F462704
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 552 | 260 | 551 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_102135397|Ga0070665_1021353971 |
| Length | 129 |
| Sequence | MAGRKAAGAKTGGRKKALAEPVRIRIKKNDTVKVIAGKDKGKTGRVLEVNQDTGRILVEGVQMIKRHTRPNPAKQIKGGIAEKESSIHASNVMVMTPGGVPTRIGYKVEKEGGVTRRTRIARKTGETLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 94 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 185 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 187 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 228 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 256 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 4.71 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.27 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 88.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000961 | 3300003214 | Bacteria | 19619 |
| 2 | Ga0058863_10010406 | 3300004799 | Bacteria | 2657 |
| 3 | Ga0058863_11587924 | 3300004799 | Bacteria | 716 |
| 4 | Ga0058861_11690222 | 3300004800 | Unclassified | 674 |
| 5 | Ga0058862_11737220 | 3300004803 | Bacteria | 836 |
| 6 | Ga0058862_12843351 | 3300004803 | Unclassified | 917 |
| 7 | Ga0070690_101445468 | 3300005330 | Bacteria | 554 |
| 8 | Ga0070666_10102938 | 3300005335 | Bacteria | 1969 |
| 9 | Ga0070666_10796447 | 3300005335 | Bacteria | 696 |
| 10 | Ga0070680_100072638 | 3300005336 | Bacteria | 2828 |
| 11 | Ga0070680_100287817 | 3300005336 | Bacteria | 1393 |
| 12 | Ga0070680_100421425 | 3300005336 | Bacteria | 1139 |
| 13 | Ga0070682_100352310 | 3300005337 | Bacteria | 1098 |
| 14 | Ga0070682_100681905 | 3300005337 | Bacteria | 822 |
| 15 | Ga0068868_100058678 | 3300005338 | Bacteria | 3042 |
| 16 | Ga0070660_101227932 | 3300005339 | Bacteria | 636 |
| 17 | Ga0070660_101227988 | 3300005339 | Bacteria | 636 |
| 18 | Ga0070691_10212610 | 3300005341 | Bacteria | 1021 |
| 19 | Ga0070692_10085623 | 3300005345 | Bacteria | 1705 |
| 20 | Ga0070668_102193671 | 3300005347 | Bacteria | 510 |
| 21 | Ga0070671_100981568 | 3300005355 | Bacteria | 740 |
| 22 | Ga0070659_100853103 | 3300005366 | Bacteria | 794 |
| 23 | Ga0070667_100096799 | 3300005367 | Bacteria | 2545 |
| 24 | Ga0070667_100295936 | 3300005367 | Bacteria | 1456 |
| 25 | Ga0070667_100639646 | 3300005367 | Bacteria | 982 |
| 26 | Ga0070667_101017746 | 3300005367 | Bacteria | 773 |
| 27 | Ga0070709_10204906 | 3300005434 | Bacteria | 1399 |
| 28 | Ga0070709_10665610 | 3300005434 | Bacteria | 807 |
| 29 | Ga0070709_11279138 | 3300005434 | Bacteria | 591 |
| 30 | Ga0070713_100338754 | 3300005436 | Bacteria | 1393 |
| 31 | Ga0070713_102306310 | 3300005436 | Unclassified | 521 |
| 32 | Ga0070708_100631194 | 3300005445 | Bacteria | 1010 |
| 33 | Ga0070663_100066762 | 3300005455 | Bacteria | 2607 |
| 34 | Ga0070663_101022850 | 3300005455 | Bacteria | 719 |
| 35 | Ga0070662_100505982 | 3300005457 | Bacteria | 1008 |
| 36 | Ga0070681_10084584 | 3300005458 | Bacteria | 3125 |
| 37 | Ga0070681_10169369 | 3300005458 | Bacteria | 2106 |
| 38 | Ga0070681_10283993 | 3300005458 | Bacteria | 1566 |
| 39 | Ga0070681_10307388 | 3300005458 | Bacteria | 1495 |
| 40 | Ga0070681_11147217 | 3300005458 | Unclassified | 698 |
| 41 | Ga0070681_11311227 | 3300005458 | Unclassified | 647 |
| 42 | Ga0070681_12032957 | 3300005458 | Bacteria | 503 |
| 43 | Ga0068867_100068643 | 3300005459 | Bacteria | 2646 |
| 44 | Ga0068867_101081994 | 3300005459 | Bacteria | 731 |
| 45 | Ga0070685_11605353 | 3300005466 | Bacteria | 503 |
| 46 | Ga0070698_101840179 | 3300005471 | Unclassified | 558 |
| 47 | Ga0070679_100030062 | 3300005530 | Bacteria | 5361 |
| 48 | Ga0070679_100048764 | 3300005530 | Bacteria | 4218 |
| 49 | Ga0070679_100418617 | 3300005530 | Bacteria | 1285 |
| 50 | Ga0070679_100443699 | 3300005530 | Bacteria | 1242 |
| 51 | Ga0070679_101313670 | 3300005530 | Bacteria | 669 |
| 52 | Ga0070684_100324235 | 3300005535 | Bacteria | 1415 |
| 53 | Ga0070684_100337792 | 3300005535 | Bacteria | 1384 |
| 54 | Ga0070684_102307355 | 3300005535 | Unclassified | 507 |
| 55 | Ga0068853_100017302 | 3300005539 | Bacteria | 5952 |
| 56 | Ga0068853_100330010 | 3300005539 | Bacteria | 1415 |
| 57 | Ga0068853_100796650 | 3300005539 | Bacteria | 905 |
| 58 | Ga0068853_101307603 | 3300005539 | Bacteria | 701 |
| 59 | Ga0070672_100640382 | 3300005543 | Bacteria | 928 |
| 60 | Ga0070695_101344339 | 3300005545 | Bacteria | 591 |
| 61 | Ga0070693_101072952 | 3300005547 | Bacteria | 613 |
| 62 | Ga0070665_100138657 | 3300005548 | Bacteria | 2435 |
| 63 | Ga0070665_100217892 | 3300005548 | Bacteria | 1909 |
| 64 | Ga0070665_100225239 | 3300005548 | Bacteria | 1875 |
| 65 | Ga0070665_100341650 | 3300005548 | Bacteria | 1502 |
| 66 | Ga0070665_101133462 | 3300005548 | Bacteria | 793 |
| 67 | Ga0070665_101383489 | 3300005548 | Bacteria | 713 |
| 68 | Ga0070665_102135397 | 3300005548 | Unclassified | 564 |
| 69 | Ga0068855_100018562 | 3300005563 | Bacteria | 8363 |
| 70 | Ga0068855_100084797 | 3300005563 | Bacteria | 3667 |
| 71 | Ga0068855_100135013 | 3300005563 | Bacteria | 2815 |
| 72 | Ga0068855_100151277 | 3300005563 | Bacteria | 2639 |
| 73 | Ga0068855_100811778 | 3300005563 | Bacteria | 993 |
| 74 | Ga0068855_102016327 | 3300005563 | Unclassified | 583 |
| 75 | Ga0070664_100055154 | 3300005564 | Bacteria | 3373 |
| 76 | Ga0070664_100488332 | 3300005564 | Bacteria | 1134 |
| 77 | Ga0070664_100572917 | 3300005564 | Bacteria | 1045 |
| 78 | Ga0070664_101764062 | 3300005564 | Unclassified | 587 |
| 79 | Ga0068857_100646626 | 3300005577 | Bacteria | 1002 |
| 80 | Ga0068857_100839846 | 3300005577 | Bacteria | 878 |
| 81 | Ga0068857_101465735 | 3300005577 | Bacteria | 665 |
| 82 | Ga0068854_101021145 | 3300005578 | Bacteria | 733 |
| 83 | Ga0068854_101472932 | 3300005578 | Bacteria | 617 |
| 84 | Ga0068856_100009432 | 3300005614 | Bacteria | 9476 |
| 85 | Ga0068856_100073064 | 3300005614 | Bacteria | 3396 |
| 86 | Ga0068856_100200510 | 3300005614 | Bacteria | 2010 |
| 87 | Ga0068856_100267581 | 3300005614 | Bacteria | 1725 |
| 88 | Ga0068856_100326750 | 3300005614 | Bacteria | 1551 |
| 89 | Ga0068856_100528183 | 3300005614 | Bacteria | 1201 |
| 90 | Ga0068852_100565939 | 3300005616 | Bacteria | 1138 |
| 91 | Ga0068852_100871218 | 3300005616 | Bacteria | 917 |
| 92 | Ga0068852_101890105 | 3300005616 | Bacteria | 619 |
| 93 | Ga0068859_100094099 | 3300005617 | Bacteria | 3048 |
| 94 | Ga0068859_100847934 | 3300005617 | Bacteria | 1000 |
| 95 | Ga0068864_100018412 | 3300005618 | Bacteria | 5835 |
| 96 | Ga0068864_100429064 | 3300005618 | Bacteria | 1261 |
| 97 | Ga0068864_101030018 | 3300005618 | Bacteria | 817 |
| 98 | Ga0068866_10164217 | 3300005718 | Bacteria | 1298 |
| 99 | Ga0068861_100250890 | 3300005719 | Bacteria | 1510 |
| 100 | Ga0068861_100405337 | 3300005719 | Bacteria | 1211 |
| 101 | Ga0068863_100016102 | 3300005841 | Bacteria | 7170 |
| 102 | Ga0068863_100335315 | 3300005841 | Bacteria | 1471 |
| 103 | Ga0068863_101508729 | 3300005841 | Unclassified | 681 |
| 104 | Ga0068863_102250603 | 3300005841 | Bacteria | 555 |
| 105 | Ga0068858_100030046 | 3300005842 | Bacteria | 5045 |
| 106 | Ga0068858_100060954 | 3300005842 | Bacteria | 3487 |
| 107 | Ga0068858_100423960 | 3300005842 | Bacteria | 1280 |
| 108 | Ga0068858_101042353 | 3300005842 | Bacteria | 802 |
| 109 | Ga0068860_100036229 | 3300005843 | Bacteria | 4728 |
| 110 | Ga0068860_100755757 | 3300005843 | Bacteria | 984 |
| 111 | Ga0068860_100930917 | 3300005843 | Bacteria | 886 |
| 112 | Ga0081455_10386263 | 3300005937 | Unclassified | 976 |
| 113 | Ga0070717_10033750 | 3300006028 | Bacteria | 4131 |
| 114 | Ga0070717_10859219 | 3300006028 | Bacteria | 826 |
| 115 | Ga0075365_10551026 | 3300006038 | Bacteria | 815 |
| 116 | Ga0075364_10295262 | 3300006051 | Bacteria | 1103 |
| 117 | Ga0070712_100511026 | 3300006175 | Bacteria | 1008 |
| 118 | Ga0097621_100314685 | 3300006237 | Bacteria | 1385 |
| 119 | Ga0097621_100850574 | 3300006237 | Bacteria | 847 |
| 120 | Ga0097621_101025163 | 3300006237 | Bacteria | 773 |
| 121 | Ga0097621_102163375 | 3300006237 | Bacteria | 532 |
| 122 | Ga0068871_100193630 | 3300006358 | Bacteria | 1752 |
| 123 | Ga0068871_100544580 | 3300006358 | Bacteria | 1050 |
| 124 | Ga0068871_100603408 | 3300006358 | Bacteria | 998 |
| 125 | Ga0068871_101131592 | 3300006358 | Unclassified | 733 |
| 126 | Ga0068871_101947175 | 3300006358 | Bacteria | 559 |
| 127 | Ga0075428_101617485 | 3300006844 | Bacteria | 677 |
| 128 | Ga0075430_100033273 | 3300006846 | Bacteria | 4376 |
| 129 | Ga0075431_100068526 | 3300006847 | Bacteria | 3662 |
| 130 | Ga0075434_100242298 | 3300006871 | Bacteria | 1823 |
| 131 | Ga0075429_100267471 | 3300006880 | Bacteria | 1497 |
| 132 | Ga0068865_100113414 | 3300006881 | Bacteria | 2003 |
| 133 | Ga0097620_100094100 | 3300006931 | Bacteria | 3048 |
| 134 | Ga0097620_100848098 | 3300006931 | Bacteria | 1000 |
| 135 | Ga0105240_10000499 | 3300009093 | Bacteria | 72315 |
| 136 | Ga0105240_11022151 | 3300009093 | Bacteria | 883 |
| 137 | Ga0105240_11466362 | 3300009093 | Unclassified | 716 |
| 138 | Ga0105245_10234129 | 3300009098 | Bacteria | 1778 |
| 139 | Ga0105245_10510093 | 3300009098 | Bacteria | 1220 |
| 140 | Ga0105245_10948397 | 3300009098 | Bacteria | 903 |
| 141 | Ga0114129_10375592 | 3300009147 | Bacteria | 1878 |
| 142 | Ga0105243_10207725 | 3300009148 | Bacteria | 1722 |
