3520
198 Ga0207650_10601060 3300025925 Bacteria 925
199 Ga0207644_10002470 3300025931 Bacteria 11922
200 Ga0207644_10011959 3300025931 Bacteria 5755
201 Ga0207690_10007078 3300025932 Bacteria 6661
202 Ga0207690_10276783 3300025932 Bacteria 1306
203 Ga0207690_10315563 3300025932 Bacteria 1227
204 Ga0207690_10505144 3300025932 Bacteria 978
205 Ga0207706_10056021 3300025933 Bacteria 3476
206 Ga0207704_10149231 3300025938 Bacteria 1647
207 Ga0207691_10784218 3300025940 Bacteria 801
208 Ga0207711_10003297 3300025941 Bacteria 14029
209 Ga0207711_10105562 3300025941 Bacteria 2498
210 Ga0207711_10221490 3300025941 Bacteria 1731
211 Ga0207689_10122428 3300025942 Bacteria 2139
212 Ga0207679_10026804 3300025945 Bacteria 3978
213 Ga0207679_10478659 3300025945 Bacteria 1108
214 Ga0207667_10014517 3300025949 Bacteria 8976
215 Ga0207651_10185686 3300025960 Bacteria 1654
216 Ga0207712_10002966 3300025961 Bacteria 10834
217 Ga0207668_10000078 3300025972 Bacteria 73213
218 Ga0207668_10000275 3300025972 Bacteria 34283
219 Ga0207668_10007208 3300025972 Bacteria 6605
220 Ga0207668_10009969 3300025972 Bacteria 5717
221 Ga0207668_10035940 3300025972 Bacteria 3304
222 Ga0207658_10012809 3300025986 Bacteria 5727
223 Ga0207658_10021635 3300025986 Bacteria 4467
224 Ga0207658_10115485 3300025986 Bacteria 2130
225 Ga0207677_10384939 3300026023 Bacteria 1185
226 Ga0207703_10000086 3300026035 Bacteria 107307
227 Ga0207703_10003261 3300026035 Bacteria 13626
228 Ga0207703_10037811 3300026035 Bacteria 3847
229 Ga0207639_10005477 3300026041 Bacteria 8580
230 Ga0207639_10268695 3300026041 Bacteria 1495
231 Ga0207678_10110423 3300026067 Bacteria 2346
232 Ga0207702_10597460 3300026078 Bacteria 1082
233 Ga0207641_10000395 3300026088 Bacteria 51273
234 Ga0207641_10004884 3300026088 Bacteria 11534
235 Ga0207641_10313742 3300026088 Bacteria 1485
236 Ga0207648_10346810 3300026089 Bacteria 1338
237 Ga0207676_10000427 3300026095 Bacteria 35513
238 Ga0207676_10005547 3300026095 Bacteria 8928
239 Ga0207676_10023190 3300026095 Bacteria 4574
240 Ga0207675_100728846 3300026118 Bacteria 1002
241 Ga0207683_10196611 3300026121 Bacteria 1832
242 Ga0207698_10039185 3300026142 Bacteria 3508
243 Ga0209981_1001438 3300027378 Bacteria 3008
244 Ga0268266_10000005 3300028379 Bacteria 1448194
245 Ga0268266_10001334 3300028379 Bacteria 29886
246 Ga0268266_10006847 3300028379 Bacteria 10381
247 Ga0268266_10038391 3300028379 Bacteria 4077
248 Ga0268266_10274006 3300028379 Bacteria 1567
249 Ga0268266_10576109 3300028379 Bacteria 1080
250 Ga0268266_10723905 3300028379 Bacteria 960
251 Ga0268265_10004940 3300028380 Bacteria 9166
252 Ga0268265_10010592 3300028380 Bacteria 6228
253 Ga0268265_10014479 3300028380 Bacteria 5374
254 Ga0268265_10238416 3300028380 Bacteria 1603
255 Ga0268264_10000358 3300028381 Bacteria 68359
256 Ga0268264_10000416 3300028381 Bacteria 60203
257 Ga0268264_10021618 3300028381 Bacteria 5253
258 Ga0265337_1022192 3300028556 Bacteria 1969
259 Ga0265326_10030900 3300028558 Bacteria 1526
260 Ga0307517_10023152 3300028786 Bacteria 7740
261 Ga0307517_10088236 3300028786 Bacteria 2566
262 Ga0307515_10035291 3300028794 Bacteria 8142
263 Ga0307515_10126219 3300028794 Bacteria 2856
264 Ga0265338_10005675 3300028800 Bacteria 16162
265 Ga0265338_10017428 3300028800 Bacteria 7741
266 Ga0265338_10064540 3300028800 Bacteria 3183
267 Ga0265338_10067268 3300028800 Bacteria 3095
268 Ga0265338_10297058 3300028800 Bacteria 1175
269 Ga0265327_10001847 3300031251 Bacteria 24570
270 Ga0265327_10004087 3300031251 Bacteria 13190
271 Ga0307513_10003664 3300031456 Bacteria 20786
272 Ga0307408_100473802 3300031548 Bacteria 1091
273 Ga0265314_10049039 3300031711 Bacteria 2959
274 Ga0265314_10253815 3300031711 Bacteria 1008
275 Ga0307516_10000004 3300031730 Bacteria 367451
276 Ga0307410_10026250 3300031852 Bacteria 3665
277 Ga0307407_10023954 3300031903 Bacteria 3193
278 Ga0307409_100049120 3300031995 Bacteria 3215
279 Ga0307414_10052527 3300032004 Bacteria 2836
280 Ga0307414_10162878 3300032004 Bacteria 1774
281 Ga0307414_10180916 3300032004 Bacteria 1695
282 Ga0307414_10451599 3300032004 Bacteria 1127
283 Ga0307414_10467920 3300032004 Bacteria 1109
284 Ga0307411_10011119 3300032005 Bacteria 4839
285 Ga0307411_10186121 3300032005 Bacteria 1581
286 Ga0307411_10657833 3300032005 Bacteria 908
287 Ga0307510_10087367 3300033180 Bacteria 2984
288 Ga0307510_10115817 3300033180 Bacteria 2403
289 Ga0373944_0019001 3300035089 Bacteria 1968
290 Ga0373936_0011961 3300035113 Bacteria 3294
291 Ga0373946_0025080 3300035171 Bacteria 2343
292 Ga0373927_0001122 3300035695 Bacteria 20326
293 Ga0373937_0513369 3300036401 Bacteria 1139
294 Ga0373925_0000136 3300037068 Bacteria 77912
295 Ga0395899_0000026 3300037312 Bacteria 345291
296 Ga0395899_0002138 3300037312 Bacteria 16246
297 Ga0395899_0062081 3300037312 Bacteria 2751
298 Ga0395900_0000010 3300037418 Bacteria 461364
299 Ga0395900_0036567 3300037418 Bacteria 5062
300 Ga0395900_0492882 3300037418 Bacteria 1176
301 Ga0395898_0122545 3300037466 Bacteria 2491
302 Ga0395898_0226406 3300037466 Bacteria 1783
303 Ga0395898_0324079 3300037466 Bacteria 1469
304 Ga0395898_0415000 3300037466 Bacteria 1283
305 Ga0395898_0499040 3300037466 Bacteria 1157
306 Ga0395905_0014167 3300037471 Bacteria 7620
307 Ga0395905_0019940 3300037471 Bacteria 6354
308 Ga0395905_0290068 3300037471 Bacteria 1523
309 Ga0395905_0365885 3300037471 Bacteria 1335
310 Ga0395905_0372209 3300037471 Bacteria 1322
311 Ga0395901_0000007 3300038443 Bacteria 497408
312 Ga0395901_0357164 3300038443 Bacteria 1507
313 Ga0395901_0473384 3300038443 Bacteria 1278
314 Ga0395901_0646322 3300038443 Bacteria 1061
315 Ga0436365_0109316 3300039437 Bacteria 1438
316 Ga0436365_0744982 3300039437 Bacteria 2712
317 Ga0436365_1656308 3300039437 Bacteria 5255
318 Ga0436360_0922575 3300039438 Bacteria 5078
319 Ga0436361_1157906 3300039447 Bacteria 2183
320 Ga0451807_2225897 3300041486 Bacteria 1258
321 Ga0439446_0009145 3300042156 Bacteria 2645
322 Ga0450901_003049 3300042533 Bacteria 1761
323 Ga0466964_0019477 3300044706 Bacteria 2608
324 Ga0466970_0478125 3300044765 Bacteria 716
325 Ga0466959_0172529 3300045049 Bacteria 1516
326 Ga0466967_0056506 3300045976 Bacteria 3461
327 Ga0495627_000770 3300046453 Bacteria 23823
328 Ga0495590_0000246 3300046457 Bacteria 29491