| 143 | Ga0105243_10497711 | 3300009148 | Bacteria | 1154 |
| 144 | Ga0105241_10017868 | 3300009174 | Bacteria | 5216 |
| 145 | Ga0105241_10116070 | 3300009174 | Bacteria | 2149 |
| 146 | Ga0105241_10307637 | 3300009174 | Bacteria | 1362 |
| 147 | Ga0105241_10358286 | 3300009174 | Bacteria | 1269 |
| 148 | Ga0105241_10631040 | 3300009174 | Bacteria | 971 |
| 149 | Ga0105241_10641622 | 3300009174 | Bacteria | 964 |
| 150 | Ga0105241_12187915 | 3300009174 | Bacteria | 548 |
| 151 | Ga0105242_11356956 | 3300009176 | Bacteria | 737 |
| 152 | Ga0105242_11785462 | 3300009176 | Bacteria | 653 |
| 153 | Ga0105242_11843140 | 3300009176 | Bacteria | 644 |
| 154 | Ga0105248_10045011 | 3300009177 | Bacteria | 4949 |
| 155 | Ga0105248_10438568 | 3300009177 | Bacteria | 1471 |
| 156 | Ga0105248_10611825 | 3300009177 | Bacteria | 1229 |
| 157 | Ga0105248_10964423 | 3300009177 | Bacteria | 963 |
| 158 | Ga0105248_12890939 | 3300009177 | Unclassified | 547 |
| 159 | Ga0105237_10002619 | 3300009545 | Bacteria | 22167 |
| 160 | Ga0105237_10007763 | 3300009545 | Bacteria | 11701 |
| 161 | Ga0105237_10047955 | 3300009545 | Bacteria | 4295 |
| 162 | Ga0105237_10086917 | 3300009545 | Bacteria | 3117 |
| 163 | Ga0105237_10221528 | 3300009545 | Bacteria | 1892 |
| 164 | Ga0105237_10284777 | 3300009545 | Bacteria | 1655 |
| 165 | Ga0105237_10357318 | 3300009545 | Bacteria | 1465 |
| 166 | Ga0105237_10461628 | 3300009545 | Bacteria | 1276 |
| 167 | Ga0105237_10498738 | 3300009545 | Bacteria | 1224 |
| 168 | Ga0105237_10739499 | 3300009545 | Bacteria | 990 |
| 169 | Ga0105237_10797399 | 3300009545 | Bacteria | 951 |
| 170 | Ga0105238_10094337 | 3300009551 | Bacteria | 2980 |
| 171 | Ga0105238_10636338 | 3300009551 | Bacteria | 1076 |
| 172 | Ga0105238_10990376 | 3300009551 | Bacteria | 861 |
| 173 | Ga0105238_11211882 | 3300009551 | Bacteria | 779 |
| 174 | Ga0105238_11221281 | 3300009551 | Bacteria | 776 |
| 175 | Ga0105238_11278296 | 3300009551 | Bacteria | 759 |
| 176 | Ga0105238_11891438 | 3300009551 | Bacteria | 630 |
| 177 | Ga0105238_12157697 | 3300009551 | Bacteria | 592 |
| 178 | Ga0105238_12825968 | 3300009551 | Bacteria | 522 |
| 179 | Ga0105249_10103809 | 3300009553 | Bacteria | 2678 |
| 180 | Ga0105239_10012303 | 3300010375 | Bacteria | 9531 |
| 181 | Ga0105239_10061221 | 3300010375 | Bacteria | 4131 |
| 182 | Ga0105239_10236062 | 3300010375 | Unclassified | 2052 |
| 183 | Ga0105239_10526954 | 3300010375 | Bacteria | 1344 |
| 184 | Ga0105239_10592207 | 3300010375 | Bacteria | 1264 |
| 185 | Ga0105239_10632459 | 3300010375 | Bacteria | 1222 |
| 186 | Ga0105239_10902550 | 3300010375 | Bacteria | 1014 |
| 187 | Ga0105239_11010016 | 3300010375 | Bacteria | 956 |
| 188 | Ga0105239_11032254 | 3300010375 | Bacteria | 946 |
| 189 | Ga0105239_11070745 | 3300010375 | Bacteria | 928 |
| 190 | Ga0105239_11095099 | 3300010375 | Bacteria | 917 |
| 191 | Ga0105239_13382250 | 3300010375 | Unclassified | 519 |
| 192 | Ga0105246_10123544 | 3300011119 | Bacteria | 1922 |
| 193 | Ga0157373_10190846 | 3300013100 | Bacteria | 1444 |
| 194 | Ga0157371_10024961 | 3300013102 | Bacteria | 4362 |
| 195 | Ga0157370_11623581 | 3300013104 | Unclassified | 581 |
| 196 | Ga0157369_10004638 | 3300013105 | Bacteria | 16148 |
| 197 | Ga0157369_10033746 | 3300013105 | Bacteria | 5621 |
| 198 | Ga0157369_10157491 | 3300013105 | Bacteria | 2398 |
| 199 | Ga0157369_10242494 | 3300013105 | Bacteria | 1882 |
| 200 | Ga0157369_10595136 | 3300013105 | Bacteria | 1142 |
| 201 | Ga0157369_11533474 | 3300013105 | Bacteria | 678 |
| 202 | Ga0157369_12575534 | 3300013105 | Bacteria | 514 |
| 203 | Ga0157374_10030570 | 3300013296 | Bacteria | 4892 |
| 204 | Ga0157374_12492985 | 3300013296 | Unclassified | 545 |
| 205 | Ga0157374_12962595 | 3300013296 | Unclassified | 502 |
| 206 | Ga0157378_10229478 | 3300013297 | Bacteria | 1768 |
| 207 | Ga0157378_10291716 | 3300013297 | Bacteria | 1576 |
| 208 | Ga0157378_10293253 | 3300013297 | Bacteria | 1572 |
| 209 | Ga0157378_10440451 | 3300013297 | Bacteria | 1291 |
| 210 | Ga0157378_11981799 | 3300013297 | Bacteria | 632 |
| 211 | Ga0157378_12452433 | 3300013297 | Bacteria | 573 |
| 212 | Ga0157378_12720737 | 3300013297 | Bacteria | 547 |
| 213 | Ga0163162_12618686 | 3300013306 | Bacteria | 580 |
| 214 | Ga0157372_10601174 | 3300013307 | Bacteria | 1282 |
| 215 | Ga0157372_11008767 | 3300013307 | Bacteria | 964 |
| 216 | Ga0157372_11118920 | 3300013307 | Bacteria | 911 |
| 217 | Ga0157372_11216088 | 3300013307 | Bacteria | 870 |
| 218 | Ga0157372_11804768 | 3300013307 | Unclassified | 703 |
| 219 | Ga0157372_12231672 | 3300013307 | Unclassified | 629 |
| 220 | Ga0157375_10103709 | 3300013308 | Bacteria | 2931 |
| 221 | Ga0157375_11184528 | 3300013308 | Bacteria | 896 |
| 222 | Ga0163163_10753571 | 3300014325 | Bacteria | 1037 |
| 223 | Ga0163163_12159637 | 3300014325 | Unclassified | 616 |
| 224 | Ga0157379_10194166 | 3300014968 | Bacteria | 1835 |
| 225 | Ga0157379_11081170 | 3300014968 | Bacteria | 768 |
| 226 | Ga0157376_10087903 | 3300014969 | Bacteria | 2683 |
| 227 | Ga0157376_10108272 | 3300014969 | Bacteria | 2441 |
| 228 | Ga0157376_10437357 | 3300014969 | Bacteria | 1273 |
| 229 | Ga0157376_11222967 | 3300014969 | Bacteria | 780 |
| 230 | Ga0157376_12397327 | 3300014969 | Bacteria | 567 |
| 231 | Ga0197907_10880964 | 3300020069 | Unclassified | 925 |
| 232 | Ga0206356_10096870 | 3300020070 | Bacteria | 954 |
| 233 | Ga0206356_10970685 | 3300020070 | Bacteria | 859 |
| 234 | Ga0206356_11605749 | 3300020070 | Bacteria | 509 |
| 235 | Ga0206352_10076272 | 3300020078 | Bacteria | 16136 |
| 236 | Ga0206352_10460690 | 3300020078 | Bacteria | 575 |
| 237 | Ga0206352_11128396 | 3300020078 | Bacteria | 2195 |
| 238 | Ga0206350_11563687 | 3300020080 | Bacteria | 618 |
| 239 | Ga0206354_10778596 | 3300020081 | Bacteria | 1095 |
| 240 | Ga0206353_11142864 | 3300020082 | Bacteria | 840 |
| 241 | Ga0213874_10048447 | 3300021377 | Bacteria | 1296 |
| 242 | Ga0213876_10441877 | 3300021384 | Bacteria | 692 |
| 243 | Ga0213875_10005759 | 3300021388 | Bacteria | 6598 |
| 244 | Ga0213875_10045320 | 3300021388 | Bacteria | 2064 |
| 245 | Ga0213875_10069891 | 3300021388 | Bacteria | 1639 |
| 246 | Ga0213875_10197171 | 3300021388 | Bacteria | 947 |
| 247 | Ga0213875_10333567 | 3300021388 | Bacteria | 719 |
| 248 | Ga0224712_10486813 | 3300022467 | Bacteria | 595 |
| 249 | Ga0224712_10543632 | 3300022467 | Bacteria | 564 |
| 250 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 251 | Ga0207656_10510455 | 3300025321 | Bacteria | 611 |
| 252 | Ga0207642_10184590 | 3300025899 | Bacteria | 1139 |
| 253 | Ga0207680_10019671 | 3300025903 | Bacteria | 3615 |
| 254 | Ga0207647_10010255 | 3300025904 | Bacteria | 6620 |
| 255 | Ga0207647_10181916 | 3300025904 | Bacteria | 1220 |
| 256 | Ga0207699_10205929 | 3300025906 | Bacteria | 1335 |
| 257 | Ga0207705_10001453 | 3300025909 | Bacteria | 18913 |
| 258 | Ga0207705_10057980 | 3300025909 | Bacteria | 2794 |
| 259 | Ga0207654_10041690 | 3300025911 | Bacteria | 2594 |
| 260 | Ga0207654_10463730 | 3300025911 | Bacteria | 890 |
| 261 | Ga0207654_10648728 | 3300025911 | Unclassified | 756 |
| 262 | Ga0207654_11134319 | 3300025911 | Bacteria | 570 |
| 263 | Ga0207654_11454183 | 3300025911 | Bacteria | 500 |
| 264 | Ga0207707_10063636 | 3300025912 | Bacteria | 3211 |
| 265 | Ga0207707_10113466 | 3300025912 | Bacteria | 2368 |
| 266 | Ga0207707_10173157 | 3300025912 | Bacteria | 1886 |
| 267 | Ga0207707_10347458 | 3300025912 | Bacteria | 1278 |
| 268 | Ga0207707_10419917 | 3300025912 | Bacteria | 1147 |
| 269 | Ga0207695_10008431 | 3300025913 | Bacteria | 12906 |
| 270 | Ga0207695_10140217 | 3300025913 | Bacteria | 2367 |
| 271 | Ga0207695_10342860 | 3300025913 | Bacteria | 1382 |
| 272 | Ga0207695_11030362 | 3300025913 | Unclassified | 703 |
| 273 | Ga0207671_10001074 | 3300025914 | Bacteria | 33173 |
| 274 | Ga0207671_10017757 | 3300025914 | Bacteria | 5476 |
| 275 | Ga0207671_10055914 | 3300025914 | Bacteria | 2924 |
| 276 | Ga0207671_10060155 | 3300025914 | Bacteria | 2818 |
| 277 | Ga0207671_10094035 | 3300025914 | Bacteria | 2262 |
| 278 | Ga0207671_10300698 | 3300025914 | Bacteria | 1268 |
| 279 | Ga0207671_11025134 | 3300025914 | Bacteria | 650 |
| 280 | Ga0207663_10640053 | 3300025916 | Bacteria | 838 |
| 281 | Ga0207657_10008060 | 3300025919 | Bacteria | 10742 |
| 282 | Ga0207657_10050665 | 3300025919 | Bacteria | 3613 |
| 283 | Ga0207657_10063775 | 3300025919 | Bacteria | 3148 |
| 284 | Ga0207657_10331518 | 3300025919 | Bacteria | 1202 |
| 285 | Ga0207649_10032767 | 3300025920 | Bacteria | 3100 |
| 286 | Ga0207649_10696864 | 3300025920 | Unclassified | 787 |
| 287 | Ga0207652_10096220 | 3300025921 | Bacteria | 2608 |
| 288 | Ga0207652_10228861 | 3300025921 | Bacteria | 1675 |
| 289 | Ga0207652_10279989 | 3300025921 | Bacteria | 1504 |
| 290 | Ga0207652_10369965 | 3300025921 | Bacteria | 1294 |
| 291 | Ga0207652_11325523 | 3300025921 | Bacteria | 623 |
| 292 | Ga0207694_10464431 | 3300025924 | Bacteria | 1058 |
| 293 | Ga0207694_10520951 | 3300025924 | Bacteria | 996 |
| 294 | Ga0207694_10573243 | 3300025924 | Bacteria | 948 |
| 295 | Ga0207687_10194230 | 3300025927 | Bacteria | 1582 |
| 296 | Ga0207687_10402687 | 3300025927 | Bacteria | 1126 |
| 297 | Ga0207700_10072432 | 3300025928 | Bacteria | 2657 |
| 298 | Ga0207700_10710310 | 3300025928 | Bacteria | 897 |
| 299 | Ga0207664_10726910 | 3300025929 | Bacteria | 893 |
| 300 | Ga0207644_10291825 | 3300025931 | Bacteria | 1312 |
| 301 | Ga0207690_10120468 | 3300025932 | Bacteria | 1905 |
| 302 | Ga0207690_10172572 | 3300025932 | Bacteria | 1621 |
| 303 | Ga0207690_10268939 | 3300025932 | Bacteria | 1323 |
| 304 | Ga0207690_10340918 | 3300025932 | Bacteria | 1183 |
| 305 | Ga0207706_11397236 | 3300025933 | Unclassified | 575 |
| 306 | Ga0207686_10311570 | 3300025934 | Bacteria | 1173 |
| 307 | Ga0207686_10462219 | 3300025934 | Bacteria | 978 |
| 308 | Ga0207709_10108056 | 3300025935 | Bacteria | 1854 |
| 309 | Ga0207704_10233860 | 3300025938 | Bacteria | 1368 |
| 310 | Ga0207665_10968425 | 3300025939 | Bacteria | 676 |
| 311 | Ga0207691_10540892 | 3300025940 | Bacteria | 988 |
| 312 | Ga0207711_10071486 | 3300025941 | Bacteria | 3010 |
| 313 | Ga0207711_10091511 | 3300025941 | Bacteria | 2676 |
| 314 | Ga0207711_10132896 | 3300025941 | Bacteria | 2233 |
| 315 | Ga0207711_10306669 | 3300025941 | Bacteria | 1465 |
| 316 | Ga0207711_11572745 | 3300025941 | Bacteria | 601 |
| 317 | Ga0207689_10111916 | 3300025942 | Bacteria | 2244 |
| 318 | Ga0207661_10225484 | 3300025944 | Bacteria | 1658 |
| 319 | Ga0207679_10547783 | 3300025945 | Bacteria | 1038 |
| 320 | Ga0207667_10002756 | 3300025949 | Bacteria | 21724 |
| 321 | Ga0207667_10068480 | 3300025949 | Bacteria | 3696 |
| 322 | Ga0207667_10114447 | 3300025949 | Bacteria | 2780 |
| 323 | Ga0207667_10148768 | 3300025949 | Bacteria | 2410 |
| 324 | Ga0207667_10436094 | 3300025949 | Unclassified | 1332 |
| 325 | Ga0207667_11387472 | 3300025949 | Bacteria | 676 |
| 326 | Ga0207667_11535863 | 3300025949 | Unclassified | 636 |
| 327 | Ga0207651_11845809 | 3300025960 | Bacteria | 544 |
| 328 | Ga0207640_10631814 | 3300025981 | Bacteria | 910 |
| 329 | Ga0207640_10670427 | 3300025981 | Bacteria | 886 |
| 330 | Ga0207640_11152549 | 3300025981 | Bacteria | 688 |
| 331 | Ga0207658_10055258 | 3300025986 | Bacteria | 2942 |
| 332 | Ga0207658_10437822 | 3300025986 | Bacteria | 1155 |
| 333 | Ga0207658_10560801 | 3300025986 | Bacteria | 1023 |
| 334 | Ga0207658_11235217 | 3300025986 | Bacteria | 683 |
| 335 | Ga0207677_10483582 | 3300026023 | Bacteria | 1067 |
| 336 | Ga0207703_10019029 | 3300026035 | Bacteria | 5364 |
| 337 | Ga0207703_10064766 | 3300026035 | Bacteria | 3001 |
| 338 | Ga0207703_10272200 | 3300026035 | Bacteria | 1535 |
| 339 | Ga0207639_10058554 | 3300026041 | Bacteria | 2964 |
| 340 | Ga0207639_10105527 | 3300026041 | Bacteria | 2286 |
| 341 | Ga0207639_10956554 | 3300026041 | Bacteria | 801 |
| 342 | Ga0207639_10992341 | 3300026041 | Bacteria | 786 |
| 343 | Ga0207639_11019033 | 3300026041 | Bacteria | 776 |
| 344 | Ga0207678_10009839 | 3300026067 | Bacteria | 8402 |
| 345 | Ga0207678_10022593 | 3300026067 | Bacteria | 5509 |
| 346 | Ga0207678_10590067 | 3300026067 | Bacteria | 974 |
| 347 | Ga0207702_10007772 | 3300026078 | Bacteria | 9104 |
| 348 | Ga0207702_10015414 | 3300026078 | Bacteria | 6331 |
| 349 | Ga0207702_10030901 | 3300026078 | Bacteria | 4463 |
| 350 | Ga0207702_10043789 | 3300026078 | Bacteria | 3760 |
| 351 | Ga0207702_10228952 | 3300026078 | Bacteria | 1736 |
| 352 | Ga0207702_10499911 | 3300026078 | Bacteria | 1185 |
| 353 | Ga0207702_11160057 | 3300026078 | Unclassified | 767 |
| 354 | Ga0207702_11426348 | 3300026078 | Bacteria | 686 |
| 355 | Ga0207641_10011436 | 3300026088 | Bacteria | 7285 |
| 356 | Ga0207641_10023693 | 3300026088 | Bacteria | 5058 |
| 357 | Ga0207641_10197637 | 3300026088 | Bacteria | 1852 |
| 358 | Ga0207648_10308547 | 3300026089 | Bacteria | 1420 |
| 359 | Ga0207676_10009610 | 3300026095 | Bacteria | 6885 |
| 360 | Ga0207676_10086376 | 3300026095 | Bacteria | 2563 |
| 361 | Ga0207676_10351270 | 3300026095 | Bacteria | 1364 |
| 362 | Ga0207676_10600908 | 3300026095 | Bacteria | 1057 |
| 363 | Ga0207674_10013233 | 3300026116 | Bacteria | 9170 |
| 364 | Ga0207674_12021362 | 3300026116 | Bacteria | 541 |
| 365 | Ga0207674_12125202 | 3300026116 | Bacteria | 525 |
| 366 | Ga0207698_10077237 | 3300026142 | Bacteria | 2669 |
| 367 | Ga0207698_12275662 | 3300026142 | Bacteria | 554 |
| 368 | Ga0268266_10000321 | 3300028379 | Bacteria | 75565 |
| 369 | Ga0268266_10370969 | 3300028379 | Bacteria | 1348 |
| 370 | Ga0268266_10561309 | 3300028379 | Bacteria | 1094 |
| 371 | Ga0268266_11727742 | 3300028379 | Bacteria | 601 |
| 372 | Ga0268264_10060239 | 3300028381 | Bacteria | 3181 |
| 373 | Ga0268264_10571705 | 3300028381 | Bacteria | 1111 |
| 374 | Ga0268264_10951624 | 3300028381 | Bacteria | 864 |
| 375 | Ga0265326_10054192 | 3300028558 | Bacteria | 1135 |
| 376 | Ga0265318_10068893 | 3300028577 | Bacteria | 1312 |
| 377 | Ga0307515_10201561 | 3300028794 | Bacteria | 1864 |
| 378 | Ga0265338_10097186 | 3300028800 | Bacteria | 2414 |
| 379 | Ga0265762_1080043 | 3300030760 | Bacteria | 698 |
| 380 | Ga0265760_10157730 | 3300031090 | Bacteria | 747 |
| 381 | Ga0265320_10021417 | 3300031240 | Bacteria | 3477 |
| 382 | Ga0265325_10234454 | 3300031241 | Bacteria | 836 |
| 383 | Ga0265339_10141364 | 3300031249 | Bacteria | 1224 |
| 384 | Ga0265331_10077798 | 3300031250 | Bacteria | 1545 |
| 385 | Ga0307513_10343349 | 3300031456 | Bacteria | 1243 |
| 386 | Ga0265313_10171480 | 3300031595 | Bacteria | 916 |
| 387 | Ga0265313_10245930 | 3300031595 | Bacteria | 731 |
| 388 | Ga0265314_10009286 | 3300031711 | Bacteria | 8330 |
| 389 | Ga0265314_10077276 | 3300031711 | Bacteria | 2209 |
| 390 | Ga0265314_10272587 | 3300031711 | Bacteria | 961 |
| 391 | Ga0265342_10052436 | 3300031712 | Bacteria | 2431 |
| 392 | Ga0265342_10064957 | 3300031712 | Bacteria | 2140 |
| 393 | Ga0307413_10578933 | 3300031824 | Bacteria | 915 |
| 394 | Ga0307406_10024184 | 3300031901 | Bacteria | 3625 |
| 395 | Ga0307412_12193671 | 3300031911 | Bacteria | 514 |
| 396 | Ga0307409_100451110 | 3300031995 | Bacteria | 1241 |
| 397 | Ga0307414_10861318 | 3300032004 | Bacteria | 829 |
| 398 | Ga0307414_11022067 | 3300032004 | Bacteria | 761 |
| 399 | Ga0307414_11171071 | 3300032004 | Bacteria | 711 |
| 400 | Ga0316586_1005355 | 3300033527 | Bacteria | 1799 |
| 401 | Ga0373930_0058782 | 3300034816 | Bacteria | 854 |
| 402 | Ga0373926_0106121 | 3300035083 | Bacteria | 1053 |
| 403 | Ga0373926_0115693 | 3300035083 | Bacteria | 1009 |
| 404 | Ga0373941_0314050 | 3300035115 | Bacteria | 629 |
| 405 | Ga0373943_0037025 | 3300035170 | Bacteria | 2340 |
| 406 | Ga0373946_0024372 | 3300035171 | Bacteria | 2371 |
| 407 | Ga0373931_1123457 | 3300035691 | Bacteria | 536 |
| 408 | Ga0373927_0022764 | 3300035695 | Bacteria | 4103 |
| 409 | Ga0373927_0036356 | 3300035695 | Bacteria | 3203 |
| 410 | Ga0373947_0013403 | 3300035725 | Bacteria | 4698 |
| 411 | Ga0373947_1252674 | 3300035725 | Bacteria | 505 |
| 412 | Ga0373937_0111079 | 3300036401 | Bacteria | 2550 |
| 413 | Ga0373937_0677496 | 3300036401 | Bacteria | 977 |
| 414 | Ga0373937_2127687 | 3300036401 | Unclassified | 507 |
| 415 | Ga0316584_0652921 | 3300036712 | Bacteria | 725 |
| 416 | Ga0373925_0007421 | 3300037068 | Bacteria | 8000 |
| 417 | Ga0373925_0757100 | 3300037068 | Bacteria | 801 |
| 418 | Ga0373925_0810765 | 3300037068 | Bacteria | 772 |
| 419 | Ga0373925_0935393 | 3300037068 | Bacteria | 714 |
| 420 | Ga0395900_0619767 | 3300037418 | Unclassified | 1021 |
| 421 | Ga0395898_0536997 | 3300037466 | Bacteria | 1111 |
| 422 | Ga0395905_0286632 | 3300037471 | Bacteria | 1534 |
| 423 | Ga0395905_0668455 | 3300037471 | Bacteria | 941 |
| 424 | Ga0436364_0026865 | 3300037853 | Bacteria | 1683 |
| 425 | Ga0436364_0125100 | 3300037853 | Bacteria | 1115 |
| 426 | Ga0436364_0240413 | 3300037853 | Bacteria | 9540 |
| 427 | Ga0436364_0419855 | 3300037853 | Bacteria | 847 |
| 428 | Ga0436364_0578648 | 3300037853 | Unclassified | 610 |
| 429 | Ga0436364_0894178 | 3300037853 | Bacteria | 2420 |
| 430 | Ga0436364_1006134 | 3300037853 | Bacteria | 1482 |
| 431 | Ga0436364_1054367 | 3300037853 | Bacteria | 18076 |
| 432 | Ga0436364_1121262 | 3300037853 | Bacteria | 32436 |
| 433 | Ga0436364_1393988 | 3300037853 | Bacteria | 3361 |
| 434 | Ga0436364_1400193 | 3300037853 | Bacteria | 4067 |
| 435 | Ga0395901_0291374 | 3300038443 | Bacteria | 1694 |
| 436 | Ga0436365_0140127 | 3300039437 | Bacteria | 1319 |
| 437 | Ga0436365_0200225 | 3300039437 | Bacteria | 757 |
| 438 | Ga0436365_0821682 | 3300039437 | Bacteria | 7072 |
| 439 | Ga0436365_1262762 | 3300039437 | Bacteria | 8818 |
| 440 | Ga0436365_1721656 | 3300039437 | Bacteria | 756 |
| 441 | Ga0436365_1887503 | 3300039437 | Bacteria | 769 |
| 442 | Ga0436360_0584444 | 3300039438 | Bacteria | 1690 |
| 443 | Ga0436360_1049432 | 3300039438 | Bacteria | 686 |
| 444 | Ga0436363_0345243 | 3300039450 | Bacteria | 1374 |
| 445 | Ga0436363_0431750 | 3300039450 | Unclassified | 1120 |
| 446 | Ga0436363_1096749 | 3300039450 | Bacteria | 571 |
| 447 | Ga0436363_1351619 | 3300039450 | Bacteria | 2929 |
| 448 | Ga0436363_1621856 | 3300039450 | Bacteria | 1096 |
| 449 | Ga0436362_0534029 | 3300039453 | Bacteria | 1505 |
| 450 | Ga0451787_123607 | 3300041441 | Bacteria | 651 |
| 451 | Ga0451787_300709 | 3300041441 | Bacteria | 800 |
| 452 | Ga0451787_315941 | 3300041441 | Bacteria | 728 |
| 453 | Ga0451795_0769616 | 3300041456 | Bacteria | 1150 |
| 454 | Ga0451808_34490 | 3300041464 | Bacteria | 611 |