329 Ga0495638_0000326 3300046460 Bacteria 60360
330 Ga0495638_0000434 3300046460 Bacteria 50529
331 Ga0495638_0000628 3300046460 Bacteria 39008
332 Ga0495638_0011814 3300046460 Bacteria 6010
333 Ga0495650_0000244 3300046471 Bacteria 107511
334 Ga0495583_0000001 3300046506 Bacteria 811973
335 Ga0495583_0037772 3300046506 Bacteria 2287
336 Ga0495606_0004354 3300046507 Bacteria 14202
337 Ga0495606_0161099 3300046507 Bacteria 1309
338 Ga0495606_0217346 3300046507 Bacteria 1079
339 Ga0495610_0000118 3300046512 Bacteria 90318
340 Ga0495610_0003104 3300046512 Bacteria 13234
341 Ga0495610_0006617 3300046512 Bacteria 7918
342 Ga0495616_0000115 3300046513 Bacteria 70371
343 Ga0495616_0092970 3300046513 Bacteria 1425
344 Ga0495620_0085630 3300046515 Bacteria 1270
345 Ga0495628_0575836 3300046516 Bacteria 806
346 Ga0495631_0003231 3300046518 Bacteria 8967
347 Ga0495632_0000380 3300046519 Bacteria 42320
348 Ga0495632_0028480 3300046519 Bacteria 2915
349 Ga0495632_0121597 3300046519 Bacteria 1220
350 Ga0495637_0007838 3300046520 Bacteria 5270
351 Ga0495637_0038891 3300046520 Bacteria 2057
352 Ga0495643_0133274 3300046522 Bacteria 1245
353 Ga0495648_0000389 3300046524 Bacteria 48263
354 Ga0495648_0049249 3300046524 Bacteria 2585
355 Ga0495648_0237867 3300046524 Bacteria 887
356 Ga0495663_0044819 3300046525 Bacteria 1355
357 Ga0495642_0074275 3300046528 Bacteria 1425
358 Ga0495654_0000024 3300046530 Bacteria 238195
359 Ga0495654_0098141 3300046530 Bacteria 1352
360 Ga0495609_0029841 3300046538 Bacteria 2482
361 Ga0495609_0094172 3300046538 Bacteria 1301
362 Ga0495597_0004527 3300046542 Bacteria 7604
363 Ga0495597_0070376 3300046542 Bacteria 1508
364 Ga0495622_0003363 3300046557 Bacteria 7549
365 Ga0495633_0001431 3300046558 Bacteria 18589
366 Ga0495668_0000060 3300046616 Bacteria 193823
367 Ga0495668_0007428 3300046616 Bacteria 7003
368 Ga0495668_0011544 3300046616 Bacteria 5284
369 Ga0495668_0056891 3300046616 Bacteria 2158
370 Ga0495611_0034390 3300046648 Bacteria 2240
371 Ga0495611_0061304 3300046648 Bacteria 1710
372 Ga0495625_0000230 3300046660 Bacteria 88194
373 Ga0495625_0002109 3300046660 Bacteria 22195
374 Ga0495625_0005999 3300046660 Bacteria 10917
375 Ga0495625_0022534 3300046660 Bacteria 4828
376 Ga0495625_0126188 3300046660 Bacteria 1737
377 Ga0495625_0164386 3300046660 Bacteria 1485
378 Ga0495588_0181870 3300046674 Bacteria 1111
379 Ga0495669_0000001 3300046684 Bacteria 291866
380 Ga0495669_0001005 3300046684 Bacteria 11776
381 Ga0495669_0010972 3300046684 Bacteria 3836
382 Ga0495669_0021526 3300046684 Bacteria 2799
383 Ga0495669_0268560 3300046684 Bacteria 820
384 Ga0495613_0001207 3300046689 Bacteria 19754
385 Ga0495670_0047646 3300046691 Bacteria 2143
386 Ga0495670_0300012 3300046691 Bacteria 861
387 Ga0495671_0023182 3300046692 Bacteria 3245
388 Ga0495589_0002064 3300046794 Bacteria 11374
389 Ga0495660_0003718 3300046810 Bacteria 9368
390 Ga0495660_0104674 3300046810 Bacteria 1452
391 Ga0495674_0452689 3300047319 Bacteria 1031
392 Ga0495672_0012911 3300047320 Bacteria 5792
393 Ga0495672_0349665 3300047320 Bacteria 687
394 Ga0495677_0007946 3300047445 Bacteria 3942
395 Ga0495679_015581 3300047446 Bacteria 2776
396 Ga0495673_0000163 3300047469 Bacteria 114230
397 Ga0495673_0000420 3300047469 Bacteria 48299
398 Ga0495673_0027096 3300047469 Bacteria 2731
399 Ga0495681_0046929 3300047470 Bacteria 2057
400 Ga0495681_0062707 3300047470 Bacteria 1708
401 Ga0495686_0009511 3300047472 Bacteria 6992
402 Ga0495686_0017179 3300047472 Bacteria 4882
403 Ga0495686_0019350 3300047472 Bacteria 4549
404 Ga0495686_0124396 3300047472 Bacteria 1534
405 Ga0495593_0062559 3300047673 Bacteria 1945
406 Ga0496101_0042222 3300048904 Bacteria 3255
407 Ga0496101_0052068 3300048904 Bacteria 2951
408 Ga0496102_0059921 3300048905 Bacteria 3482
409 Ga0496102_0180829 3300048905 Bacteria 1987
410 Ga0496106_0007083 3300048909 Bacteria 8287
411 Ga0496106_0441204 3300048909 Bacteria 1046
412 Ga0496107_0001960 3300048910 Bacteria 13079
413 Ga0496109_0027753 3300048912 Bacteria 5058
414 Ga0496110_0145971 3300048913 Bacteria 2140
415 Ga0496112_0145643 3300048915 Bacteria 2337
416 Ga0496112_0187579 3300048915 Bacteria 2031
417 Ga0496113_0231067 3300048916 Bacteria 1475
418 Ga0496115_0002336 3300048918 Bacteria 13597
419 Ga0496115_0004948 3300048918 Bacteria 9682
420 Ga0496115_0008853 3300048918 Bacteria 7461
421 Ga0496115_0142323 3300048918 Bacteria 1979
422 Ga0496115_0315588 3300048918 Bacteria 1279
423 Ga0496115_0615639 3300048918 Bacteria 862
424 Ga0496117_0061312 3300048920 Bacteria 2586
425 Ga0496118_0008028 3300048921 Bacteria 11023
426 Ga0496121_0000009 3300048924 Bacteria 836971
427 Ga0496121_0001556 3300048924 Bacteria 38368
428 Ga0496121_0192760 3300048924 Bacteria 1460
429 Ga0496121_0346969 3300048924 Bacteria 990
430 Ga0496122_0026335 3300048925 Bacteria 5017
431 Ga0496122_0109319 3300048925 Bacteria 1820
432 Ga0496123_0004875 3300048926 Bacteria 13801
433 Ga0496124_0006138 3300048927 Bacteria 13184
434 Ga0496124_0339330 3300048927 Bacteria 1068
435 Ga0496125_0001384 3300048928 Bacteria 35511
436 Ga0496125_0162570 3300048928 Bacteria 1514
437 Ga0496126_0045699 3300048929 Bacteria 4022
438 Ga0496126_0145737 3300048929 Bacteria 2034
439 Ga0496126_0406474 3300048929 Bacteria 1103
440 Ga0495678_001173 3300049459 Bacteria 21592
441 Ga0501034_0010705 3300049571 Bacteria 9528
442 Ga0501037_0107343 3300049573 Bacteria 2012
443 Ga0501043_0412118 3300049579 Bacteria 1020
444 Ga0501047_0000907 3300049581 Bacteria 30267
445 Ga0501047_0014684 3300049581 Bacteria 7453
446 Ga0501048_0035662 3300049582 Bacteria 3580
447 Ga0501238_003403 3300049671 Bacteria 1953
448 Ga0501035_0575054 3300049822 Bacteria 921
449 Ga0501035_0719370 3300049822 Bacteria 804
450 Ga0501044_0014254 3300049823 Bacteria 8583
451 Ga0501044_0243146 3300049823 Bacteria 1743
452 Ga0501044_0421271 3300049823 Bacteria 1245
453 nmdc:mga00v17_23909_c1 3300050491 Bacteria 3539
454 nmdc:mga0k408_179012_c1 3300050493 Bacteria 1264
455 nmdc:mga0k408_220804_c1 3300050493 Bacteria 1131
456 nmdc:mga0k408_222791_c1 3300050493 Bacteria 1126
457 nmdc:mga0k408_78776_c1 3300050493 Bacteria 1928
458 nmdc:mga06z11_78420_c1 3300050494 Bacteria 1766
459 nmdc:mga07m45_46041_c1 3300050496 Bacteria 2450
460 nmdc:mga07m45_48325_c1 3300050496 Bacteria 2392
461 nmdc:mga07m45_8634_c1 3300050496 Bacteria 5246