| 455 | Ga0451807_0475875 | 3300041486 | Unclassified | 621 |
| 456 | Ga0451841_0349496 | 3300041498 | Bacteria | 793 |
| 457 | Ga0451855_0059144 | 3300041511 | Bacteria | 905 |
| 458 | Ga0451853_0975994 | 3300041512 | Bacteria | 917 |
| 459 | Ga0439431_0029306 | 3300041997 | Bacteria | 1359 |
| 460 | Ga0451577_1562387 | 3300042876 | Bacteria | 583 |
| 461 | Ga0466969_0558443 | 3300044656 | Bacteria | 524 |
| 462 | Ga0466965_0819667 | 3300044683 | Bacteria | 539 |
| 463 | Ga0466966_0017481 | 3300044684 | Bacteria | 4737 |
| 464 | Ga0466961_0260078 | 3300044693 | Bacteria | 1064 |
| 465 | Ga0466961_0277874 | 3300044693 | Bacteria | 1025 |
| 466 | Ga0466961_0280150 | 3300044693 | Bacteria | 1020 |
| 467 | Ga0466961_0388179 | 3300044693 | Bacteria | 848 |
| 468 | Ga0466963_0565210 | 3300044694 | Bacteria | 803 |
| 469 | Ga0466963_1331630 | 3300044694 | Unclassified | 504 |
| 470 | Ga0453684_0464818 | 3300044712 | Bacteria | 1406 |
| 471 | Ga0466970_0206926 | 3300044765 | Bacteria | 1092 |
| 472 | Ga0466970_0581394 | 3300044765 | Bacteria | 649 |
| 473 | Ga0466970_0745036 | 3300044765 | Bacteria | 572 |
| 474 | Ga0466957_0963322 | 3300044842 | Bacteria | 612 |
| 475 | Ga0466959_0072475 | 3300045049 | Bacteria | 2493 |
| 476 | Ga0466958_0050425 | 3300045836 | Bacteria | 2520 |
| 477 | Ga0466958_0230842 | 3300045836 | Bacteria | 1182 |
| 478 | Ga0466967_0169278 | 3300045976 | Bacteria | 2055 |
| 479 | Ga0466967_0610353 | 3300045976 | Bacteria | 1077 |
| 480 | Ga0466967_0703486 | 3300045976 | Bacteria | 1001 |
| 481 | Ga0495580_0035122 | 3300046472 | Bacteria | 3605 |
| 482 | Ga0495580_0303839 | 3300046472 | Bacteria | 1086 |
| 483 | Ga0495582_0270634 | 3300046473 | Bacteria | 975 |
| 484 | Ga0495666_0398497 | 3300046526 | Bacteria | 618 |
| 485 | Ga0495665_0058621 | 3300046531 | Bacteria | 2033 |
| 486 | Ga0495665_0465519 | 3300046531 | Bacteria | 638 |
| 487 | Ga0495645_0589234 | 3300046543 | Bacteria | 685 |
| 488 | Ga0495656_0648452 | 3300046615 | Bacteria | 567 |
| 489 | Ga0495635_0115216 | 3300046663 | Bacteria | 1835 |
| 490 | Ga0495658_0183328 | 3300046683 | Bacteria | 1299 |
| 491 | Ga0495624_0677555 | 3300046690 | Bacteria | 613 |
| 492 | Ga0495670_0163925 | 3300046691 | Bacteria | 1168 |
| 493 | Ga0495636_0199904 | 3300047318 | Bacteria | 912 |
| 494 | Ga0495593_0124579 | 3300047673 | Bacteria | 1310 |
| 495 | Ga0495602_1066728 | 3300048088 | Unclassified | 531 |
| 496 | Ga0496101_0374400 | 3300048904 | Bacteria | 1120 |
| 497 | Ga0496105_0502990 | 3300048908 | Bacteria | 951 |
| 498 | Ga0496106_0930185 | 3300048909 | Bacteria | 686 |
| 499 | Ga0496106_1202591 | 3300048909 | Unclassified | 591 |
| 500 | Ga0496107_1357773 | 3300048910 | Unclassified | 507 |
| 501 | Ga0496110_0497506 | 3300048913 | Bacteria | 1110 |
| 502 | Ga0496111_0048615 | 3300048914 | Bacteria | 3056 |
| 503 | Ga0496112_0008575 | 3300048915 | Bacteria | 9163 |
| 504 | Ga0496115_0011601 | 3300048918 | Bacteria | 6609 |
| 505 | Ga0496115_0035714 | 3300048918 | Bacteria | 3934 |
| 506 | Ga0496116_0146828 | 3300048919 | Bacteria | 1317 |
| 507 | Ga0496118_0109853 | 3300048921 | Bacteria | 1834 |
| 508 | Ga0496118_0221485 | 3300048921 | Bacteria | 1101 |
| 509 | Ga0496118_0319084 | 3300048921 | Bacteria | 844 |
| 510 | Ga0496122_0294434 | 3300048925 | Bacteria | 879 |
| 511 | Ga0496124_0835150 | 3300048927 | Bacteria | 566 |
| 512 | Ga0496125_0000815 | 3300048928 | Bacteria | 50702 |
| 513 | Ga0501319_015186 | 3300049535 | Bacteria | 652 |
| 514 | Ga0501031_0554376 | 3300049568 | Bacteria | 740 |
| 515 | Ga0501032_0276586 | 3300049569 | Bacteria | 1087 |
| 516 | Ga0501033_0837683 | 3300049570 | Bacteria | 620 |
| 517 | Ga0501034_0010656 | 3300049571 | Bacteria | 9554 |
| 518 | Ga0501034_0058419 | 3300049571 | Bacteria | 3877 |
| 519 | Ga0501037_0052409 | 3300049573 | Bacteria | 2984 |
| 520 | Ga0501038_0006023 | 3300049574 | Bacteria | 11222 |
| 521 | Ga0501043_0105319 | 3300049579 | Bacteria | 2216 |
| 522 | Ga0501046_0318591 | 3300049580 | Bacteria | 1133 |
| 523 | Ga0501046_0926196 | 3300049580 | Bacteria | 607 |
| 524 | Ga0501047_0038476 | 3300049581 | Bacteria | 4628 |
| 525 | Ga0501048_0086023 | 3300049582 | Bacteria | 2218 |
| 526 | Ga0501070_0006487 | 3300049586 | Bacteria | 9959 |
| 527 | Ga0501073_0198962 | 3300049589 | Bacteria | 1386 |
| 528 | Ga0501074_0043689 | 3300049590 | Bacteria | 3244 |
| 529 | Ga0501256_022223 | 3300049685 | Unclassified | 673 |
| 530 | Ga0501080_0070674 | 3300049742 | Bacteria | 3247 |
| 531 | Ga0501080_1627891 | 3300049742 | Bacteria | 546 |
| 532 | Ga0501083_0160511 | 3300049744 | Bacteria | 1471 |
| 533 | Ga0501035_0028540 | 3300049822 | Bacteria | 5093 |
| 534 | Ga0501044_0010929 | 3300049823 | Bacteria | 9853 |
| 535 | Ga0501044_0073393 | 3300049823 | Bacteria | 3478 |
| 536 | nmdc:mga0yw44_852520_c1 | 3300050492 | Bacteria | 618 |
| 537 | nmdc:mga05p37_221970_c1 | 3300050507 | Bacteria | 2280 |
| 538 | nmdc:mga0qj67_136084_c1 | 3300050509 | Bacteria | 1991 |
| 539 | nmdc:mga06r32_10773_c1 | 3300050510 | Bacteria | 8236 |
| 540 | nmdc:mga0n895_398993_c1 | 3300050512 | Unclassified | 1391 |
| 541 | Ga0495601_0311785 | 3300053077 | Bacteria | 1025 |
| 542 | Ga0495619_1097865 | 3300053085 | Bacteria | 529 |
| 543 | Ga0500568_0002264 | 3300053139 | Bacteria | 11497 |
| 544 | Ga0500604_0069550 | 3300053151 | Bacteria | 1120 |
| 545 | Ga0587093_084890 | 3300059478 | Bacteria | 551 |
| 546 | Ga0587088_015178 | 3300059508 | Bacteria | 1210 |
| 547 | Ga0587072_003068 | 3300059643 | Bacteria | 2312 |
| 548 | Ga0587072_014285 | 3300059643 | Bacteria | 1336 |
| 549 | Ga0501082_0000322 | 3300060353 | Bacteria | 42523 |
| 550 | Ga0466962_0194683 | 3300061719 | Bacteria | 989 |
| 551 | Ga0466962_0441157 | 3300061719 | Bacteria | 655 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0926196 | Ga0501046_0926196_164_490 | 83 |
| 2 | 3300026095 | Ga0207676_10351270 | Ga0207676_103512702 | 84 |
| 3 | 3300005347 | Ga0070668_102193671 | Ga0070668_1021936711 | 91 |
| 4 | 3300005459 | Ga0068867_101081994 | Ga0068867_1010819942 | 91 |
| 5 | 3300005719 | Ga0068861_100405337 | Ga0068861_1004053372 | 91 |
| 6 | 3300005842 | Ga0068858_100423960 | Ga0068858_1004239602 | 91 |
| 7 | 3300005843 | Ga0068860_100755757 | Ga0068860_1007557572 | 91 |
| 8 | 3300009551 | Ga0105238_11278296 | Ga0105238_112782962 | 91 |
| 9 | 3300010375 | Ga0105239_11032254 | Ga0105239_110322542 | 91 |
| 10 | 3300013308 | Ga0157375_11184528 | Ga0157375_111845282 | 91 |
| 11 | 3300026035 | Ga0207703_10272200 | Ga0207703_102722002 | 91 |
| 12 | 3300026041 | Ga0207639_10058554 | Ga0207639_100585541 | 91 |
| 13 | 3300005367 | Ga0070667_100639646 | Ga0070667_1006396461 | 92 |
| 14 | 3300005548 | Ga0070665_100138657 | Ga0070665_1001386575 | 92 |
| 15 | 3300009093 | Ga0105240_11022151 | Ga0105240_110221511 | 92 |
| 16 | 3300025986 | Ga0207658_10560801 | Ga0207658_105608012 | 92 |
| 17 | 3300028379 | Ga0268266_10561309 | Ga0268266_105613092 | 92 |
| 18 | 3300031712 | Ga0265342_10064957 | Ga0265342_100649572 | 92 |
| 19 | 3300013296 | Ga0157374_12962595 | Ga0157374_129625952 | 93 |
| 20 | 3300042876 | Ga0451577_1562387 | Ga0451577_1562387_151_531 | 93 |
| 21 | 3300005367 | Ga0070667_100295936 | Ga0070667_1002959362 | 96 |
| 22 | 3300005614 | Ga0068856_100528183 | Ga0068856_1005281833 | 96 |
| 23 | 3300005842 | Ga0068858_100030046 | Ga0068858_1000300466 | 96 |
| 24 | 3300005843 | Ga0068860_100930917 | Ga0068860_1009309172 | 96 |
| 25 | 3300006237 | Ga0097621_100314685 | Ga0097621_1003146852 | 96 |
| 26 | 3300006358 | Ga0068871_100193630 | Ga0068871_1001936303 | 96 |
| 27 | 3300006358 | Ga0068871_101131592 | Ga0068871_1011315922 | 96 |
| 28 | 3300009098 | Ga0105245_10510093 | Ga0105245_105100932 | 96 |
| 29 | 3300009177 | Ga0105248_10964423 | Ga0105248_109644232 | 96 |
| 30 | 3300009177 | Ga0105248_12890939 | Ga0105248_128909391 | 96 |
| 31 | 3300013297 | Ga0157378_10229478 | Ga0157378_102294781 | 96 |
| 32 | 3300013297 | Ga0157378_10440451 | Ga0157378_104404512 | 96 |
| 33 | 3300013297 | Ga0157378_12720737 | Ga0157378_127207372 | 96 |
| 34 | 3300014968 | Ga0157379_10194166 | Ga0157379_101941662 | 96 |
| 35 | 3300020080 | Ga0206350_11563687 | Ga0206350_115636872 | 96 |
| 36 | 3300021388 | Ga0213875_10197171 | Ga0213875_101971712 | 96 |
| 37 | 3300025927 | Ga0207687_10402687 | Ga0207687_104026872 | 96 |
| 38 | 3300025941 | Ga0207711_10132896 | Ga0207711_101328965 | 96 |
| 39 | 3300025941 | Ga0207711_11572745 | Ga0207711_115727452 | 96 |
| 40 | 3300025986 | Ga0207658_11235217 | Ga0207658_112352172 | 96 |
| 41 | 3300026035 | Ga0207703_10019029 | Ga0207703_100190298 | 96 |
| 42 | 3300026078 | Ga0207702_10228952 | Ga0207702_102289522 | 96 |
| 43 | 3300028381 | Ga0268264_10571705 | Ga0268264_105717052 | 96 |
| 44 | 3300037853 | Ga0436364_0125100 | Ga0436364_0125100_77_394 | 96 |
| 45 | 3300039437 | Ga0436365_0140127 | Ga0436365_0140127_678_995 | 96 |
| 46 | 3300046690 | Ga0495624_0677555 | Ga0495624_0677555_76_444 | 96 |
| 47 | 3300048909 | Ga0496106_0930185 | Ga0496106_0930185_178_546 | 96 |
| 48 | 3300005330 | Ga0070690_101445468 | Ga0070690_1014454681 | 97 |
| 49 | 3300005335 | Ga0070666_10102938 | Ga0070666_101029384 | 97 |
| 50 | 3300005338 | Ga0068868_100058678 | Ga0068868_1000586784 | 97 |
| 51 | 3300005339 | Ga0070660_101227988 | Ga0070660_1012279881 | 97 |
| 52 | 3300005355 | Ga0070671_100981568 | Ga0070671_1009815682 | 97 |
| 53 | 3300005367 | Ga0070667_100096799 | Ga0070667_1000967994 | 97 |
| 54 | 3300005445 | Ga0070708_100631194 | Ga0070708_1006311942 | 97 |
| 55 | 3300005457 | Ga0070662_100505982 | Ga0070662_1005059822 | 97 |
| 56 | 3300005458 | Ga0070681_10084584 | Ga0070681_100845842 | 97 |
| 57 | 3300005458 | Ga0070681_11147217 | Ga0070681_111472171 | 97 |
| 58 | 3300005458 | Ga0070681_12032957 | Ga0070681_120329571 | 97 |
| 59 | 3300005459 | Ga0068867_100068643 | Ga0068867_1000686433 | 97 |
| 60 | 3300005471 | Ga0070698_101840179 | Ga0070698_1018401791 | 97 |
| 61 | 3300005530 | Ga0070679_100030062 | Ga0070679_1000300626 | 97 |
| 62 | 3300005530 | Ga0070679_101313670 | Ga0070679_1013136702 | 97 |
| 63 | 3300005535 | Ga0070684_100337792 | Ga0070684_1003377922 | 97 |
| 64 | 3300005539 | Ga0068853_100330010 | Ga0068853_1003300102 | 97 |
| 65 | 3300005547 | Ga0070693_101072952 | Ga0070693_1010729522 | 97 |
| 66 | 3300005548 | Ga0070665_100217892 | Ga0070665_1002178922 | 97 |
| 67 | 3300005548 | Ga0070665_101133462 | Ga0070665_1011334622 | 97 |
| 68 | 3300005563 | Ga0068855_100135013 | Ga0068855_1001350135 | 97 |
| 69 | 3300005563 | Ga0068855_100811778 | Ga0068855_1008117782 | 97 |
| 70 | 3300005577 | Ga0068857_100839846 | Ga0068857_1008398462 | 97 |
| 71 | 3300005577 | Ga0068857_101465735 | Ga0068857_1014657352 | 97 |
| 72 | 3300005614 | Ga0068856_100073064 | Ga0068856_1000730642 | 97 |
| 73 | 3300005614 | Ga0068856_100326750 | Ga0068856_1003267504 | 97 |
| 74 | 3300005618 | Ga0068864_100018412 | Ga0068864_1000184126 | 97 |
| 75 | 3300005618 | Ga0068864_100429064 | Ga0068864_1004290641 | 97 |
| 76 | 3300005718 | Ga0068866_10164217 | Ga0068866_101642172 | 97 |
| 77 | 3300005841 | Ga0068863_100335315 | Ga0068863_1003353154 | 97 |
| 78 | 3300005841 | Ga0068863_101508729 | Ga0068863_1015087292 | 97 |
| 79 | 3300005842 | Ga0068858_100060954 | Ga0068858_1000609545 | 97 |
| 80 | 3300005843 | Ga0068860_100036229 | Ga0068860_1000362298 | 97 |
| 81 | 3300006237 | Ga0097621_100850574 | Ga0097621_1008505741 | 97 |
| 82 | 3300006358 | Ga0068871_100544580 | Ga0068871_1005445802 | 97 |
| 83 | 3300006358 | Ga0068871_100603408 | Ga0068871_1006034082 | 97 |
| 84 | 3300006881 | Ga0068865_100113414 | Ga0068865_1001134144 | 97 |
| 85 | 3300009093 | Ga0105240_11466362 | Ga0105240_114663622 | 97 |
| 86 | 3300009098 | Ga0105245_10234129 | Ga0105245_102341295 | 97 |
| 87 | 3300009098 | Ga0105245_10948397 | Ga0105245_109483972 | 97 |
| 88 | 3300009148 | Ga0105243_10207725 | Ga0105243_102077253 | 97 |
| 89 | 3300009148 | Ga0105243_10497711 | Ga0105243_104977112 | 97 |
| 90 | 3300009174 | Ga0105241_10017868 | Ga0105241_100178684 | 97 |
| 91 | 3300009174 | Ga0105241_10307637 | Ga0105241_103076373 | 97 |
| 92 | 3300009174 | Ga0105241_10641622 | Ga0105241_106416222 | 97 |
| 93 | 3300009174 | Ga0105241_12187915 | Ga0105241_121879152 | 97 |
| 94 | 3300009176 | Ga0105242_11356956 | Ga0105242_113569562 | 97 |
| 95 | 3300009176 | Ga0105242_11785462 | Ga0105242_117854622 | 97 |
| 96 | 3300009176 | Ga0105242_11843140 | Ga0105242_118431402 | 97 |
| 97 | 3300009177 | Ga0105248_10438568 | Ga0105248_104385684 | 97 |
| 98 | 3300009177 | Ga0105248_10611825 | Ga0105248_106118253 | 97 |
| 99 | 3300009545 | Ga0105237_10047955 | Ga0105237_100479559 | 97 |
| 100 | 3300009545 | Ga0105237_10284777 | Ga0105237_102847772 | 97 |
| 101 | 3300009545 | Ga0105237_10461628 | Ga0105237_104616282 | 97 |
| 102 | 3300009545 | Ga0105237_10739499 | Ga0105237_107394992 | 97 |
| 103 | 3300009551 | Ga0105238_10094337 | Ga0105238_100943377 | 97 |
| 104 | 3300009551 | Ga0105238_10636338 | Ga0105238_106363383 | 97 |
| 105 | 3300009551 | Ga0105238_10990376 | Ga0105238_109903762 | 97 |
| 106 | 3300009551 | Ga0105238_11221281 | Ga0105238_112212812 | 97 |
| 107 | 3300009551 | Ga0105238_11891438 | Ga0105238_118914381 | 97 |
| 108 | 3300010375 | Ga0105239_10592207 | Ga0105239_105922072 | 97 |
| 109 | 3300010375 | Ga0105239_11010016 | Ga0105239_110100162 | 97 |
| 110 | 3300010375 | Ga0105239_11070745 | Ga0105239_110707452 | 97 |
| 111 | 3300010375 | Ga0105239_11095099 | Ga0105239_110950992 | 97 |
| 112 | 3300010375 | Ga0105239_13382250 | Ga0105239_133822501 | 97 |
| 113 | 3300011119 | Ga0105246_10123544 | Ga0105246_101235442 | 97 |
| 114 | 3300013296 | Ga0157374_12492985 | Ga0157374_124929852 | 97 |
| 115 | 3300013297 | Ga0157378_10291716 | Ga0157378_102917163 | 97 |
| 116 | 3300013307 | Ga0157372_10601174 | Ga0157372_106011743 | 97 |
| 117 | 3300013307 | Ga0157372_11118920 | Ga0157372_111189202 | 97 |
| 118 | 3300013307 | Ga0157372_11216088 | Ga0157372_112160882 | 97 |
| 119 | 3300013308 | Ga0157375_10103709 | Ga0157375_101037095 | 97 |
| 120 | 3300014325 | Ga0163163_10753571 | Ga0163163_107535712 | 97 |
| 121 | 3300014325 | Ga0163163_12159637 | Ga0163163_121596372 | 97 |
| 122 | 3300014968 | Ga0157379_11081170 | Ga0157379_110811703 | 97 |
| 123 | 3300014969 | Ga0157376_11222967 | Ga0157376_112229672 | 97 |
| 124 | 3300020070 | Ga0206356_11605749 | Ga0206356_116057491 | 97 |
| 125 | 3300022467 | Ga0224712_10543632 | Ga0224712_105436322 | 97 |
| 126 | 3300025321 | Ga0207656_10510455 | Ga0207656_105104552 | 97 |
| 127 | 3300025899 | Ga0207642_10184590 | Ga0207642_101845902 | 97 |
| 128 | 3300025903 | Ga0207680_10019671 | Ga0207680_100196718 | 97 |
| 129 | 3300025904 | Ga0207647_10010255 | Ga0207647_100102552 | 97 |
| 130 | 3300025911 | Ga0207654_10041690 | Ga0207654_100416903 | 97 |
| 131 | 3300025911 | Ga0207654_11134319 | Ga0207654_111343192 | 97 |
| 132 | 3300025912 | Ga0207707_10063636 | Ga0207707_100636362 | 97 |
| 133 | 3300025913 | Ga0207695_11030362 | Ga0207695_110303622 | 97 |
| 134 | 3300025914 | Ga0207671_10060155 | Ga0207671_100601555 | 97 |
| 135 | 3300025914 | Ga0207671_10094035 | Ga0207671_100940355 | 97 |
| 136 | 3300025914 | Ga0207671_10300698 | Ga0207671_103006982 | 97 |
| 137 | 3300025916 | Ga0207663_10640053 | Ga0207663_106400531 | 97 |
| 138 | 3300025919 | Ga0207657_10050665 | Ga0207657_100506658 | 97 |
| 139 | 3300025919 | Ga0207657_10331518 | Ga0207657_103315182 | 97 |
| 140 | 3300025920 | Ga0207649_10696864 | Ga0207649_106968642 | 97 |
| 141 | 3300025921 | Ga0207652_10096220 | Ga0207652_100962202 | 97 |
| 142 | 3300025921 | Ga0207652_11325523 | Ga0207652_113255232 | 97 |
| 143 | 3300025924 | Ga0207694_10573243 | Ga0207694_105732432 | 97 |
| 144 | 3300025927 | Ga0207687_10194230 | Ga0207687_101942303 | 97 |
| 145 | 3300025932 | Ga0207690_10120468 | Ga0207690_101204681 | 97 |
| 146 | 3300025933 | Ga0207706_11397236 | Ga0207706_113972362 | 97 |
| 147 | 3300025934 | Ga0207686_10311570 | Ga0207686_103115702 | 97 |
| 148 | 3300025934 | Ga0207686_10462219 | Ga0207686_104622192 | 97 |
| 149 | 3300025935 | Ga0207709_10108056 | Ga0207709_101080562 | 97 |
| 150 | 3300025938 | Ga0207704_10233860 | Ga0207704_102338602 | 97 |
| 151 | 3300025941 | Ga0207711_10091511 | Ga0207711_100915112 | 97 |
| 152 | 3300025941 | Ga0207711_10306669 | Ga0207711_103066691 | 97 |
| 153 | 3300025944 | Ga0207661_10225484 | Ga0207661_102254842 | 97 |
| 154 | 3300025945 | Ga0207679_10547783 | Ga0207679_105477832 | 97 |
| 155 | 3300025949 | Ga0207667_11387472 | Ga0207667_113874721 | 97 |
| 156 | 3300025981 | Ga0207640_10631814 | Ga0207640_106318142 | 97 |
| 157 | 3300025986 | Ga0207658_10437822 | Ga0207658_104378222 | 97 |
| 158 | 3300026023 | Ga0207677_10483582 | Ga0207677_104835822 | 97 |
| 159 | 3300026035 | Ga0207703_10064766 | Ga0207703_100647664 | 97 |
| 160 | 3300026041 | Ga0207639_10105527 | Ga0207639_101055272 | 97 |
| 161 | 3300026078 | Ga0207702_10030901 | Ga0207702_100309019 | 97 |
| 162 | 3300026078 | Ga0207702_10043789 | Ga0207702_100437892 | 97 |
| 163 | 3300026088 | Ga0207641_10023693 | Ga0207641_100236935 | 97 |
| 164 | 3300026088 | Ga0207641_10197637 | Ga0207641_101976372 | 97 |
| 165 | 3300026089 | Ga0207648_10308547 | Ga0207648_103085472 | 97 |
| 166 | 3300026095 | Ga0207676_10009610 | Ga0207676_100096106 | 97 |
| 167 | 3300026095 | Ga0207676_10086376 | Ga0207676_100863764 | 97 |
| 168 | 3300026116 | Ga0207674_10013233 | Ga0207674_1001323317 | 97 |
| 169 | 3300028379 | Ga0268266_10370969 | Ga0268266_103709692 | 97 |
| 170 | 3300028381 | Ga0268264_10060239 | Ga0268264_100602396 | 97 |
| 171 | 3300031241 | Ga0265325_10234454 | Ga0265325_102344542 | 97 |
| 172 | 3300031249 | Ga0265339_10141364 | Ga0265339_101413643 | 97 |
| 173 | 3300031250 | Ga0265331_10077798 | Ga0265331_100777983 | 97 |
| 174 | 3300031595 | Ga0265313_10171480 | Ga0265313_101714802 | 97 |
| 175 | 3300031595 | Ga0265313_10245930 | Ga0265313_102459302 | 97 |
| 176 | 3300031711 | Ga0265314_10009286 | Ga0265314_1000928610 | 97 |
| 177 | 3300034816 | Ga0373930_0058782 | Ga0373930_0058782_66_434 | 97 |
| 178 | 3300035115 | Ga0373941_0314050 | Ga0373941_0314050_71_439 | 97 |
| 179 | 3300036401 | Ga0373937_0677496 | Ga0373937_0677496_398_766 | 97 |
| 180 | 3300037068 | Ga0373925_0935393 | Ga0373925_0935393_140_508 | 97 |
| 181 | 3300044684 | Ga0466966_0017481 | Ga0466966_0017481_1796_2116 | 97 |
| 182 | 3300044693 | Ga0466961_0260078 | Ga0466961_0260078_277_597 | 97 |
| 183 | 3300044693 | Ga0466961_0280150 | Ga0466961_0280150_70_390 | 97 |
| 184 | 3300044693 | Ga0466961_0388179 | Ga0466961_0388179_325_645 | 97 |
| 185 | 3300044694 | Ga0466963_0565210 | Ga0466963_0565210_453_773 | 97 |
| 186 | 3300044765 | Ga0466970_0206926 | Ga0466970_0206926_84_404 | 97 |