462 Ga0500635_0000149 3300053080 Bacteria 39267
463 Ga0500578_0000056 3300053086 Bacteria 120189
464 Ga0500578_0264411 3300053086 Bacteria 1032
465 Ga0500643_004115 3300053087 Bacteria 6698
466 Ga0500643_008887 3300053087 Bacteria 3897
467 Ga0500643_011908 3300053087 Bacteria 3142
468 Ga0500643_059449 3300053087 Bacteria 1076
469 Ga0500644_0000046 3300053088 Bacteria 73850
470 Ga0500647_0005680 3300053091 Bacteria 5198
471 Ga0500651_0007472 3300053093 Bacteria 6386
472 Ga0500566_0028400 3300053094 Bacteria 3270
473 Ga0500641_0000846 3300053096 Bacteria 11006
474 Ga0500641_0040516 3300053096 Bacteria 1882
475 Ga0500554_108208 3300053102 Bacteria 933
476 Ga0500555_001565 3300053103 Bacteria 6922
477 Ga0500556_0001070 3300053104 Bacteria 14004
478 Ga0500556_0075254 3300053104 Bacteria 1268
479 Ga0500562_001295 3300053108 Bacteria 6169
480 Ga0500562_001334 3300053108 Bacteria 6082
481 Ga0500569_003708 3300053109 Bacteria 3150
482 Ga0500572_075554 3300053111 Bacteria 1048
483 Ga0500594_0000197 3300053118 Bacteria 14989
484 Ga0500595_006903 3300053119 Bacteria 4765
485 Ga0500595_041171 3300053119 Bacteria 1486
486 Ga0500597_209105 3300053120 Bacteria 816
487 Ga0500608_000012 3300053122 Bacteria 91378
488 Ga0500608_000308 3300053122 Bacteria 18930
489 Ga0500608_101687 3300053122 Bacteria 1331
490 Ga0500614_003117 3300053123 Bacteria 3601
491 Ga0500618_000047 3300053125 Bacteria 109222
492 Ga0500642_0123991 3300053130 Bacteria 1209
493 Ga0500642_0156991 3300053130 Bacteria 1067
494 Ga0500658_0020835 3300053134 Bacteria 2479
495 Ga0500559_0000058 3300053136 Bacteria 88268
496 Ga0500559_0015519 3300053136 Bacteria 3216
497 Ga0500559_0023063 3300053136 Bacteria 2641
498 Ga0500559_0025230 3300053136 Bacteria 2529
499 Ga0500559_0144630 3300053136 Bacteria 1114
500 Ga0500564_000125 3300053138 Bacteria 19515
501 Ga0500573_0081195 3300053140 Bacteria 1842
502 Ga0500577_0011988 3300053142 Bacteria 2606
503 Ga0500590_076631 3300053148 Bacteria 1651
504 Ga0500622_0000468 3300053156 Bacteria 38166
505 Ga0500624_029100 3300053157 Bacteria 939
506 Ga0500627_0058974 3300053158 Bacteria 1685
507 Ga0500638_044763 3300053162 Bacteria 2148
508 Ga0500639_145469 3300053163 Bacteria 1101
509 Ga0500636_0053441 3300053177 Bacteria 2370
510 Ga0500637_0007601 3300053178 Bacteria 5430
511 Ga0500637_0041208 3300053178 Bacteria 2610
512 Ga0500625_048077 3300053729 Bacteria 1982
513 Ga0500645_001355 3300053730 Bacteria 12624
514 Ga0500645_001688 3300053730 Bacteria 10789
515 Ga0500645_002774 3300053730 Bacteria 7568
516 Ga0500609_000356 3300053731 Bacteria 6778
517 Ga0500596_000193 3300053735 Bacteria 9989
518 Ga0500661_012282 3300055283 Bacteria 1547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0056506 Ga0466967_0056506_891_1562 193
2 3300053730 Ga0500645_002774 Ga0500645_002774_2337_3029 193
3 3300003578 Ga0006562J51391_1114709 Ga0006562J51391_11147093 204
4 3300026089 Ga0207648_10346810 Ga0207648_103468102 204
5 3300046558 Ga0495633_0001431 Ga0495633_0001431_7806_8489 204
6 3300025924 Ga0207694_10165627 Ga0207694_101656272 205
7 3300046528 Ga0495642_0074275 Ga0495642_0074275_784_1404 205
8 3300047320 Ga0495672_0349665 Ga0495672_0349665_20_640 205
9 3300047445 Ga0495677_0007946 Ga0495677_0007946_35_655 205
10 3300028379 Ga0268266_10723905 Ga0268266_107239052 207
11 3300006038 Ga0075365_10153477 Ga0075365_101534772 209
12 3300006846 Ga0075430_100628433 Ga0075430_1006284331 209
13 3300044765 Ga0466970_0478125 Ga0466970_0478125_17_649 209
14 3300032004 Ga0307414_10162878 Ga0307414_101628782 211
15 3300035089 Ga0373944_0019001 Ga0373944_0019001_1150_1836 211
16 3300035171 Ga0373946_0025080 Ga0373946_0025080_954_1640 211
17 3300035695 Ga0373927_0001122 Ga0373927_0001122_2728_3414 211
18 3300037068 Ga0373925_0000136 Ga0373925_0000136_39375_40061 211
19 3300005841 Ga0068863_100444512 Ga0068863_1004445122 216
20 3300009093 Ga0105240_10354135 Ga0105240_103541351 217
21 3300025941 Ga0207711_10221490 Ga0207711_102214902 217
22 3300009177 Ga0105248_10124886 Ga0105248_101248862 221
23 3300009177 Ga0105248_11426459 Ga0105248_114264591 221
24 iso_pu_bacteria 2643221663 2644354344 221
25 iso_pu_bacteria 2928972540 2928975231 221
26 iso_pu_bacteria 2941485952 2941488323 221
27 iso_pu_bacteria 2977240413 2977241775 221
28 iso_pu_bacteria 2510917020 2511120765 222
29 iso_pu_bacteria 2582581279 2585147111 222
30 iso_pu_bacteria 2582581280 2585150789 222
31 iso_pu_bacteria 2582581293 2585195761 222
32 iso_pu_bacteria 2585428106 2587917978 222
33 iso_pu_bacteria 2643221545 2643751226 222
34 iso_pu_bacteria 2643221552 2643780578 222
35 iso_pu_bacteria 2643221574 2643883197 222
36 iso_pu_bacteria 2643221583 2643926594 222
37 iso_pu_bacteria 2643221584 2643929223 222
38 iso_pu_bacteria 2643221598 2644002135 222
39 iso_pu_bacteria 2643221640 2644224511 222
40 iso_pu_bacteria 2643221642 2644234553 222
41 iso_pu_bacteria 2643221691 2644511193 222
42 iso_pu_bacteria 2643221699 2644547451 222
43 iso_pu_bacteria 2643221699 2644552380 222
44 iso_pu_bacteria 2791355048 2792462551 222
45 iso_pu_bacteria 2818991435 2819538663 222
46 iso_pu_bacteria 2818991454 2819646803 222
47 iso_pu_bacteria 2843744320 2843748565 222
48 iso_pu_bacteria 2849560528 2849565278 222
49 iso_pu_bacteria 2849573788 2849578923 222
50 iso_pu_bacteria 2851153111 2851156384 222
51 iso_pu_bacteria 2857504554 2857504782 222
52 iso_pu_bacteria 2884960567 2884965310 222
53 iso_pu_bacteria 2898329390 2898330174 222
54 iso_pu_bacteria 2928531327 2928532831 222
55 iso_pu_bacteria 2643221614 2644085545 223
56 iso_pu_bacteria 2643221661 2644343097 223
57 iso_pu_bacteria 2643221666 2644366397 223
58 3300025919 Ga0207657_10075310 Ga0207657_100753103 224
59 3300003781 Ga0055536_1001223 Ga0055536_10012238 225
60 3300003781 Ga0055536_1001420 Ga0055536_10014202 225
61 3300003794 Ga0055531_10040142 Ga0055531_100401422 225
62 3300013308 Ga0157375_10442141 Ga0157375_104421411 225
63 3300025292 Ga0209676_1000733 Ga0209676_100073325 225
64 3300025292 Ga0209676_1001881 Ga0209676_100188111 225
65 3300025298 Ga0209050_1008436 Ga0209050_10084362 225
66 3300025304 Ga0209257_1000561 Ga0209257_100056123 225
67 3300025304 Ga0209257_1001589 Ga0209257_100158914 225
68 3300028558 Ga0265326_10030900 Ga0265326_100309002 225
69 3300028800 Ga0265338_10017428 Ga0265338_100174287 225