| 187 | 3300044765 | Ga0466970_0581394 | Ga0466970_0581394_246_566 | 97 |
| 188 | 3300045049 | Ga0466959_0072475 | Ga0466959_0072475_1812_2132 | 97 |
| 189 | 3300046473 | Ga0495582_0270634 | Ga0495582_0270634_375_743 | 97 |
| 190 | 3300046531 | Ga0495665_0465519 | Ga0495665_0465519_87_455 | 97 |
| 191 | 3300046691 | Ga0495670_0163925 | Ga0495670_0163925_765_1133 | 97 |
| 192 | 3300059478 | Ga0587093_084890 | Ga0587093_084890_172_492 | 97 |
| 193 | 3300059508 | Ga0587088_015178 | Ga0587088_015178_766_1086 | 97 |
| 194 | 3300061719 | Ga0466962_0194683 | Ga0466962_0194683_143_463 | 97 |
| 195 | 3300009551 | Ga0105238_11211882 | Ga0105238_112118822 | 99 |
| 196 | 3300025924 | Ga0207694_10520951 | Ga0207694_105209512 | 99 |
| 197 | 3300028558 | Ga0265326_10054192 | Ga0265326_100541922 | 99 |
| 198 | 3300028577 | Ga0265318_10068893 | Ga0265318_100688932 | 99 |
| 199 | 3300028800 | Ga0265338_10097186 | Ga0265338_100971865 | 99 |
| 200 | 3300031240 | Ga0265320_10021417 | Ga0265320_100214178 | 99 |
| 201 | 3300031711 | Ga0265314_10077276 | Ga0265314_100772763 | 99 |
| 202 | 3300041486 | Ga0451807_0475875 | Ga0451807_0475875_284_598 | 99 |
| 203 | 3300044842 | Ga0466957_0963322 | Ga0466957_0963322_149_520 | 99 |
| 204 | iso_pu_bacteria | 2643221591 | 2643963609 | 99 |
| 205 | 3300005337 | Ga0070682_100681905 | Ga0070682_1006819051 | 100 |
| 206 | 3300006051 | Ga0075364_10295262 | Ga0075364_102952623 | 100 |
| 207 | 3300025939 | Ga0207665_10968425 | Ga0207665_109684252 | 100 |
| 208 | 3300037068 | Ga0373925_0810765 | Ga0373925_0810765_108_452 | 100 |
| 209 | 3300037853 | Ga0436364_0419855 | Ga0436364_0419855_485_811 | 100 |
| 210 | 3300041512 | Ga0451853_0975994 | Ga0451853_0975994_370_684 | 100 |
| 211 | 3300044694 | Ga0466963_1331630 | Ga0466963_1331630_136_462 | 100 |
| 212 | 3300048921 | Ga0496118_0109853 | Ga0496118_0109853_92_442 | 100 |
| 213 | 3300005564 | Ga0070664_100572917 | Ga0070664_1005729171 | 101 |
| 214 | 3300006871 | Ga0075434_100242298 | Ga0075434_1002422983 | 101 |
| 215 | 3300031711 | Ga0265314_10272587 | Ga0265314_102725872 | 101 |
| 216 | 3300031712 | Ga0265342_10052436 | Ga0265342_100524362 | 101 |
| 217 | 3300041441 | Ga0451787_123607 | Ga0451787_123607_34_351 | 101 |
| 218 | 3300041441 | Ga0451787_300709 | Ga0451787_300709_296_613 | 101 |
| 219 | 3300041441 | Ga0451787_315941 | Ga0451787_315941_378_701 | 101 |
| 220 | 3300041456 | Ga0451795_0769616 | Ga0451795_0769616_366_683 | 101 |
| 221 | 3300044712 | Ga0453684_0464818 | Ga0453684_0464818_593_916 | 101 |
| 222 | 3300048088 | Ga0495602_1066728 | Ga0495602_1066728_29_358 | 101 |
| 223 | 3300048921 | Ga0496118_0319084 | Ga0496118_0319084_260_628 | 101 |
| 224 | 3300049571 | Ga0501034_0058419 | Ga0501034_0058419_678_1025 | 101 |
| 225 | 3300050512 | nmdc:mga0n895_398993_c1 | nmdc:mga0n895_398993_c1_542_853 | 101 |
| 226 | 3300005455 | Ga0070663_101022850 | Ga0070663_1010228501 | 102 |
| 227 | 3300005535 | Ga0070684_102307355 | Ga0070684_1023073551 | 102 |
| 228 | 3300005539 | Ga0068853_100017302 | Ga0068853_1000173022 | 102 |
| 229 | 3300005543 | Ga0070672_100640382 | Ga0070672_1006403821 | 102 |
| 230 | 3300005548 | Ga0070665_101383489 | Ga0070665_1013834892 | 102 |
| 231 | 3300005548 | Ga0070665_102135397 | Ga0070665_1021353971 | 102 |
| 232 | 3300005563 | Ga0068855_100084797 | Ga0068855_1000847975 | 102 |
| 233 | 3300005563 | Ga0068855_102016327 | Ga0068855_1020163272 | 102 |
| 234 | 3300005564 | Ga0070664_100055154 | Ga0070664_1000551548 | 102 |
| 235 | 3300005564 | Ga0070664_100488332 | Ga0070664_1004883322 | 102 |
| 236 | 3300005578 | Ga0068854_101021145 | Ga0068854_1010211452 | 102 |
| 237 | 3300005578 | Ga0068854_101472932 | Ga0068854_1014729322 | 102 |
| 238 | 3300005614 | Ga0068856_100009432 | Ga0068856_10000943211 | 102 |
| 239 | 3300005614 | Ga0068856_100267581 | Ga0068856_1002675812 | 102 |
| 240 | 3300005616 | Ga0068852_100871218 | Ga0068852_1008712182 | 102 |
| 241 | 3300005616 | Ga0068852_101890105 | Ga0068852_1018901052 | 102 |
| 242 | 3300005618 | Ga0068864_101030018 | Ga0068864_1010300181 | 102 |
| 243 | 3300005937 | Ga0081455_10386263 | Ga0081455_103862632 | 102 |
| 244 | 3300006028 | Ga0070717_10033750 | Ga0070717_100337502 | 102 |
| 245 | 3300006028 | Ga0070717_10859219 | Ga0070717_108592191 | 102 |
| 246 | 3300006175 | Ga0070712_100511026 | Ga0070712_1005110261 | 102 |
| 247 | 3300006237 | Ga0097621_102163375 | Ga0097621_1021633752 | 102 |
| 248 | 3300009174 | Ga0105241_10631040 | Ga0105241_106310403 | 102 |
| 249 | 3300009545 | Ga0105237_10357318 | Ga0105237_103573182 | 102 |
| 250 | 3300009545 | Ga0105237_10498738 | Ga0105237_104987382 | 102 |
| 251 | 3300009551 | Ga0105238_12157697 | Ga0105238_121576972 | 102 |
| 252 | 3300009551 | Ga0105238_12825968 | Ga0105238_128259682 | 102 |
| 253 | 3300010375 | Ga0105239_10236062 | Ga0105239_102360622 | 102 |
| 254 | 3300010375 | Ga0105239_10526954 | Ga0105239_105269544 | 102 |
| 255 | 3300010375 | Ga0105239_10902550 | Ga0105239_109025502 | 102 |
| 256 | 3300013100 | Ga0157373_10190846 | Ga0157373_101908464 | 102 |
| 257 | 3300013102 | Ga0157371_10024961 | Ga0157371_100249619 | 102 |
| 258 | 3300013105 | Ga0157369_10004638 | Ga0157369_1000463822 | 102 |
| 259 | 3300013105 | Ga0157369_10033746 | Ga0157369_100337466 | 102 |
| 260 | 3300013105 | Ga0157369_10595136 | Ga0157369_105951362 | 102 |
| 261 | 3300013105 | Ga0157369_11533474 | Ga0157369_115334742 | 102 |
| 262 | 3300013296 | Ga0157374_10030570 | Ga0157374_1003057010 | 102 |
| 263 | 3300013307 | Ga0157372_11804768 | Ga0157372_118047682 | 102 |
| 264 | 3300013307 | Ga0157372_12231672 | Ga0157372_122316721 | 102 |
| 265 | 3300014969 | Ga0157376_10087903 | Ga0157376_100879036 | 102 |
| 266 | 3300014969 | Ga0157376_10108272 | Ga0157376_101082725 | 102 |
| 267 | 3300021384 | Ga0213876_10441877 | Ga0213876_104418771 | 102 |
| 268 | 3300021388 | Ga0213875_10005759 | Ga0213875_1000575911 | 102 |
| 269 | 3300021388 | Ga0213875_10045320 | Ga0213875_100453203 | 102 |
| 270 | 3300021388 | Ga0213875_10069891 | Ga0213875_100698914 | 102 |
| 271 | 3300021388 | Ga0213875_10333567 | Ga0213875_103335672 | 102 |
| 272 | 3300025909 | Ga0207705_10057980 | Ga0207705_100579804 | 102 |
| 273 | 3300025911 | Ga0207654_10648728 | Ga0207654_106487281 | 102 |
| 274 | 3300025913 | Ga0207695_10140217 | Ga0207695_101402175 | 102 |
| 275 | 3300025913 | Ga0207695_10342860 | Ga0207695_103428602 | 102 |
| 276 | 3300025914 | Ga0207671_11025134 | Ga0207671_110251342 | 102 |
| 277 | 3300025919 | Ga0207657_10063775 | Ga0207657_100637753 | 102 |
| 278 | 3300025920 | Ga0207649_10032767 | Ga0207649_100327676 | 102 |
| 279 | 3300025929 | Ga0207664_10726910 | Ga0207664_107269102 | 102 |
| 280 | 3300025931 | Ga0207644_10291825 | Ga0207644_102918252 | 102 |
| 281 | 3300025932 | Ga0207690_10172572 | Ga0207690_101725723 | 102 |
| 282 | 3300025940 | Ga0207691_10540892 | Ga0207691_105408922 | 102 |
| 283 | 3300025949 | Ga0207667_10068480 | Ga0207667_100684805 | 102 |
| 284 | 3300025949 | Ga0207667_10114447 | Ga0207667_101144475 | 102 |
| 285 | 3300025949 | Ga0207667_10436094 | Ga0207667_104360943 | 102 |
| 286 | 3300025949 | Ga0207667_11535863 | Ga0207667_115358632 | 102 |
| 287 | 3300025981 | Ga0207640_11152549 | Ga0207640_111525492 | 102 |
| 288 | 3300026041 | Ga0207639_10992341 | Ga0207639_109923412 | 102 |
| 289 | 3300026067 | Ga0207678_10009839 | Ga0207678_100098397 | 102 |
| 290 | 3300026067 | Ga0207678_10590067 | Ga0207678_105900672 | 102 |
| 291 | 3300026078 | Ga0207702_10007772 | Ga0207702_1000777210 | 102 |
| 292 | 3300026078 | Ga0207702_10015414 | Ga0207702_1001541411 | 102 |
| 293 | 3300026078 | Ga0207702_10499911 | Ga0207702_104999111 | 102 |
| 294 | 3300028379 | Ga0268266_11727742 | Ga0268266_117277422 | 102 |
| 295 | 3300031824 | Ga0307413_10578933 | Ga0307413_105789332 | 102 |
| 296 | 3300031995 | Ga0307409_100451110 | Ga0307409_1004511102 | 102 |
| 297 | 3300032004 | Ga0307414_10861318 | Ga0307414_108613182 | 102 |
| 298 | 3300032004 | Ga0307414_11171071 | Ga0307414_111710712 | 102 |
| 299 | 3300033527 | Ga0316586_1005355 | Ga0316586_10053553 | 102 |
| 300 | 3300035691 | Ga0373931_1123457 | Ga0373931_1123457_72_449 | 102 |
| 301 | 3300035725 | Ga0373947_1252674 | Ga0373947_1252674_111_494 | 102 |
| 302 | 3300036712 | Ga0316584_0652921 | Ga0316584_0652921_334_714 | 102 |
| 303 | 3300037471 | Ga0395905_0668455 | Ga0395905_0668455_346_723 | 102 |
| 304 | 3300037853 | Ga0436364_0026865 | Ga0436364_0026865_529_912 | 102 |
| 305 | 3300037853 | Ga0436364_0240413 | Ga0436364_0240413_2995_3378 | 102 |
| 306 | 3300037853 | Ga0436364_0578648 | Ga0436364_0578648_35_418 | 102 |
| 307 | 3300037853 | Ga0436364_0894178 | Ga0436364_0894178_1012_1395 | 102 |
| 308 | 3300037853 | Ga0436364_1006134 | Ga0436364_1006134_594_977 | 102 |
| 309 | 3300037853 | Ga0436364_1054367 | Ga0436364_1054367_14313_14696 | 102 |
| 310 | 3300037853 | Ga0436364_1121262 | Ga0436364_1121262_9710_10093 | 102 |
| 311 | 3300037853 | Ga0436364_1393988 | Ga0436364_1393988_1109_1492 | 102 |
| 312 | 3300037853 | Ga0436364_1400193 | Ga0436364_1400193_2746_3129 | 102 |
| 313 | 3300039437 | Ga0436365_0200225 | Ga0436365_0200225_266_649 | 102 |
| 314 | 3300039437 | Ga0436365_0821682 | Ga0436365_0821682_6169_6552 | 102 |
| 315 | 3300039437 | Ga0436365_1262762 | Ga0436365_1262762_41_424 | 102 |
| 316 | 3300039437 | Ga0436365_1721656 | Ga0436365_1721656_313_699 | 102 |
| 317 | 3300039437 | Ga0436365_1887503 | Ga0436365_1887503_315_701 | 102 |
| 318 | 3300039438 | Ga0436360_0584444 | Ga0436360_0584444_1026_1409 | 102 |
| 319 | 3300039438 | Ga0436360_1049432 | Ga0436360_1049432_53_436 | 102 |
| 320 | 3300039450 | Ga0436363_0345243 | Ga0436363_0345243_322_705 | 102 |
| 321 | 3300039450 | Ga0436363_0431750 | Ga0436363_0431750_450_833 | 102 |
| 322 | 3300039450 | Ga0436363_1351619 | Ga0436363_1351619_907_1293 | 102 |
| 323 | 3300039453 | Ga0436362_0534029 | Ga0436362_0534029_585_968 | 102 |
| 324 | 3300041511 | Ga0451855_0059144 | Ga0451855_0059144_176_496 | 102 |
| 325 | 3300041997 | Ga0439431_0029306 | Ga0439431_0029306_678_1007 | 102 |
| 326 | 3300044693 | Ga0466961_0277874 | Ga0466961_0277874_316_699 | 102 |
| 327 | 3300044765 | Ga0466970_0745036 | Ga0466970_0745036_175_558 | 102 |
| 328 | 3300045836 | Ga0466958_0050425 | Ga0466958_0050425_20_403 | 102 |
| 329 | 3300045976 | Ga0466967_0610353 | Ga0466967_0610353_271_654 | 102 |
| 330 | 3300045976 | Ga0466967_0703486 | Ga0466967_0703486_376_759 | 102 |
| 331 | 3300048904 | Ga0496101_0374400 | Ga0496101_0374400_305_682 | 102 |
| 332 | 3300048908 | Ga0496105_0502990 | Ga0496105_0502990_466_849 | 102 |
| 333 | 3300048909 | Ga0496106_1202591 | Ga0496106_1202591_56_439 | 102 |
| 334 | 3300048910 | Ga0496107_1357773 | Ga0496107_1357773_110_493 | 102 |
| 335 | 3300048915 | Ga0496112_0008575 | Ga0496112_0008575_7980_8363 | 102 |
| 336 | 3300048918 | Ga0496115_0011601 | Ga0496115_0011601_1764_2147 | 102 |
| 337 | 3300048918 | Ga0496115_0035714 | Ga0496115_0035714_1202_1570 | 102 |
| 338 | 3300049685 | Ga0501256_022223 | Ga0501256_022223_262_639 | 102 |
| 339 | 3300049742 | Ga0501080_1627891 | Ga0501080_1627891_192_536 | 102 |
| 340 | 3300049744 | Ga0501083_0160511 | Ga0501083_0160511_582_950 | 102 |
| 341 | 3300053077 | Ga0495601_0311785 | Ga0495601_0311785_614_997 | 102 |
| 342 | 3300053139 | Ga0500568_0002264 | Ga0500568_0002264_281_658 | 102 |
| 343 | 3300053151 | Ga0500604_0069550 | Ga0500604_0069550_336_674 | 102 |
| 344 | 3300059643 | Ga0587072_014285 | Ga0587072_014285_398_736 | 102 |
| 345 | 3300004799 | Ga0058863_10010406 | Ga0058863_100104065 | 103 |
| 346 | 3300004799 | Ga0058863_11587924 | Ga0058863_115879242 | 103 |
| 347 | 3300004800 | Ga0058861_11690222 | Ga0058861_116902222 | 103 |
| 348 | 3300004803 | Ga0058862_11737220 | Ga0058862_117372201 | 103 |
| 349 | 3300004803 | Ga0058862_12843351 | Ga0058862_128433512 | 103 |
| 350 | 3300005336 | Ga0070680_100072638 | Ga0070680_1000726385 | 103 |
| 351 | 3300005336 | Ga0070680_100287817 | Ga0070680_1002878173 | 103 |
| 352 | 3300005336 | Ga0070680_100421425 | Ga0070680_1004214253 | 103 |
| 353 | 3300005337 | Ga0070682_100352310 | Ga0070682_1003523102 | 103 |
| 354 | 3300005339 | Ga0070660_101227932 | Ga0070660_1012279321 | 103 |
| 355 | 3300005341 | Ga0070691_10212610 | Ga0070691_102126103 | 103 |
| 356 | 3300005345 | Ga0070692_10085623 | Ga0070692_100856233 | 103 |
| 357 | 3300005434 | Ga0070709_10204906 | Ga0070709_102049063 | 103 |
| 358 | 3300005434 | Ga0070709_10665610 | Ga0070709_106656102 | 103 |
| 359 | 3300005436 | Ga0070713_100338754 | Ga0070713_1003387542 | 103 |
| 360 | 3300005458 | Ga0070681_10169369 | Ga0070681_101693692 | 103 |
| 361 | 3300005458 | Ga0070681_10307388 | Ga0070681_103073883 | 103 |
| 362 | 3300005458 | Ga0070681_11311227 | Ga0070681_113112271 | 103 |
| 363 | 3300005530 | Ga0070679_100418617 | Ga0070679_1004186171 | 103 |
| 364 | 3300005530 | Ga0070679_100443699 | Ga0070679_1004436992 | 103 |
| 365 | 3300005535 | Ga0070684_100324235 | Ga0070684_1003242351 | 103 |
| 366 | 3300005545 | Ga0070695_101344339 | Ga0070695_1013443391 | 103 |
| 367 | 3300005548 | Ga0070665_100341650 | Ga0070665_1003416504 | 103 |
| 368 | 3300005614 | Ga0068856_100200510 | Ga0068856_1002005102 | 103 |
| 369 | 3300005617 | Ga0068859_100094099 | Ga0068859_1000940993 | 103 |
| 370 | 3300005719 | Ga0068861_100250890 | Ga0068861_1002508903 | 103 |
| 371 | 3300005841 | Ga0068863_100016102 | Ga0068863_10001610210 | 103 |
| 372 | 3300006038 | Ga0075365_10551026 | Ga0075365_105510262 | 103 |
| 373 | 3300006358 | Ga0068871_101947175 | Ga0068871_1019471752 | 103 |
| 374 | 3300006844 | Ga0075428_101617485 | Ga0075428_1016174852 | 103 |
| 375 | 3300006846 | Ga0075430_100033273 | Ga0075430_1000332739 | 103 |
| 376 | 3300006847 | Ga0075431_100068526 | Ga0075431_1000685269 | 103 |
| 377 | 3300006880 | Ga0075429_100267471 | Ga0075429_1002674712 | 103 |
| 378 | 3300006931 | Ga0097620_100094100 | Ga0097620_1000941003 | 103 |
| 379 | 3300009093 | Ga0105240_10000499 | Ga0105240_1000049914 | 103 |
| 380 | 3300009147 | Ga0114129_10375592 | Ga0114129_103755922 | 103 |
| 381 | 3300009545 | Ga0105237_10086917 | Ga0105237_100869176 | 103 |
| 382 | 3300009545 | Ga0105237_10221528 | Ga0105237_102215284 | 103 |
| 383 | 3300009553 | Ga0105249_10103809 | Ga0105249_101038094 | 103 |
| 384 | 3300013104 | Ga0157370_11623581 | Ga0157370_116235811 | 103 |
| 385 | 3300013105 | Ga0157369_10242494 | Ga0157369_102424942 | 103 |
| 386 | 3300013105 | Ga0157369_12575534 | Ga0157369_125755341 | 103 |
| 387 | 3300013297 | Ga0157378_10293253 | Ga0157378_102932533 | 103 |
| 388 | 3300014969 | Ga0157376_10437357 | Ga0157376_104373574 | 103 |
| 389 | 3300020069 | Ga0197907_10880964 | Ga0197907_108809642 | 103 |
| 390 | 3300020078 | Ga0206352_10460690 | Ga0206352_104606901 | 103 |
| 391 | 3300021377 | Ga0213874_10048447 | Ga0213874_100484472 | 103 |
| 392 | 3300022467 | Ga0224712_10486813 | Ga0224712_104868131 | 103 |
| 393 | 3300025904 | Ga0207647_10181916 | Ga0207647_101819162 | 103 |
| 394 | 3300025906 | Ga0207699_10205929 | Ga0207699_102059292 | 103 |
| 395 | 3300025912 | Ga0207707_10113466 | Ga0207707_101134664 | 103 |
| 396 | 3300025912 | Ga0207707_10173157 | Ga0207707_101731574 | 103 |
| 397 | 3300025912 | Ga0207707_10419917 | Ga0207707_104199172 | 103 |
| 398 | 3300025913 | Ga0207695_10008431 | Ga0207695_1000843121 | 103 |
| 399 | 3300025914 | Ga0207671_10017757 | Ga0207671_100177575 | 103 |
| 400 | 3300025921 | Ga0207652_10279989 | Ga0207652_102799891 | 103 |
| 401 | 3300025921 | Ga0207652_10369965 | Ga0207652_103699651 | 103 |
| 402 | 3300025928 | Ga0207700_10710310 | Ga0207700_107103102 | 103 |
| 403 | 3300025942 | Ga0207689_10111916 | Ga0207689_101119165 | 103 |
| 404 | 3300025986 | Ga0207658_10055258 | Ga0207658_100552587 | 103 |
| 405 | 3300026078 | Ga0207702_11160057 | Ga0207702_111600571 | 103 |
| 406 | 3300026088 | Ga0207641_10011436 | Ga0207641_1001143614 | 103 |
| 407 | 3300026095 | Ga0207676_10600908 | Ga0207676_106009082 | 103 |
| 408 | 3300026116 | Ga0207674_12021362 | Ga0207674_120213622 | 103 |
| 409 | 3300028381 | Ga0268264_10951624 | Ga0268264_109516242 | 103 |
| 410 | 3300028794 | Ga0307515_10201561 | Ga0307515_102015614 | 103 |
| 411 | 3300031456 | Ga0307513_10343349 | Ga0307513_103433492 | 103 |
| 412 | 3300031901 | Ga0307406_10024184 | Ga0307406_100241846 | 103 |
| 413 | 3300031911 | Ga0307412_12193671 | Ga0307412_121936711 | 103 |
| 414 | 3300032004 | Ga0307414_11022067 | Ga0307414_110220672 | 103 |
| 415 | 3300035083 | Ga0373926_0106121 | Ga0373926_0106121_164_544 | 103 |
| 416 | 3300035083 | Ga0373926_0115693 | Ga0373926_0115693_540_908 | 103 |
| 417 | 3300035170 | Ga0373943_0037025 | Ga0373943_0037025_612_992 | 103 |
| 418 | 3300035171 | Ga0373946_0024372 | Ga0373946_0024372_1565_1945 | 103 |
| 419 | 3300035695 | Ga0373927_0022764 | Ga0373927_0022764_909_1277 | 103 |
| 420 | 3300035695 | Ga0373927_0036356 | Ga0373927_0036356_2282_2662 | 103 |
| 421 | 3300035725 | Ga0373947_0013403 | Ga0373947_0013403_2248_2628 | 103 |
| 422 | 3300036401 | Ga0373937_0111079 | Ga0373937_0111079_585_965 | 103 |
| 423 | 3300036401 | Ga0373937_2127687 | Ga0373937_2127687_109_489 | 103 |
| 424 | 3300037068 | Ga0373925_0007421 | Ga0373925_0007421_4355_4735 | 103 |
| 425 | 3300037418 | Ga0395900_0619767 | Ga0395900_0619767_515_901 | 103 |
| 426 | 3300037466 | Ga0395898_0536997 | Ga0395898_0536997_401_787 | 103 |
| 427 | 3300037471 | Ga0395905_0286632 | Ga0395905_0286632_972_1358 | 103 |
| 428 | 3300038443 | Ga0395901_0291374 | Ga0395901_0291374_885_1271 | 103 |
| 429 | 3300039450 | Ga0436363_1096749 | Ga0436363_1096749_73_459 | 103 |
| 430 | 3300039450 | Ga0436363_1621856 | Ga0436363_1621856_490_870 | 103 |
| 431 | 3300041464 | Ga0451808_34490 | Ga0451808_34490_270_581 | 103 |
| 432 | 3300041498 | Ga0451841_0349496 | Ga0451841_0349496_51_362 | 103 |
| 433 | 3300044656 | Ga0466969_0558443 | Ga0466969_0558443_75_467 | 103 |
| 434 | 3300044683 | Ga0466965_0819667 | Ga0466965_0819667_10_402 | 103 |
| 435 | 3300045836 | Ga0466958_0230842 | Ga0466958_0230842_140_526 | 103 |
| 436 | 3300046472 | Ga0495580_0035122 | Ga0495580_0035122_854_1234 | 103 |
| 437 | 3300046472 | Ga0495580_0303839 | Ga0495580_0303839_647_1027 | 103 |
| 438 | 3300046526 | Ga0495666_0398497 | Ga0495666_0398497_87_467 | 103 |
| 439 | 3300046531 | Ga0495665_0058621 | Ga0495665_0058621_241_621 | 103 |
| 440 | 3300046615 | Ga0495656_0648452 | Ga0495656_0648452_80_463 | 103 |
| 441 | 3300046663 | Ga0495635_0115216 | Ga0495635_0115216_177_557 | 103 |
| 442 | 3300046683 | Ga0495658_0183328 | Ga0495658_0183328_197_577 | 103 |
| 443 | 3300047318 | Ga0495636_0199904 | Ga0495636_0199904_166_549 | 103 |
| 444 | 3300047673 | Ga0495593_0124579 | Ga0495593_0124579_618_998 | 103 |