70 3300028800 Ga0265338_10064540 Ga0265338_100645404 225
71 3300028800 Ga0265338_10067268 Ga0265338_100672682 225
72 3300028800 Ga0265338_10297058 Ga0265338_102970582 225
73 3300031711 Ga0265314_10253815 Ga0265314_102538152 225
74 3300032004 Ga0307414_10052527 Ga0307414_100525272 225
75 3300032004 Ga0307414_10451599 Ga0307414_104515992 225
76 3300036401 Ga0373937_0513369 Ga0373937_0513369_211_903 225
77 3300039437 Ga0436365_1656308 Ga0436365_1656308_2599_3291 225
78 3300042533 Ga0450901_003049 Ga0450901_003049_288_971 225
79 3300048925 Ga0496122_0026335 Ga0496122_0026335_2080_2763 225
80 3300048925 Ga0496122_0109319 Ga0496122_0109319_1031_1714 225
81 3300048926 Ga0496123_0004875 Ga0496123_0004875_12996_13679 225
82 3300048928 Ga0496125_0001384 Ga0496125_0001384_34221_34904 225
83 3300048929 Ga0496126_0406474 Ga0496126_0406474_264_947 225
84 3300053093 Ga0500651_0007472 Ga0500651_0007472_4039_4722 225
85 3300053140 Ga0500573_0081195 Ga0500573_0081195_133_816 225
86 3300003215 JGI25153J46596_10038344 JGI25153J46596_100383442 226
87 3300003215 JGI25153J46596_10082874 JGI25153J46596_100828741 226
88 3300003320 rootH2_10176393 rootH2_101763932 226
89 3300003773 Ga0055537_1001619 Ga0055537_10016196 226
90 3300003775 Ga0055524_1007881 Ga0055524_10078813 226
91 3300003781 Ga0055536_1000393 Ga0055536_100039328 226
92 3300003781 Ga0055536_1004944 Ga0055536_10049445 226
93 3300003790 Ga0055528_1006482 Ga0055528_10064822 226
94 3300003791 Ga0055530_10000188 Ga0055530_1000018811 226
95 3300003791 Ga0055530_10003290 Ga0055530_100032906 226
96 3300003791 Ga0055530_10005883 Ga0055530_100058833 226
97 3300003794 Ga0055531_10001067 Ga0055531_100010675 226
98 3300003794 Ga0055531_10001676 Ga0055531_1000167613 226
99 3300003794 Ga0055531_10001776 Ga0055531_1000177613 226
100 3300003794 Ga0055531_10003003 Ga0055531_1000300310 226
101 3300004625 Ga0055543_1011440 Ga0055543_10114402 226
102 3300005262 Ga0065165_1000029 Ga0065165_1000029132 226
103 3300005262 Ga0065165_1001558 Ga0065165_100155816 226
104 3300005262 Ga0065165_1011977 Ga0065165_10119771 226
105 3300005327 Ga0070658_10147533 Ga0070658_101475332 226
106 3300005327 Ga0070658_10449251 Ga0070658_104492512 226
107 3300005331 Ga0070670_100000050 Ga0070670_10000005051 226
108 3300005331 Ga0070670_100043998 Ga0070670_1000439983 226
109 3300005331 Ga0070670_100049662 Ga0070670_1000496623 226
110 3300005336 Ga0070680_100021729 Ga0070680_1000217293 226
111 3300005336 Ga0070680_100032004 Ga0070680_1000320043 226
112 3300005336 Ga0070680_100036438 Ga0070680_1000364383 226
113 3300005336 Ga0070680_100440860 Ga0070680_1004408602 226
114 3300005339 Ga0070660_100203419 Ga0070660_1002034192 226
115 3300005339 Ga0070660_100360374 Ga0070660_1003603742 226
116 3300005347 Ga0070668_100000170 Ga0070668_10000017016 226
117 3300005347 Ga0070668_100004210 Ga0070668_1000042108 226
118 3300005347 Ga0070668_100005892 Ga0070668_1000058927 226
119 3300005347 Ga0070668_100020499 Ga0070668_1000204992 226
120 3300005347 Ga0070668_100039071 Ga0070668_1000390712 226
121 3300005353 Ga0070669_100005143 Ga0070669_10000514311 226
122 3300005355 Ga0070671_100004825 Ga0070671_1000048252 226
123 3300005355 Ga0070671_100098164 Ga0070671_1000981641 226
124 3300005366 Ga0070659_100003569 Ga0070659_1000035697 226
125 3300005366 Ga0070659_100009258 Ga0070659_1000092583 226
126 3300005366 Ga0070659_100063709 Ga0070659_1000637092 226
127 3300005367 Ga0070667_100000140 Ga0070667_10000014072 226
128 3300005367 Ga0070667_100010714 Ga0070667_1000107147 226
129 3300005367 Ga0070667_100030544 Ga0070667_1000305442 226
130 3300005455 Ga0070663_100307516 Ga0070663_1003075162 226
131 3300005456 Ga0070678_100056052 Ga0070678_1000560523 226
132 3300005458 Ga0070681_10006946 Ga0070681_100069465 226
133 3300005458 Ga0070681_10045247 Ga0070681_100452475 226
134 3300005530 Ga0070679_100011303 Ga0070679_1000113033 226
135 3300005539 Ga0068853_100256163 Ga0068853_1002561632 226
136 3300005543 Ga0070672_100520033 Ga0070672_1005200331 226
137 3300005548 Ga0070665_100000248 Ga0070665_10000024853 226
138 3300005548 Ga0070665_100000819 Ga0070665_10000081942 226
139 3300005548 Ga0070665_100000923 Ga0070665_10000092321 226
140 3300005548 Ga0070665_100054835 Ga0070665_1000548354 226
141 3300005548 Ga0070665_100097260 Ga0070665_1000972602 226
142 3300005548 Ga0070665_100165319 Ga0070665_1001653192 226
143 3300005563 Ga0068855_100047390 Ga0068855_1000473905 226
144 3300005563 Ga0068855_100096697 Ga0068855_1000966974 226
145 3300005563 Ga0068855_100175085 Ga0068855_1001750853 226
146 3300005564 Ga0070664_100064963 Ga0070664_1000649632 226
147 3300005564 Ga0070664_100357910 Ga0070664_1003579102 226
148 3300005577 Ga0068857_100150090 Ga0068857_1001500901 226
149 3300005614 Ga0068856_100282780 Ga0068856_1002827802 226
150 3300005616 Ga0068852_100508533 Ga0068852_1005085332 226
151 3300005616 Ga0068852_100920134 Ga0068852_1009201341 226
152 3300005617 Ga0068859_100000177 Ga0068859_10000017756 226
153 3300005617 Ga0068859_100059275 Ga0068859_1000592754 226
154 3300005617 Ga0068859_100227594 Ga0068859_1002275942 226
155 3300005618 Ga0068864_100000275 Ga0068864_10000027511 226
156 3300005618 Ga0068864_100000525 Ga0068864_10000052516 226
157 3300005719 Ga0068861_100563982 Ga0068861_1005639822 226
158 3300005841 Ga0068863_100000292 Ga0068863_10000029232 226
159 3300005841 Ga0068863_100000338 Ga0068863_10000033816 226
160 3300005841 Ga0068863_100005365 Ga0068863_1000053655 226
161 3300005841 Ga0068863_100027386 Ga0068863_1000273862 226
162 3300005841 Ga0068863_100263361 Ga0068863_1002633612 226
163 3300005841 Ga0068863_100388149 Ga0068863_1003881491 226
164 3300005841 Ga0068863_100509829 Ga0068863_1005098292 226
165 3300005842 Ga0068858_100000098 Ga0068858_10000009833 226
166 3300005842 Ga0068858_100004751 Ga0068858_1000047513 226
167 3300005842 Ga0068858_100012403 Ga0068858_1000124032 226
168 3300005842 Ga0068858_100403959 Ga0068858_1004039591 226
169 3300005843 Ga0068860_100000517 Ga0068860_10000051717 226
170 3300005843 Ga0068860_100000845 Ga0068860_10000084529 226
171 3300005844 Ga0068862_100001028 Ga0068862_10000102823 226
172 3300005844 Ga0068862_100015158 Ga0068862_1000151585 226
173 3300005844 Ga0068862_100453379 Ga0068862_1004533792 226
174 3300006028 Ga0070717_10242158 Ga0070717_102421582 226
175 3300006042 Ga0075368_10000345 Ga0075368_100003452 226
176 3300006048 Ga0075363_100035980 Ga0075363_1000359802 226
177 3300006051 Ga0075364_10010709 Ga0075364_100107093 226
178 3300006178 Ga0075367_10021501 Ga0075367_100215012 226
179 3300006186 Ga0075369_10037275 Ga0075369_100372752 226
180 3300006195 Ga0075366_10031817 Ga0075366_100318172 226
181 3300006195 Ga0075366_10249392 Ga0075366_102493922 226
182 3300006353 Ga0075370_10046517 Ga0075370_100465172 226
183 3300006353 Ga0075370_10164372 Ga0075370_101643721 226
184 3300006353 Ga0075370_10301561 Ga0075370_103015612 226
185 3300006881 Ga0068865_100026275 Ga0068865_1000262753 226
186 3300006931 Ga0097620_100000177 Ga0097620_10000017756 226
187 3300006931 Ga0097620_100059277 Ga0097620_1000592774 226
188 3300006931 Ga0097620_100227605 Ga0097620_1002276052 226
189 3300009092 Ga0105250_10004695 Ga0105250_100046952 226
190 3300009093 Ga0105240_10000522 Ga0105240_100005224 226
191 3300009093 Ga0105240_10043875 Ga0105240_100438753 226
192 3300009093 Ga0105240_10558891 Ga0105240_105588912 226
193 3300009101 Ga0105247_10031265 Ga0105247_100312652 226
194 3300009174 Ga0105241_10383958 Ga0105241_103839582 226
195 3300009177 Ga0105248_10002192 Ga0105248_1000219220 226
196 3300009177 Ga0105248_10006463 Ga0105248_100064632 226
197 3300009177 Ga0105248_10735334 Ga0105248_107353342 226
198 3300009551 Ga0105238_10762194 Ga0105238_107621942 226
199 3300009553 Ga0105249_10012701 Ga0105249_100127013 226
200 3300010375 Ga0105239_11074519 Ga0105239_110745191 226
201 3300013100 Ga0157373_10000586 Ga0157373_1000058616 226
202 3300013100 Ga0157373_10003492 Ga0157373_1000349214 226
203 3300013104 Ga0157370_10051382 Ga0157370_100513823 226
204 3300013104 Ga0157370_10198200 Ga0157370_101982002 226
205 3300013105 Ga0157369_10012338 Ga0157369_100123383 226
206 3300013296 Ga0157374_10123650 Ga0157374_101236502 226
207 3300013306 Ga0163162_10050997 Ga0163162_100509973 226
208 3300013306 Ga0163162_10058980 Ga0163162_100589804 226
209 3300013307 Ga0157372_10350664 Ga0157372_103506642 226
210 3300013308 Ga0157375_10077717 Ga0157375_100777172 226
211 3300014325 Ga0163163_10003088 Ga0163163_100030886 226
212 3300014325 Ga0163163_10004095 Ga0163163_1000409511 226
213 3300014325 Ga0163163_10157442 Ga0163163_101574422 226
214 3300014325 Ga0163163_10329031 Ga0163163_103290312 226
215 3300014325 Ga0163163_10447716 Ga0163163_104477162 226
216 3300014325 Ga0163163_10615263 Ga0163163_106152632 226
217 3300014968 Ga0157379_10000956 Ga0157379_100009562 226
218 3300014968 Ga0157379_10007852 Ga0157379_1000785213 226
219 3300014968 Ga0157379_10192841 Ga0157379_101928412 226
220 3300021361 Ga0213872_10043179 Ga0213872_100431792 226
221 3300021384 Ga0213876_10050798 Ga0213876_100507982 226
222 3300021384 Ga0213876_10248628 Ga0213876_102486282 226
223 3300021388 Ga0213875_10199564 Ga0213875_101995641 226
224 3300021441 Ga0213871_10026137 Ga0213871_100261371 226
225 3300025263 Ga0209565_1000301 Ga0209565_100030125 226
226 3300025273 Ga0209673_1000652 Ga0209673_100065226 226
227 3300025291 Ga0209675_1009228 Ga0209675_10092282 226
228 3300025292 Ga0209676_1000291 Ga0209676_100029136 226
229 3300025292 Ga0209676_1000374 Ga0209676_100037416 226
230 3300025295 Ga0209564_1001598 Ga0209564_10015988 226
231 3300025295 Ga0209564_1029748 Ga0209564_10297482 226
232 3300025297 Ga0209758_1000649 Ga0209758_100064955 226
233 3300025297 Ga0209758_1001229 Ga0209758_100122914 226
234 3300025297 Ga0209758_1004447 Ga0209758_10044478 226
235 3300025298 Ga0209050_1000031 Ga0209050_1000031267 226
236 3300025298 Ga0209050_1000327 Ga0209050_100032783 226
237 3300025298 Ga0209050_1000443 Ga0209050_100044367 226
238 3300025298 Ga0209050_1002696 Ga0209050_10026963 226
239 3300025299 Ga0209256_1000592 Ga0209256_100059218 226
240 3300025299 Ga0209256_1002655 Ga0209256_10026552 226
241 3300025299 Ga0209256_1013992 Ga0209256_10139922 226
242 3300025303 Ga0209051_1002121 Ga0209051_10021218 226
243 3300025304 Ga0209257_1000066 Ga0209257_1000066118 226
244 3300025304 Ga0209257_1000073 Ga0209257_1000073113 226
245 3300025304 Ga0209257_1000345 Ga0209257_100034532 226
246 3300025304 Ga0209257_1009199 Ga0209257_10091997 226
247 3300025711 Ga0207696_1011837 Ga0207696_10118372 226
248 3300025903 Ga0207680_10045867 Ga0207680_100458672 226
249 3300025909 Ga0207705_10010270 Ga0207705_100102702 226
250 3300025909 Ga0207705_10183064 Ga0207705_101830641 226
251 3300025912 Ga0207707_10041365 Ga0207707_100413653 226
252 3300025912 Ga0207707_10058107 Ga0207707_100581073 226
253 3300025913 Ga0207695_10001134 Ga0207695_100011344 226
254 3300025913 Ga0207695_10048841 Ga0207695_100488412 226
255 3300025913 Ga0207695_10481795 Ga0207695_104817952 226
256 3300025917 Ga0207660_10003586 Ga0207660_100035865 226
257 3300025917 Ga0207660_10009948 Ga0207660_100099483 226
258 3300025919 Ga0207657_10008921 Ga0207657_100089215 226
259 3300025919 Ga0207657_10304438 Ga0207657_103044382 226
260 3300025921 Ga0207652_10348199 Ga0207652_103481992 226
261 3300025923 Ga0207681_10002898 Ga0207681_1000289810 226
262 3300025924 Ga0207694_10063437 Ga0207694_100634373 226
263 3300025925 Ga0207650_10000133 Ga0207650_100001338 226
264 3300025925 Ga0207650_10037797 Ga0207650_100377973 226
265 3300025925 Ga0207650_10601060 Ga0207650_106010601 226
266 3300025931 Ga0207644_10002470 Ga0207644_100024702 226
267 3300025931 Ga0207644_10011959 Ga0207644_100119596 226
268 3300025932 Ga0207690_10007078 Ga0207690_100070785 226
269 3300025932 Ga0207690_10276783 Ga0207690_102767832 226
270 3300025932 Ga0207690_10315563 Ga0207690_103155632 226
271 3300025932 Ga0207690_10505144 Ga0207690_105051442 226
272 3300025933 Ga0207706_10056021 Ga0207706_100560212 226
273 3300025938 Ga0207704_10149231 Ga0207704_101492312 226
274 3300025940 Ga0207691_10784218 Ga0207691_107842181 226
275 3300025941 Ga0207711_10003297 Ga0207711_100032977 226
276 3300025941 Ga0207711_10105562 Ga0207711_101055622 226
277 3300025942 Ga0207689_10122428 Ga0207689_101224282 226
278 3300025945 Ga0207679_10026804 Ga0207679_100268042 226
279 3300025945 Ga0207679_10478659 Ga0207679_104786592 226
280 3300025949 Ga0207667_10014517 Ga0207667_100145173 226
281 3300025960 Ga0207651_10185686 Ga0207651_101856862 226
282 3300025961 Ga0207712_10002966 Ga0207712_100029668 226
283 3300025972 Ga0207668_10000078 Ga0207668_1000007835 226
284 3300025972 Ga0207668_10000275 Ga0207668_1000027524 226
285 3300025972 Ga0207668_10007208 Ga0207668_100072082 226
286 3300025972 Ga0207668_10009969 Ga0207668_100099697 226
287 3300025972 Ga0207668_10035940 Ga0207668_100359402 226
288 3300025986 Ga0207658_10012809 Ga0207658_100128099 226
289 3300025986 Ga0207658_10021635 Ga0207658_100216352 226
290 3300025986 Ga0207658_10115485 Ga0207658_101154852 226
291 3300026023 Ga0207677_10384939 Ga0207677_103849391 226
292 3300026035 Ga0207703_10000086 Ga0207703_1000008648 226
293 3300026035 Ga0207703_10003261 Ga0207703_1000326112 226
294 3300026035 Ga0207703_10037811 Ga0207703_100378113 226
295 3300026041 Ga0207639_10005477 Ga0207639_100054776 226
296 3300026041 Ga0207639_10268695 Ga0207639_102686952 226
297 3300026067 Ga0207678_10110423 Ga0207678_101104232 226
298 3300026078 Ga0207702_10597460 Ga0207702_105974602 226
299 3300026088 Ga0207641_10000395 Ga0207641_1000039522 226
300 3300026088 Ga0207641_10004884 Ga0207641_100048843 226
301 3300026088 Ga0207641_10313742 Ga0207641_103137422 226
302 3300026095 Ga0207676_10000427 Ga0207676_1000042719 226
303 3300026095 Ga0207676_10005547 Ga0207676_1000554712 226
304 3300026095 Ga0207676_10023190 Ga0207676_100231904 226
305 3300026118 Ga0207675_100728846 Ga0207675_1007288461 226
306 3300026121 Ga0207683_10196611 Ga0207683_101966112 226
307 3300026142 Ga0207698_10039185 Ga0207698_100391852 226
308 3300027378 Ga0209981_1001438 Ga0209981_10014382 226
309 3300028379 Ga0268266_10000005 Ga0268266_100000051153 226
310 3300028379 Ga0268266_10001334 Ga0268266_1000133427 226
311 3300028379 Ga0268266_10006847 Ga0268266_1000684711 226
312 3300028379 Ga0268266_10038391 Ga0268266_100383914 226
313 3300028379 Ga0268266_10274006 Ga0268266_102740062 226
314 3300028379 Ga0268266_10576109 Ga0268266_105761092 226
315 3300028380 Ga0268265_10004940 Ga0268265_100049402 226
316 3300028380 Ga0268265_10010592 Ga0268265_100105923 226
317 3300028380 Ga0268265_10014479 Ga0268265_100144793 226
318 3300028380 Ga0268265_10238416 Ga0268265_102384162 226
319 3300028381 Ga0268264_10000358 Ga0268264_1000035851 226
320 3300028381 Ga0268264_10000416 Ga0268264_1000041652 226
321 3300028381 Ga0268264_10021618 Ga0268264_100216182 226
322 3300028556 Ga0265337_1022192 Ga0265337_10221921 226
323 3300028786 Ga0307517_10023152 Ga0307517_100231523 226
324 3300028786 Ga0307517_10088236 Ga0307517_100882362 226
325 3300028794 Ga0307515_10035291 Ga0307515_100352913 226
326 3300028794 Ga0307515_10126219 Ga0307515_101262193 226
327 3300028800 Ga0265338_10005675 Ga0265338_1000567514 226
328 3300031251 Ga0265327_10001847 Ga0265327_100018475 226
329 3300031251 Ga0265327_10004087 Ga0265327_100040879 226
330 3300031456 Ga0307513_10003664 Ga0307513_1000366413 226
331 3300031548 Ga0307408_100473802 Ga0307408_1004738021 226
332 3300031711 Ga0265314_10049039 Ga0265314_100490392 226
333 3300031730 Ga0307516_10000004 Ga0307516_10000004167 226
334 3300031852 Ga0307410_10026250 Ga0307410_100262502 226
335 3300031903 Ga0307407_10023954 Ga0307407_100239542 226
336 3300031995 Ga0307409_100049120 Ga0307409_1000491202 226
337 3300032004 Ga0307414_10180916 Ga0307414_101809162 226
338 3300032004 Ga0307414_10467920 Ga0307414_104679202 226
339 3300032005 Ga0307411_10011119 Ga0307411_100111196 226
340 3300032005 Ga0307411_10186121 Ga0307411_101861212 226
341 3300032005 Ga0307411_10657833 Ga0307411_106578331 226
342 3300033180 Ga0307510_10087367 Ga0307510_100873672 226
343 3300033180 Ga0307510_10115817 Ga0307510_101158172 226
344 3300035113 Ga0373936_0011961 Ga0373936_0011961_419_1105 226
345 3300037312 Ga0395899_0000026 Ga0395899_0000026_339228_339920 226
346 3300037312 Ga0395899_0002138 Ga0395899_0002138_4157_4840 226
347 3300037312 Ga0395899_0062081 Ga0395899_0062081_1405_2091 226
348 3300037418 Ga0395900_0000010 Ga0395900_0000010_343996_344679 226
349 3300037418 Ga0395900_0036567 Ga0395900_0036567_3693_4379 226
350 3300037418 Ga0395900_0492882 Ga0395900_0492882_315_1001 226
351 3300037466 Ga0395898_0122545 Ga0395898_0122545_1410_2096 226
352 3300037466 Ga0395898_0226406 Ga0395898_0226406_467_1150 226
353 3300037466 Ga0395898_0324079 Ga0395898_0324079_430_1116 226
354 3300037466 Ga0395898_0415000 Ga0395898_0415000_464_1162 226
355 3300037466 Ga0395898_0499040 Ga0395898_0499040_430_1116 226
356 3300037471 Ga0395905_0014167 Ga0395905_0014167_1343_2029 226
357 3300037471 Ga0395905_0019940 Ga0395905_0019940_5238_5924 226
358 3300037471 Ga0395905_0290068 Ga0395905_0290068_246_929 226
359 3300037471 Ga0395905_0365885 Ga0395905_0365885_167_865 226
360 3300037471 Ga0395905_0372209 Ga0395905_0372209_355_1041 226
361 3300038443 Ga0395901_0000007 Ga0395901_0000007_428360_429043 226
362 3300038443 Ga0395901_0357164 Ga0395901_0357164_664_1362 226
363 3300038443 Ga0395901_0473384 Ga0395901_0473384_316_1002 226
364 3300038443 Ga0395901_0646322 Ga0395901_0646322_22_708 226
365 3300039437 Ga0436365_0109316 Ga0436365_0109316_510_1193 226
366 3300039437 Ga0436365_0744982 Ga0436365_0744982_721_1407 226
367 3300039438 Ga0436360_0922575 Ga0436360_0922575_2051_2746 226
368 3300039447 Ga0436361_1157906 Ga0436361_1157906_791_1474 226
369 3300041486 Ga0451807_2225897 Ga0451807_2225897_229_912 226
370 3300042156 Ga0439446_0009145 Ga0439446_0009145_1925_2605 226
371 3300044706 Ga0466964_0019477 Ga0466964_0019477_185_871 226
372 3300045049 Ga0466959_0172529 Ga0466959_0172529_550_1242 226
373 3300046453 Ga0495627_000770 Ga0495627_000770_14869_15549 226
374 3300046457 Ga0495590_0000246 Ga0495590_0000246_8721_9401 226
375 3300046460 Ga0495638_0000326 Ga0495638_0000326_15946_16626 226
376 3300046460 Ga0495638_0000434 Ga0495638_0000434_43726_44406 226
377 3300046460 Ga0495638_0000628 Ga0495638_0000628_18243_18923 226
378 3300046460 Ga0495638_0011814 Ga0495638_0011814_4896_5576 226
379 3300046471 Ga0495650_0000244 Ga0495650_0000244_38367_39047 226
380 3300046506 Ga0495583_0000001 Ga0495583_0000001_386167_386847 226
381 3300046506 Ga0495583_0037772 Ga0495583_0037772_706_1392 226
382 3300046507 Ga0495606_0004354 Ga0495606_0004354_13333_14013 226
383 3300046507 Ga0495606_0161099 Ga0495606_0161099_253_951 226
384 3300046507 Ga0495606_0217346 Ga0495606_0217346_263_946 226
385 3300046512 Ga0495610_0000118 Ga0495610_0000118_37629_38309 226
386 3300046512 Ga0495610_0003104 Ga0495610_0003104_2177_2857 226
387 3300046512 Ga0495610_0006617 Ga0495610_0006617_5951_6631 226
388 3300046513 Ga0495616_0000115 Ga0495616_0000115_50447_51127 226
389 3300046513 Ga0495616_0092970 Ga0495616_0092970_392_1072 226
390 3300046515 Ga0495620_0085630 Ga0495620_0085630_467_1147 226
391 3300046516 Ga0495628_0575836 Ga0495628_0575836_14_700 226
392 3300046518 Ga0495631_0003231 Ga0495631_0003231_3158_3838 226
393 3300046519 Ga0495632_0000380 Ga0495632_0000380_2683_3363 226
394 3300046519 Ga0495632_0028480 Ga0495632_0028480_722_1402 226
395 3300046519 Ga0495632_0121597 Ga0495632_0121597_216_896 226
396 3300046520 Ga0495637_0007838 Ga0495637_0007838_4165_4845 226
397 3300046520 Ga0495637_0038891 Ga0495637_0038891_211_891 226
398 3300046522 Ga0495643_0133274 Ga0495643_0133274_189_887 226
399 3300046524 Ga0495648_0000389 Ga0495648_0000389_35878_36558 226
400 3300046524 Ga0495648_0049249 Ga0495648_0049249_1301_1981 226
401 3300046524 Ga0495648_0237867 Ga0495648_0237867_176_856 226
402 3300046525 Ga0495663_0044819 Ga0495663_0044819_234_914 226
403 3300046530 Ga0495654_0000024 Ga0495654_0000024_161453_162133 226
404 3300046530 Ga0495654_0098141 Ga0495654_0098141_134_832 226
405 3300046538 Ga0495609_0029841 Ga0495609_0029841_430_1110 226
406 3300046538 Ga0495609_0094172 Ga0495609_0094172_216_914 226
407 3300046542 Ga0495597_0004527 Ga0495597_0004527_3872_4570 226
408 3300046542 Ga0495597_0070376 Ga0495597_0070376_495_1178 226
409 3300046557 Ga0495622_0003363 Ga0495622_0003363_1325_2023 226
410 3300046616 Ga0495668_0000060 Ga0495668_0000060_166929_167612 226
411 3300046616 Ga0495668_0007428 Ga0495668_0007428_3895_4578 226
412 3300046616 Ga0495668_0011544 Ga0495668_0011544_2358_3038 226
413 3300046616 Ga0495668_0056891 Ga0495668_0056891_711_1409 226
414 3300046648 Ga0495611_0034390 Ga0495611_0034390_803_1489 226
415 3300046648 Ga0495611_0061304 Ga0495611_0061304_472_1170 226
416 3300046660 Ga0495625_0000230 Ga0495625_0000230_30238_30918 226
417 3300046660 Ga0495625_0002109 Ga0495625_0002109_18638_19318 226
418 3300046660 Ga0495625_0005999 Ga0495625_0005999_3948_4628 226
419 3300046660 Ga0495625_0022534 Ga0495625_0022534_709_1392 226
420 3300046660 Ga0495625_0126188 Ga0495625_0126188_502_1197 226
421 3300046660 Ga0495625_0164386 Ga0495625_0164386_210_893 226
422 3300046674 Ga0495588_0181870 Ga0495588_0181870_97_795 226
423 3300046684 Ga0495669_0000001 Ga0495669_0000001_243712_244395 226
424 3300046684 Ga0495669_0001005 Ga0495669_0001005_6786_7469 226
425 3300046684 Ga0495669_0010972 Ga0495669_0010972_2238_2924 226
426 3300046684 Ga0495669_0021526 Ga0495669_0021526_1958_2656 226
427 3300046684 Ga0495669_0268560 Ga0495669_0268560_53_736 226
428 3300046689 Ga0495613_0001207 Ga0495613_0001207_10338_11024 226
429 3300046691 Ga0495670_0047646 Ga0495670_0047646_22_702 226
430 3300046691 Ga0495670_0300012 Ga0495670_0300012_121_801 226
431 3300046692 Ga0495671_0023182 Ga0495671_0023182_1744_2424 226
432 3300046794 Ga0495589_0002064 Ga0495589_0002064_8050_8730 226
433 3300046810 Ga0495660_0003718 Ga0495660_0003718_8403_9083 226
434 3300046810 Ga0495660_0104674 Ga0495660_0104674_473_1153 226
435 3300047319 Ga0495674_0452689 Ga0495674_0452689_91_777 226
436 3300047320 Ga0495672_0012911 Ga0495672_0012911_1615_2304 226
437 3300047446 Ga0495679_015581 Ga0495679_015581_1679_2359 226
438 3300047469 Ga0495673_0000163 Ga0495673_0000163_83123_83803 226
439 3300047469 Ga0495673_0000420 Ga0495673_0000420_25091_25771 226
440 3300047469 Ga0495673_0027096 Ga0495673_0027096_1770_2450 226
441 3300047470 Ga0495681_0046929 Ga0495681_0046929_1093_1773 226
442 3300047470 Ga0495681_0062707 Ga0495681_0062707_40_723 226
443 3300047472 Ga0495686_0009511 Ga0495686_0009511_1900_2586 226
444 3300047472 Ga0495686_0017179 Ga0495686_0017179_1490_2170 226
445 3300047472 Ga0495686_0019350 Ga0495686_0019350_2577_3257 226
446 3300047472 Ga0495686_0124396 Ga0495686_0124396_37_717 226
447 3300047673 Ga0495593_0062559 Ga0495593_0062559_439_1137 226
448 3300048904 Ga0496101_0042222 Ga0496101_0042222_1519_2205 226
449 3300048904 Ga0496101_0052068 Ga0496101_0052068_1615_2295 226
450 3300048905 Ga0496102_0059921 Ga0496102_0059921_1943_2629 226
451 3300048905 Ga0496102_0180829 Ga0496102_0180829_505_1194 226
452 3300048909 Ga0496106_0007083 Ga0496106_0007083_2915_3595 226
453 3300048909 Ga0496106_0441204 Ga0496106_0441204_328_1014 226
454 3300048910 Ga0496107_0001960 Ga0496107_0001960_9745_10425 226
455 3300048912 Ga0496109_0027753 Ga0496109_0027753_3719_4405 226
456 3300048913 Ga0496110_0145971 Ga0496110_0145971_1234_1920 226
457 3300048915 Ga0496112_0145643 Ga0496112_0145643_365_1051 226
458 3300048915 Ga0496112_0187579 Ga0496112_0187579_1112_1798 226
459 3300048916 Ga0496113_0231067 Ga0496113_0231067_169_855 226
460 3300048918 Ga0496115_0002336 Ga0496115_0002336_11767_12453 226
461 3300048918 Ga0496115_0004948 Ga0496115_0004948_2821_3507 226
462 3300048918 Ga0496115_0008853 Ga0496115_0008853_3878_4558 226
463 3300048918 Ga0496115_0142323 Ga0496115_0142323_1268_1954 226
464 3300048918 Ga0496115_0315588 Ga0496115_0315588_458_1150 226
465 3300048918 Ga0496115_0615639 Ga0496115_0615639_120_803 226
466 3300048920 Ga0496117_0061312 Ga0496117_0061312_1825_2526 226
467 3300048921 Ga0496118_0008028 Ga0496118_0008028_1449_2135 226
468 3300048924 Ga0496121_0000009 Ga0496121_0000009_792983_793669 226
469 3300048924 Ga0496121_0001556 Ga0496121_0001556_32439_33119 226
470 3300048924 Ga0496121_0192760 Ga0496121_0192760_211_894 226
471 3300048924 Ga0496121_0346969 Ga0496121_0346969_199_888 226
472 3300048927 Ga0496124_0006138 Ga0496124_0006138_5663_6346 226
473 3300048927 Ga0496124_0339330 Ga0496124_0339330_370_1050 226
474 3300048928 Ga0496125_0162570 Ga0496125_0162570_80_763 226
475 3300048929 Ga0496126_0045699 Ga0496126_0045699_2961_3644 226
476 3300048929 Ga0496126_0145737 Ga0496126_0145737_1097_1777 226
477 3300049459 Ga0495678_001173 Ga0495678_001173_5271_5951 226
478 3300049571 Ga0501034_0010705 Ga0501034_0010705_6717_7400 226
479 3300049573 Ga0501037_0107343 Ga0501037_0107343_1280_1963 226
480 3300049579 Ga0501043_0412118 Ga0501043_0412118_289_975 226
481 3300049581 Ga0501047_0000907 Ga0501047_0000907_20612_21298 226
482 3300049581 Ga0501047_0014684 Ga0501047_0014684_2258_2941 226
483 3300049582 Ga0501048_0035662 Ga0501048_0035662_2250_2936 226
484 3300049671 Ga0501238_003403 Ga0501238_003403_637_1317 226
485 3300049822 Ga0501035_0575054 Ga0501035_0575054_37_723 226
486 3300049822 Ga0501035_0719370 Ga0501035_0719370_19_702 226
487 3300049823 Ga0501044_0014254 Ga0501044_0014254_7818_8501 226
488 3300049823 Ga0501044_0243146 Ga0501044_0243146_433_1119 226
489 3300049823 Ga0501044_0421271 Ga0501044_0421271_119_805 226
490 3300050491 nmdc:mga00v17_23909_c1 nmdc:mga00v17_23909_c1_853_1536 226
491 3300050493 nmdc:mga0k408_179012_c1 nmdc:mga0k408_179012_c1_135_815 226
492 3300050493 nmdc:mga0k408_220804_c1 nmdc:mga0k408_220804_c1_289_969 226
493 3300050493 nmdc:mga0k408_222791_c1 nmdc:mga0k408_222791_c1_169_852 226
494 3300050493 nmdc:mga0k408_78776_c1 nmdc:mga0k408_78776_c1_762_1445 226
495 3300050494 nmdc:mga06z11_78420_c1 nmdc:mga06z11_78420_c1_1070_1753 226
496 3300050496 nmdc:mga07m45_46041_c1 nmdc:mga07m45_46041_c1_1705_2388 226
497 3300050496 nmdc:mga07m45_48325_c1 nmdc:mga07m45_48325_c1_1095_1775 226
498 3300050496 nmdc:mga07m45_8634_c1 nmdc:mga07m45_8634_c1_1171_1854 226
499 3300053080 Ga0500635_0000149 Ga0500635_0000149_22305_22991 226
500 3300053086 Ga0500578_0000056 Ga0500578_0000056_45277_45957 226
501 3300053086 Ga0500578_0264411 Ga0500578_0264411_94_774 226
502 3300053087 Ga0500643_004115 Ga0500643_004115_5840_6526 226
503 3300053087 Ga0500643_008887 Ga0500643_008887_2943_3638 226
504 3300053087 Ga0500643_011908 Ga0500643_011908_2401_3081 226
505 3300053087 Ga0500643_059449 Ga0500643_059449_106_786 226
506 3300053088 Ga0500644_0000046 Ga0500644_0000046_17599_18279 226
507 3300053091 Ga0500647_0005680 Ga0500647_0005680_3400_4083 226
508 3300053094 Ga0500566_0028400 Ga0500566_0028400_1965_2663 226
509 3300053096 Ga0500641_0000846 Ga0500641_0000846_4036_4731 226
510 3300053096 Ga0500641_0040516 Ga0500641_0040516_705_1385 226
511 3300053102 Ga0500554_108208 Ga0500554_108208_78_758 226
512 3300053103 Ga0500555_001565 Ga0500555_001565_1098_1796 226
513 3300053104 Ga0500556_0001070 Ga0500556_0001070_5338_6018 226
514 3300053104 Ga0500556_0075254 Ga0500556_0075254_424_1104 226
515 3300053108 Ga0500562_001295 Ga0500562_001295_5057_5743 226
516 3300053108 Ga0500562_001334 Ga0500562_001334_1573_2253 226
517 3300053109 Ga0500569_003708 Ga0500569_003708_2086_2784 226
518 3300053111 Ga0500572_075554 Ga0500572_075554_155_841 226
519 3300053118 Ga0500594_0000197 Ga0500594_0000197_10365_11045 226
520 3300053119 Ga0500595_006903 Ga0500595_006903_20_718 226
521 3300053119 Ga0500595_041171 Ga0500595_041171_455_1141 226
522 3300053120 Ga0500597_209105 Ga0500597_209105_111_791 226
523 3300053122 Ga0500608_000012 Ga0500608_000012_12165_12848 226
524 3300053122 Ga0500608_000308 Ga0500608_000308_11531_12229 226
525 3300053122 Ga0500608_101687 Ga0500608_101687_313_996 226
526 3300053123 Ga0500614_003117 Ga0500614_003117_2361_3059 226
527 3300053125 Ga0500618_000047 Ga0500618_000047_66789_67469 226
528 3300053130 Ga0500642_0123991 Ga0500642_0123991_220_906 226
529 3300053130 Ga0500642_0156991 Ga0500642_0156991_20_718 226
530 3300053134 Ga0500658_0020835 Ga0500658_0020835_1613_2311 226
531 3300053136 Ga0500559_0000058 Ga0500559_0000058_62880_63560 226
532 3300053136 Ga0500559_0015519 Ga0500559_0015519_237_935 226
533 3300053136 Ga0500559_0023063 Ga0500559_0023063_1412_2092 226
534 3300053136 Ga0500559_0025230 Ga0500559_0025230_324_1007 226
535 3300053136 Ga0500559_0144630 Ga0500559_0144630_247_933 226
536 3300053138 Ga0500564_000125 Ga0500564_000125_14911_15591 226
537 3300053142 Ga0500577_0011988 Ga0500577_0011988_11_691 226
538 3300053148 Ga0500590_076631 Ga0500590_076631_779_1477 226
539 3300053156 Ga0500622_0000468 Ga0500622_0000468_9169_9849 226
540 3300053157 Ga0500624_029100 Ga0500624_029100_146_832 226
541 3300053158 Ga0500627_0058974 Ga0500627_0058974_114_794 226
542 3300053162 Ga0500638_044763 Ga0500638_044763_329_1027 226
543 3300053163 Ga0500639_145469 Ga0500639_145469_302_1000 226
544 3300053177 Ga0500636_0053441 Ga0500636_0053441_587_1273 226
545 3300053178 Ga0500637_0007601 Ga0500637_0007601_2265_2951 226
546 3300053178 Ga0500637_0041208 Ga0500637_0041208_372_1070 226
547 3300053729 Ga0500625_048077 Ga0500625_048077_387_1085 226
548 3300053730 Ga0500645_001355 Ga0500645_001355_10154_10834 226
549 3300053730 Ga0500645_001688 Ga0500645_001688_503_1189 226
550 3300053731 Ga0500609_000356 Ga0500609_000356_608_1288 226
551 3300053735 Ga0500596_000193 Ga0500596_000193_161_859 226
552 3300055283 Ga0500661_012282 Ga0500661_012282_488_1168 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06026

Rib_5-P_isom_A

Ribose 5-phosphate isomerase A (phosphoriboisomerase A)

67

241

0.96

PF00455

DeoRC

DeoR C terminal sensor domain

22

99

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhe-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase a from bartonella henselae 0.9723 2 226
3hhe-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase a from bartonella henselae 0.9639 2 226
6zxt-assembly1.cif.gz_A high resolution crystal structure of chloroplastic ribose-5-phosphate isomerase from chlamydomonas reinhardtii 0.9596 1 225
1m0s-assembly1.cif.gz_B northeast structural genomics consortium (nesg id ir21) 0.9556 1 224
3l7o-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase a from streptococcus mutans ua159 0.9545 7 225
ID Description Score Start End Superfamily
4m8lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9585 3 123 3.40.50.1360
1uj6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9426 3 117 3.40.50.1360
4gmkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9334 7 218 3.40.50.1360
1xtzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9321 5 122 3.40.50.1360
2f8mB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9223 4 217 3.40.50.1360
ID Description Score Start End GO Terms
AF-B0T734-F1-model_v4 Ribose-5-phosphate isomerase A (EC 5.3.1.6) (Phosphoriboisomerase A) (PRI) 0.9996 1 226 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A1G2X2T0-F1-model_v4 deleted 0.9927 1 226
AF-A0A7J4RDJ8-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9901 3 126 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A256YJI0-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9897 22 122 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A1G2X2T0-F1-model_v4 deleted 0.9884 1 226

Feature Viewer

pLDDT pTM Quality
97.68 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map