| 445 | 3300048913 | Ga0496110_0497506 | Ga0496110_0497506_685_996 | 103 |
| 446 | 3300048914 | Ga0496111_0048615 | Ga0496111_0048615_2376_2687 | 103 |
| 447 | 3300048919 | Ga0496116_0146828 | Ga0496116_0146828_212_523 | 103 |
| 448 | 3300048921 | Ga0496118_0221485 | Ga0496118_0221485_510_821 | 103 |
| 449 | 3300048925 | Ga0496122_0294434 | Ga0496122_0294434_386_697 | 103 |
| 450 | 3300048927 | Ga0496124_0835150 | Ga0496124_0835150_233_544 | 103 |
| 451 | 3300048928 | Ga0496125_0000815 | Ga0496125_0000815_32830_33141 | 103 |
| 452 | 3300049535 | Ga0501319_015186 | Ga0501319_015186_193_504 | 103 |
| 453 | 3300049568 | Ga0501031_0554376 | Ga0501031_0554376_309_695 | 103 |
| 454 | 3300049569 | Ga0501032_0276586 | Ga0501032_0276586_506_892 | 103 |
| 455 | 3300049570 | Ga0501033_0837683 | Ga0501033_0837683_46_432 | 103 |
| 456 | 3300049571 | Ga0501034_0010656 | Ga0501034_0010656_452_838 | 103 |
| 457 | 3300049573 | Ga0501037_0052409 | Ga0501037_0052409_2147_2533 | 103 |
| 458 | 3300049574 | Ga0501038_0006023 | Ga0501038_0006023_7923_8309 | 103 |
| 459 | 3300049579 | Ga0501043_0105319 | Ga0501043_0105319_710_1096 | 103 |
| 460 | 3300049580 | Ga0501046_0318591 | Ga0501046_0318591_642_1028 | 103 |
| 461 | 3300049581 | Ga0501047_0038476 | Ga0501047_0038476_1494_1880 | 103 |
| 462 | 3300049582 | Ga0501048_0086023 | Ga0501048_0086023_1046_1432 | 103 |
| 463 | 3300049586 | Ga0501070_0006487 | Ga0501070_0006487_9122_9508 | 103 |
| 464 | 3300049589 | Ga0501073_0198962 | Ga0501073_0198962_298_684 | 103 |
| 465 | 3300049590 | Ga0501074_0043689 | Ga0501074_0043689_91_477 | 103 |
| 466 | 3300049742 | Ga0501080_0070674 | Ga0501080_0070674_450_836 | 103 |
| 467 | 3300049822 | Ga0501035_0028540 | Ga0501035_0028540_608_994 | 103 |
| 468 | 3300049823 | Ga0501044_0010929 | Ga0501044_0010929_6638_7024 | 103 |
| 469 | 3300049823 | Ga0501044_0073393 | Ga0501044_0073393_101_412 | 103 |
| 470 | 3300050492 | nmdc:mga0yw44_852520_c1 | nmdc:mga0yw44_852520_c1_231_542 | 103 |
| 471 | 3300050507 | nmdc:mga05p37_221970_c1 | nmdc:mga05p37_221970_c1_1297_1662 | 103 |
| 472 | 3300050509 | nmdc:mga0qj67_136084_c1 | nmdc:mga0qj67_136084_c1_1333_1698 | 103 |
| 473 | 3300050510 | nmdc:mga06r32_10773_c1 | nmdc:mga06r32_10773_c1_6031_6396 | 103 |
| 474 | 3300053085 | Ga0495619_1097865 | Ga0495619_1097865_85_465 | 103 |
| 475 | 3300059643 | Ga0587072_003068 | Ga0587072_003068_358_669 | 103 |
| 476 | 3300003214 | JGI25165J46597_1000961 | JGI25165J46597_100096117 | 104 |
| 477 | 3300005335 | Ga0070666_10796447 | Ga0070666_107964472 | 104 |
| 478 | 3300005366 | Ga0070659_100853103 | Ga0070659_1008531032 | 104 |
| 479 | 3300005367 | Ga0070667_101017746 | Ga0070667_1010177462 | 104 |
| 480 | 3300005434 | Ga0070709_11279138 | Ga0070709_112791382 | 104 |
| 481 | 3300005436 | Ga0070713_102306310 | Ga0070713_1023063101 | 104 |
| 482 | 3300005455 | Ga0070663_100066762 | Ga0070663_1000667624 | 104 |
| 483 | 3300005458 | Ga0070681_10283993 | Ga0070681_102839933 | 104 |
| 484 | 3300005466 | Ga0070685_11605353 | Ga0070685_116053531 | 104 |
| 485 | 3300005530 | Ga0070679_100048764 | Ga0070679_1000487646 | 104 |
| 486 | 3300005539 | Ga0068853_100796650 | Ga0068853_1007966502 | 104 |
| 487 | 3300005539 | Ga0068853_101307603 | Ga0068853_1013076032 | 104 |
| 488 | 3300005548 | Ga0070665_100225239 | Ga0070665_1002252396 | 104 |
| 489 | 3300005563 | Ga0068855_100018562 | Ga0068855_1000185626 | 104 |
| 490 | 3300005563 | Ga0068855_100151277 | Ga0068855_1001512775 | 104 |
| 491 | 3300005564 | Ga0070664_101764062 | Ga0070664_1017640621 | 104 |
| 492 | 3300005577 | Ga0068857_100646626 | Ga0068857_1006466262 | 104 |
| 493 | 3300005616 | Ga0068852_100565939 | Ga0068852_1005659392 | 104 |
| 494 | 3300005617 | Ga0068859_100847934 | Ga0068859_1008479342 | 104 |
| 495 | 3300005841 | Ga0068863_102250603 | Ga0068863_1022506032 | 104 |
| 496 | 3300005842 | Ga0068858_101042353 | Ga0068858_1010423532 | 104 |
| 497 | 3300006237 | Ga0097621_101025163 | Ga0097621_1010251632 | 104 |
| 498 | 3300006931 | Ga0097620_100848098 | Ga0097620_1008480982 | 104 |
| 499 | 3300009174 | Ga0105241_10116070 | Ga0105241_101160702 | 104 |
| 500 | 3300009174 | Ga0105241_10358286 | Ga0105241_103582863 | 104 |
| 501 | 3300009177 | Ga0105248_10045011 | Ga0105248_1004501110 | 104 |
| 502 | 3300009545 | Ga0105237_10002619 | Ga0105237_1000261924 | 104 |
| 503 | 3300009545 | Ga0105237_10007763 | Ga0105237_100077639 | 104 |
| 504 | 3300009545 | Ga0105237_10797399 | Ga0105237_107973991 | 104 |
| 505 | 3300010375 | Ga0105239_10012303 | Ga0105239_100123038 | 104 |
| 506 | 3300010375 | Ga0105239_10061221 | Ga0105239_100612219 | 104 |
| 507 | 3300010375 | Ga0105239_10632459 | Ga0105239_106324592 | 104 |
| 508 | 3300013105 | Ga0157369_10157491 | Ga0157369_101574916 | 104 |
| 509 | 3300013297 | Ga0157378_11981799 | Ga0157378_119817992 | 104 |
| 510 | 3300013297 | Ga0157378_12452433 | Ga0157378_124524332 | 104 |
| 511 | 3300013306 | Ga0163162_12618686 | Ga0163162_126186862 | 104 |
| 512 | 3300013307 | Ga0157372_11008767 | Ga0157372_110087672 | 104 |
| 513 | 3300014969 | Ga0157376_12397327 | Ga0157376_123973272 | 104 |
| 514 | 3300020070 | Ga0206356_10096870 | Ga0206356_100968701 | 104 |
| 515 | 3300020070 | Ga0206356_10970685 | Ga0206356_109706852 | 104 |
| 516 | 3300020078 | Ga0206352_10076272 | Ga0206352_1007627219 | 104 |
| 517 | 3300020078 | Ga0206352_11128396 | Ga0206352_111283963 | 104 |
| 518 | 3300020081 | Ga0206354_10778596 | Ga0206354_107785962 | 104 |
| 519 | 3300020082 | Ga0206353_11142864 | Ga0206353_111428641 | 104 |
| 520 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029325 | 104 |
| 521 | 3300025909 | Ga0207705_10001453 | Ga0207705_1000145321 | 104 |
| 522 | 3300025911 | Ga0207654_10463730 | Ga0207654_104637302 | 104 |
| 523 | 3300025911 | Ga0207654_11454183 | Ga0207654_114541832 | 104 |
| 524 | 3300025912 | Ga0207707_10347458 | Ga0207707_103474582 | 104 |
| 525 | 3300025914 | Ga0207671_10001074 | Ga0207671_1000107424 | 104 |
| 526 | 3300025914 | Ga0207671_10055914 | Ga0207671_100559144 | 104 |
| 527 | 3300025919 | Ga0207657_10008060 | Ga0207657_1000806015 | 104 |
| 528 | 3300025921 | Ga0207652_10228861 | Ga0207652_102288612 | 104 |
| 529 | 3300025924 | Ga0207694_10464431 | Ga0207694_104644312 | 104 |
| 530 | 3300025928 | Ga0207700_10072432 | Ga0207700_100724326 | 104 |
| 531 | 3300025932 | Ga0207690_10268939 | Ga0207690_102689395 | 104 |
| 532 | 3300025932 | Ga0207690_10340918 | Ga0207690_103409182 | 104 |
| 533 | 3300025941 | Ga0207711_10071486 | Ga0207711_100714862 | 104 |
| 534 | 3300025949 | Ga0207667_10002756 | Ga0207667_1000275621 | 104 |
| 535 | 3300025949 | Ga0207667_10148768 | Ga0207667_101487685 | 104 |
| 536 | 3300025960 | Ga0207651_11845809 | Ga0207651_118458091 | 104 |
| 537 | 3300025981 | Ga0207640_10670427 | Ga0207640_106704272 | 104 |
| 538 | 3300026041 | Ga0207639_10956554 | Ga0207639_109565542 | 104 |
| 539 | 3300026041 | Ga0207639_11019033 | Ga0207639_110190332 | 104 |
| 540 | 3300026067 | Ga0207678_10022593 | Ga0207678_100225936 | 104 |
| 541 | 3300026078 | Ga0207702_11426348 | Ga0207702_114263482 | 104 |
| 542 | 3300026116 | Ga0207674_12125202 | Ga0207674_121252021 | 104 |
| 543 | 3300026142 | Ga0207698_10077237 | Ga0207698_100772373 | 104 |
| 544 | 3300026142 | Ga0207698_12275662 | Ga0207698_122756621 | 104 |
| 545 | 3300028379 | Ga0268266_10000321 | Ga0268266_1000032121 | 104 |
| 546 | 3300030760 | Ga0265762_1080043 | Ga0265762_10800432 | 104 |
| 547 | 3300031090 | Ga0265760_10157730 | Ga0265760_101577302 | 104 |
| 548 | 3300037068 | Ga0373925_0757100 | Ga0373925_0757100_19_390 | 104 |
| 549 | 3300045976 | Ga0466967_0169278 | Ga0466967_0169278_1078_1392 | 104 |
| 550 | 3300046543 | Ga0495645_0589234 | Ga0495645_0589234_113_484 | 104 |
| 551 | 3300060353 | Ga0501082_0000322 | Ga0501082_0000322_36130_36501 | 104 |
| 552 | 3300061719 | Ga0466962_0441157 | Ga0466962_0441157_299_613 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9577 | 5 | 37 |
| 5mmm-assembly1.cif.gz_V | structure of the 70s chloroplast ribosome | 0.9276 | 5 | 102 |
| 6eri-assembly1.cif.gz_AU | structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor | 0.9193 | 5 | 102 |
| 5mlc-assembly1.cif.gz_W | cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions | 0.9089 | 1 | 101 |
| 5h1s-assembly1.cif.gz_W | structure of the large subunit of the chloro-ribosome | 0.9089 | 4 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9439 | 4 | 98 | 2.30.30.30 |
| af_Q55D16_393_444_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9275 | 5 | 37 | 2.30.30.30 |
| af_Q8I5H8_47_152_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9243 | 5 | 97 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9071 | 4 | 98 | 2.30.30.30 |
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9037 | 4 | 98 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A6DEY5-F1-model_v4 | deleted | 0.9677 | 4 | 71 |
|
| AF-B9L6M2-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9676 | 4 | 71 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3N1YKF1-F1-model_v4 | deleted | 0.9663 | 4 | 71 |
|
| AF-Q11QC3-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9557 | 4 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A832CLV5-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9519 | 4 | 69 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar