F462704

General Info

Members Datasets Scaffolds Average Seq Length
552 260 551 118

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_102135397|Ga0070665_1021353971
Length 129
Sequence MAGRKAAGAKTGGRKKALAEPVRIRIKKNDTVKVIAGKDKGKTGRVLEVNQDTGRILVEGVQMIKRHTRPNPAKQIKGGIAEKESSIHASNVMVMTPGGVPTRIGYKVEKEGGVTRRTRIARKTGETLK

Samples

Sample ID Description Type Environment
1 2643221591 Devosia sp. Root685 Isolate Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
183 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
184 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 4.71
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 2.9
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000961 3300003214 Bacteria 19619
2 Ga0058863_10010406 3300004799 Bacteria 2657
3 Ga0058863_11587924 3300004799 Bacteria 716
4 Ga0058861_11690222 3300004800 Unclassified 674
5 Ga0058862_11737220 3300004803 Bacteria 836
6 Ga0058862_12843351 3300004803 Unclassified 917
7 Ga0070690_101445468 3300005330 Bacteria 554
8 Ga0070666_10102938 3300005335 Bacteria 1969
9 Ga0070666_10796447 3300005335 Bacteria 696
10 Ga0070680_100072638 3300005336 Bacteria 2828
11 Ga0070680_100287817 3300005336 Bacteria 1393
12 Ga0070680_100421425 3300005336 Bacteria 1139
13 Ga0070682_100352310 3300005337 Bacteria 1098
14 Ga0070682_100681905 3300005337 Bacteria 822
15 Ga0068868_100058678 3300005338 Bacteria 3042
16 Ga0070660_101227932 3300005339 Bacteria 636
17 Ga0070660_101227988 3300005339 Bacteria 636
18 Ga0070691_10212610 3300005341 Bacteria 1021
19 Ga0070692_10085623 3300005345 Bacteria 1705
20 Ga0070668_102193671 3300005347 Bacteria 510
21 Ga0070671_100981568 3300005355 Bacteria 740
22 Ga0070659_100853103 3300005366 Bacteria 794
23 Ga0070667_100096799 3300005367 Bacteria 2545
24 Ga0070667_100295936 3300005367 Bacteria 1456
25 Ga0070667_100639646 3300005367 Bacteria 982
26 Ga0070667_101017746 3300005367 Bacteria 773
27 Ga0070709_10204906 3300005434 Bacteria 1399
28 Ga0070709_10665610 3300005434 Bacteria 807
29 Ga0070709_11279138 3300005434 Bacteria 591
30 Ga0070713_100338754 3300005436 Bacteria 1393
31 Ga0070713_102306310 3300005436 Unclassified 521
32 Ga0070708_100631194 3300005445 Bacteria 1010
33 Ga0070663_100066762 3300005455 Bacteria 2607
34 Ga0070663_101022850 3300005455 Bacteria 719
35 Ga0070662_100505982 3300005457 Bacteria 1008
36 Ga0070681_10084584 3300005458 Bacteria 3125
37 Ga0070681_10169369 3300005458 Bacteria 2106
38 Ga0070681_10283993 3300005458 Bacteria 1566
39 Ga0070681_10307388 3300005458 Bacteria 1495
40 Ga0070681_11147217 3300005458 Unclassified 698
41 Ga0070681_11311227 3300005458 Unclassified 647
42 Ga0070681_12032957 3300005458 Bacteria 503
43 Ga0068867_100068643 3300005459 Bacteria 2646
44 Ga0068867_101081994 3300005459 Bacteria 731
45 Ga0070685_11605353 3300005466 Bacteria 503
46 Ga0070698_101840179 3300005471 Unclassified 558
47 Ga0070679_100030062 3300005530 Bacteria 5361
48 Ga0070679_100048764 3300005530 Bacteria 4218
49 Ga0070679_100418617 3300005530 Bacteria 1285
50 Ga0070679_100443699 3300005530 Bacteria 1242
51 Ga0070679_101313670 3300005530 Bacteria 669
52 Ga0070684_100324235 3300005535 Bacteria 1415
53 Ga0070684_100337792 3300005535 Bacteria 1384
54 Ga0070684_102307355 3300005535 Unclassified 507
55 Ga0068853_100017302 3300005539 Bacteria 5952
56 Ga0068853_100330010 3300005539 Bacteria 1415
57 Ga0068853_100796650 3300005539 Bacteria 905
58 Ga0068853_101307603 3300005539 Bacteria 701
59 Ga0070672_100640382 3300005543 Bacteria 928
60 Ga0070695_101344339 3300005545 Bacteria 591
61 Ga0070693_101072952 3300005547 Bacteria 613
62 Ga0070665_100138657 3300005548 Bacteria 2435
63 Ga0070665_100217892 3300005548 Bacteria 1909
64 Ga0070665_100225239 3300005548 Bacteria 1875
65 Ga0070665_100341650 3300005548 Bacteria 1502
66 Ga0070665_101133462 3300005548 Bacteria 793
67 Ga0070665_101383489 3300005548 Bacteria 713
68 Ga0070665_102135397 3300005548 Unclassified 564
69 Ga0068855_100018562 3300005563 Bacteria 8363
70 Ga0068855_100084797 3300005563 Bacteria 3667
71 Ga0068855_100135013 3300005563 Bacteria 2815
72 Ga0068855_100151277 3300005563 Bacteria 2639
73 Ga0068855_100811778 3300005563 Bacteria 993
74 Ga0068855_102016327 3300005563 Unclassified 583
75 Ga0070664_100055154 3300005564 Bacteria 3373
76 Ga0070664_100488332 3300005564 Bacteria 1134
77 Ga0070664_100572917 3300005564 Bacteria 1045
78 Ga0070664_101764062 3300005564 Unclassified 587
79 Ga0068857_100646626 3300005577 Bacteria 1002
80 Ga0068857_100839846 3300005577 Bacteria 878
81 Ga0068857_101465735 3300005577 Bacteria 665
82 Ga0068854_101021145 3300005578 Bacteria 733
83 Ga0068854_101472932 3300005578 Bacteria 617
84 Ga0068856_100009432 3300005614 Bacteria 9476
85 Ga0068856_100073064 3300005614 Bacteria 3396
86 Ga0068856_100200510 3300005614 Bacteria 2010
87 Ga0068856_100267581 3300005614 Bacteria 1725
88 Ga0068856_100326750 3300005614 Bacteria 1551
89 Ga0068856_100528183 3300005614 Bacteria 1201
90 Ga0068852_100565939 3300005616 Bacteria 1138
91 Ga0068852_100871218 3300005616 Bacteria 917
92 Ga0068852_101890105 3300005616 Bacteria 619
93 Ga0068859_100094099 3300005617 Bacteria 3048
94 Ga0068859_100847934 3300005617 Bacteria 1000
95 Ga0068864_100018412 3300005618 Bacteria 5835
96 Ga0068864_100429064 3300005618 Bacteria 1261
97 Ga0068864_101030018 3300005618 Bacteria 817
98 Ga0068866_10164217 3300005718 Bacteria 1298
99 Ga0068861_100250890 3300005719 Bacteria 1510
100 Ga0068861_100405337 3300005719 Bacteria 1211
101 Ga0068863_100016102 3300005841 Bacteria 7170
102 Ga0068863_100335315 3300005841 Bacteria 1471
103 Ga0068863_101508729 3300005841 Unclassified 681
104 Ga0068863_102250603 3300005841 Bacteria 555
105 Ga0068858_100030046 3300005842 Bacteria 5045
106 Ga0068858_100060954 3300005842 Bacteria 3487
107 Ga0068858_100423960 3300005842 Bacteria 1280
108 Ga0068858_101042353 3300005842 Bacteria 802
109 Ga0068860_100036229 3300005843 Bacteria 4728
110 Ga0068860_100755757 3300005843 Bacteria 984
111 Ga0068860_100930917 3300005843 Bacteria 886
112 Ga0081455_10386263 3300005937 Unclassified 976
113 Ga0070717_10033750 3300006028 Bacteria 4131
114 Ga0070717_10859219 3300006028 Bacteria 826
115 Ga0075365_10551026 3300006038 Bacteria 815
116 Ga0075364_10295262 3300006051 Bacteria 1103
117 Ga0070712_100511026 3300006175 Bacteria 1008
118 Ga0097621_100314685 3300006237 Bacteria 1385
119 Ga0097621_100850574 3300006237 Bacteria 847
120 Ga0097621_101025163 3300006237 Bacteria 773
121 Ga0097621_102163375 3300006237 Bacteria 532
122 Ga0068871_100193630 3300006358 Bacteria 1752
123 Ga0068871_100544580 3300006358 Bacteria 1050
124 Ga0068871_100603408 3300006358 Bacteria 998
125 Ga0068871_101131592 3300006358 Unclassified 733
126 Ga0068871_101947175 3300006358 Bacteria 559
127 Ga0075428_101617485 3300006844 Bacteria 677
128 Ga0075430_100033273 3300006846 Bacteria 4376
129 Ga0075431_100068526 3300006847 Bacteria 3662
130 Ga0075434_100242298 3300006871 Bacteria 1823
131 Ga0075429_100267471 3300006880 Bacteria 1497
132 Ga0068865_100113414 3300006881 Bacteria 2003
133 Ga0097620_100094100 3300006931 Bacteria 3048
134 Ga0097620_100848098 3300006931 Bacteria 1000
135 Ga0105240_10000499 3300009093 Bacteria 72315
136 Ga0105240_11022151 3300009093 Bacteria 883
137 Ga0105240_11466362 3300009093 Unclassified 716
138 Ga0105245_10234129 3300009098 Bacteria 1778
139 Ga0105245_10510093 3300009098 Bacteria 1220
140 Ga0105245_10948397 3300009098 Bacteria 903
141 Ga0114129_10375592 3300009147 Bacteria 1878
142 Ga0105243_10207725 3300009148 Bacteria 1722
143 Ga0105243_10497711 3300009148 Bacteria 1154
144 Ga0105241_10017868 3300009174 Bacteria 5216
145 Ga0105241_10116070 3300009174 Bacteria 2149
146 Ga0105241_10307637 3300009174 Bacteria 1362
147 Ga0105241_10358286 3300009174 Bacteria 1269
148 Ga0105241_10631040 3300009174 Bacteria 971
149 Ga0105241_10641622 3300009174 Bacteria 964
150 Ga0105241_12187915 3300009174 Bacteria 548
151 Ga0105242_11356956 3300009176 Bacteria 737
152 Ga0105242_11785462 3300009176 Bacteria 653
153 Ga0105242_11843140 3300009176 Bacteria 644
154 Ga0105248_10045011 3300009177 Bacteria 4949
155 Ga0105248_10438568 3300009177 Bacteria 1471
156 Ga0105248_10611825 3300009177 Bacteria 1229
157 Ga0105248_10964423 3300009177 Bacteria 963
158 Ga0105248_12890939 3300009177 Unclassified 547
159 Ga0105237_10002619 3300009545 Bacteria 22167
160 Ga0105237_10007763 3300009545 Bacteria 11701
161 Ga0105237_10047955 3300009545 Bacteria 4295
162 Ga0105237_10086917 3300009545 Bacteria 3117
163 Ga0105237_10221528 3300009545 Bacteria 1892
164 Ga0105237_10284777 3300009545 Bacteria 1655
165 Ga0105237_10357318 3300009545 Bacteria 1465
166 Ga0105237_10461628 3300009545 Bacteria 1276
167 Ga0105237_10498738 3300009545 Bacteria 1224
168 Ga0105237_10739499 3300009545 Bacteria 990
169 Ga0105237_10797399 3300009545 Bacteria 951
170 Ga0105238_10094337 3300009551 Bacteria 2980
171 Ga0105238_10636338 3300009551 Bacteria 1076
172 Ga0105238_10990376 3300009551 Bacteria 861
173 Ga0105238_11211882 3300009551 Bacteria 779
174 Ga0105238_11221281 3300009551 Bacteria 776
175 Ga0105238_11278296 3300009551 Bacteria 759
176 Ga0105238_11891438 3300009551 Bacteria 630
177 Ga0105238_12157697 3300009551 Bacteria 592
178 Ga0105238_12825968 3300009551 Bacteria 522
179 Ga0105249_10103809 3300009553 Bacteria 2678
180 Ga0105239_10012303 3300010375 Bacteria 9531
181 Ga0105239_10061221 3300010375 Bacteria 4131
182 Ga0105239_10236062 3300010375 Unclassified 2052
183 Ga0105239_10526954 3300010375 Bacteria 1344
184 Ga0105239_10592207 3300010375 Bacteria 1264
185 Ga0105239_10632459 3300010375 Bacteria 1222
186 Ga0105239_10902550 3300010375 Bacteria 1014
187 Ga0105239_11010016 3300010375 Bacteria 956
188 Ga0105239_11032254 3300010375 Bacteria 946
189 Ga0105239_11070745 3300010375 Bacteria 928
190 Ga0105239_11095099 3300010375 Bacteria 917
191 Ga0105239_13382250 3300010375 Unclassified 519
192 Ga0105246_10123544 3300011119 Bacteria 1922
193 Ga0157373_10190846 3300013100 Bacteria 1444
194 Ga0157371_10024961 3300013102 Bacteria 4362
195 Ga0157370_11623581 3300013104 Unclassified 581
196 Ga0157369_10004638 3300013105 Bacteria 16148
197 Ga0157369_10033746 3300013105 Bacteria 5621
198 Ga0157369_10157491 3300013105 Bacteria 2398
199 Ga0157369_10242494 3300013105 Bacteria 1882
200 Ga0157369_10595136 3300013105 Bacteria 1142
201 Ga0157369_11533474 3300013105 Bacteria 678
202 Ga0157369_12575534 3300013105 Bacteria 514
203 Ga0157374_10030570 3300013296 Bacteria 4892
204 Ga0157374_12492985 3300013296 Unclassified 545
205 Ga0157374_12962595 3300013296 Unclassified 502
206 Ga0157378_10229478 3300013297 Bacteria 1768
207 Ga0157378_10291716 3300013297 Bacteria 1576
208 Ga0157378_10293253 3300013297 Bacteria 1572
209 Ga0157378_10440451 3300013297 Bacteria 1291
210 Ga0157378_11981799 3300013297 Bacteria 632
211 Ga0157378_12452433 3300013297 Bacteria 573
212 Ga0157378_12720737 3300013297 Bacteria 547
213 Ga0163162_12618686 3300013306 Bacteria 580
214 Ga0157372_10601174 3300013307 Bacteria 1282
215 Ga0157372_11008767 3300013307 Bacteria 964
216 Ga0157372_11118920 3300013307 Bacteria 911
217 Ga0157372_11216088 3300013307 Bacteria 870
218 Ga0157372_11804768 3300013307 Unclassified 703
219 Ga0157372_12231672 3300013307 Unclassified 629
220 Ga0157375_10103709 3300013308 Bacteria 2931
221 Ga0157375_11184528 3300013308 Bacteria 896
222 Ga0163163_10753571 3300014325 Bacteria 1037
223 Ga0163163_12159637 3300014325 Unclassified 616
224 Ga0157379_10194166 3300014968 Bacteria 1835
225 Ga0157379_11081170 3300014968 Bacteria 768
226 Ga0157376_10087903 3300014969 Bacteria 2683
227 Ga0157376_10108272 3300014969 Bacteria 2441
228 Ga0157376_10437357 3300014969 Bacteria 1273
229 Ga0157376_11222967 3300014969 Bacteria 780
230 Ga0157376_12397327 3300014969 Bacteria 567
231 Ga0197907_10880964 3300020069 Unclassified 925
232 Ga0206356_10096870 3300020070 Bacteria 954
233 Ga0206356_10970685 3300020070 Bacteria 859
234 Ga0206356_11605749 3300020070 Bacteria 509
235 Ga0206352_10076272 3300020078 Bacteria 16136
236 Ga0206352_10460690 3300020078 Bacteria 575
237 Ga0206352_11128396 3300020078 Bacteria 2195
238 Ga0206350_11563687 3300020080 Bacteria 618
239 Ga0206354_10778596 3300020081 Bacteria 1095
240 Ga0206353_11142864 3300020082 Bacteria 840
241 Ga0213874_10048447 3300021377 Bacteria 1296
242 Ga0213876_10441877 3300021384 Bacteria 692
243 Ga0213875_10005759 3300021388 Bacteria 6598
244 Ga0213875_10045320 3300021388 Bacteria 2064
245 Ga0213875_10069891 3300021388 Bacteria 1639
246 Ga0213875_10197171 3300021388 Bacteria 947
247 Ga0213875_10333567 3300021388 Bacteria 719
248 Ga0224712_10486813 3300022467 Bacteria 595
249 Ga0224712_10543632 3300022467 Bacteria 564
250 Ga0209233_1000293 3300025261 Bacteria 63470
251 Ga0207656_10510455 3300025321 Bacteria 611
252 Ga0207642_10184590 3300025899 Bacteria 1139
253 Ga0207680_10019671 3300025903 Bacteria 3615
254 Ga0207647_10010255 3300025904 Bacteria 6620
255 Ga0207647_10181916 3300025904 Bacteria 1220
256 Ga0207699_10205929 3300025906 Bacteria 1335
257 Ga0207705_10001453 3300025909 Bacteria 18913
258 Ga0207705_10057980 3300025909 Bacteria 2794
259 Ga0207654_10041690 3300025911 Bacteria 2594
260 Ga0207654_10463730 3300025911 Bacteria 890
261 Ga0207654_10648728 3300025911 Unclassified 756
262 Ga0207654_11134319 3300025911 Bacteria 570
263 Ga0207654_11454183 3300025911 Bacteria 500
264 Ga0207707_10063636 3300025912 Bacteria 3211
265 Ga0207707_10113466 3300025912 Bacteria 2368
266 Ga0207707_10173157 3300025912 Bacteria 1886
267 Ga0207707_10347458 3300025912 Bacteria 1278
268 Ga0207707_10419917 3300025912 Bacteria 1147
269 Ga0207695_10008431 3300025913 Bacteria 12906
270 Ga0207695_10140217 3300025913 Bacteria 2367
271 Ga0207695_10342860 3300025913 Bacteria 1382
272 Ga0207695_11030362 3300025913 Unclassified 703
273 Ga0207671_10001074 3300025914 Bacteria 33173
274 Ga0207671_10017757 3300025914 Bacteria 5476
275 Ga0207671_10055914 3300025914 Bacteria 2924
276 Ga0207671_10060155 3300025914 Bacteria 2818
277 Ga0207671_10094035 3300025914 Bacteria 2262
278 Ga0207671_10300698 3300025914 Bacteria 1268
279 Ga0207671_11025134 3300025914 Bacteria 650
280 Ga0207663_10640053 3300025916 Bacteria 838
281 Ga0207657_10008060 3300025919 Bacteria 10742
282 Ga0207657_10050665 3300025919 Bacteria 3613
283 Ga0207657_10063775 3300025919 Bacteria 3148
284 Ga0207657_10331518 3300025919 Bacteria 1202
285 Ga0207649_10032767 3300025920 Bacteria 3100
286 Ga0207649_10696864 3300025920 Unclassified 787
287 Ga0207652_10096220 3300025921 Bacteria 2608
288 Ga0207652_10228861 3300025921 Bacteria 1675
289 Ga0207652_10279989 3300025921 Bacteria 1504
290 Ga0207652_10369965 3300025921 Bacteria 1294
291 Ga0207652_11325523 3300025921 Bacteria 623
292 Ga0207694_10464431 3300025924 Bacteria 1058
293 Ga0207694_10520951 3300025924 Bacteria 996
294 Ga0207694_10573243 3300025924 Bacteria 948
295 Ga0207687_10194230 3300025927 Bacteria 1582
296 Ga0207687_10402687 3300025927 Bacteria 1126
297 Ga0207700_10072432 3300025928 Bacteria 2657
298 Ga0207700_10710310 3300025928 Bacteria 897
299 Ga0207664_10726910 3300025929 Bacteria 893
300 Ga0207644_10291825 3300025931 Bacteria 1312
301 Ga0207690_10120468 3300025932 Bacteria 1905
302 Ga0207690_10172572 3300025932 Bacteria 1621
303 Ga0207690_10268939 3300025932 Bacteria 1323
304 Ga0207690_10340918 3300025932 Bacteria 1183
305 Ga0207706_11397236 3300025933 Unclassified 575
306 Ga0207686_10311570 3300025934 Bacteria 1173
307 Ga0207686_10462219 3300025934 Bacteria 978
308 Ga0207709_10108056 3300025935 Bacteria 1854
309 Ga0207704_10233860 3300025938 Bacteria 1368
310 Ga0207665_10968425 3300025939 Bacteria 676
311 Ga0207691_10540892 3300025940 Bacteria 988
312 Ga0207711_10071486 3300025941 Bacteria 3010
313 Ga0207711_10091511 3300025941 Bacteria 2676
314 Ga0207711_10132896 3300025941 Bacteria 2233
315 Ga0207711_10306669 3300025941 Bacteria 1465
316 Ga0207711_11572745 3300025941 Bacteria 601
317 Ga0207689_10111916 3300025942 Bacteria 2244
318 Ga0207661_10225484 3300025944 Bacteria 1658
319 Ga0207679_10547783 3300025945 Bacteria 1038
320 Ga0207667_10002756 3300025949 Bacteria 21724
321 Ga0207667_10068480 3300025949 Bacteria 3696
322 Ga0207667_10114447 3300025949 Bacteria 2780
323 Ga0207667_10148768 3300025949 Bacteria 2410
324 Ga0207667_10436094 3300025949 Unclassified 1332
325 Ga0207667_11387472 3300025949 Bacteria 676
326 Ga0207667_11535863 3300025949 Unclassified 636
327 Ga0207651_11845809 3300025960 Bacteria 544
328 Ga0207640_10631814 3300025981 Bacteria 910
329 Ga0207640_10670427 3300025981 Bacteria 886
330 Ga0207640_11152549 3300025981 Bacteria 688
331 Ga0207658_10055258 3300025986 Bacteria 2942
332 Ga0207658_10437822 3300025986 Bacteria 1155
333 Ga0207658_10560801 3300025986 Bacteria 1023
334 Ga0207658_11235217 3300025986 Bacteria 683
335 Ga0207677_10483582 3300026023 Bacteria 1067
336 Ga0207703_10019029 3300026035 Bacteria 5364
337 Ga0207703_10064766 3300026035 Bacteria 3001
338 Ga0207703_10272200 3300026035 Bacteria 1535
339 Ga0207639_10058554 3300026041 Bacteria 2964
340 Ga0207639_10105527 3300026041 Bacteria 2286
341 Ga0207639_10956554 3300026041 Bacteria 801
342 Ga0207639_10992341 3300026041 Bacteria 786
343 Ga0207639_11019033 3300026041 Bacteria 776
344 Ga0207678_10009839 3300026067 Bacteria 8402
345 Ga0207678_10022593 3300026067 Bacteria 5509
346 Ga0207678_10590067 3300026067 Bacteria 974
347 Ga0207702_10007772 3300026078 Bacteria 9104
348 Ga0207702_10015414 3300026078 Bacteria 6331
349 Ga0207702_10030901 3300026078 Bacteria 4463
350 Ga0207702_10043789 3300026078 Bacteria 3760
351 Ga0207702_10228952 3300026078 Bacteria 1736
352 Ga0207702_10499911 3300026078 Bacteria 1185
353 Ga0207702_11160057 3300026078 Unclassified 767
354 Ga0207702_11426348 3300026078 Bacteria 686
355 Ga0207641_10011436 3300026088 Bacteria 7285
356 Ga0207641_10023693 3300026088 Bacteria 5058
357 Ga0207641_10197637 3300026088 Bacteria 1852
358 Ga0207648_10308547 3300026089 Bacteria 1420
359 Ga0207676_10009610 3300026095 Bacteria 6885
360 Ga0207676_10086376 3300026095 Bacteria 2563
361 Ga0207676_10351270 3300026095 Bacteria 1364
362 Ga0207676_10600908 3300026095 Bacteria 1057
363 Ga0207674_10013233 3300026116 Bacteria 9170
364 Ga0207674_12021362 3300026116 Bacteria 541
365 Ga0207674_12125202 3300026116 Bacteria 525
366 Ga0207698_10077237 3300026142 Bacteria 2669
367 Ga0207698_12275662 3300026142 Bacteria 554
368 Ga0268266_10000321 3300028379 Bacteria 75565
369 Ga0268266_10370969 3300028379 Bacteria 1348
370 Ga0268266_10561309 3300028379 Bacteria 1094
371 Ga0268266_11727742 3300028379 Bacteria 601
372 Ga0268264_10060239 3300028381 Bacteria 3181
373 Ga0268264_10571705 3300028381 Bacteria 1111
374 Ga0268264_10951624 3300028381 Bacteria 864
375 Ga0265326_10054192 3300028558 Bacteria 1135
376 Ga0265318_10068893 3300028577 Bacteria 1312
377 Ga0307515_10201561 3300028794 Bacteria 1864
378 Ga0265338_10097186 3300028800 Bacteria 2414
379 Ga0265762_1080043 3300030760 Bacteria 698
380 Ga0265760_10157730 3300031090 Bacteria 747
381 Ga0265320_10021417 3300031240 Bacteria 3477
382 Ga0265325_10234454 3300031241 Bacteria 836
383 Ga0265339_10141364 3300031249 Bacteria 1224
384 Ga0265331_10077798 3300031250 Bacteria 1545
385 Ga0307513_10343349 3300031456 Bacteria 1243
386 Ga0265313_10171480 3300031595 Bacteria 916
387 Ga0265313_10245930 3300031595 Bacteria 731
388 Ga0265314_10009286 3300031711 Bacteria 8330
389 Ga0265314_10077276 3300031711 Bacteria 2209
390 Ga0265314_10272587 3300031711 Bacteria 961
391 Ga0265342_10052436 3300031712 Bacteria 2431
392 Ga0265342_10064957 3300031712 Bacteria 2140
393 Ga0307413_10578933 3300031824 Bacteria 915
394 Ga0307406_10024184 3300031901 Bacteria 3625
395 Ga0307412_12193671 3300031911 Bacteria 514
396 Ga0307409_100451110 3300031995 Bacteria 1241
397 Ga0307414_10861318 3300032004 Bacteria 829
398 Ga0307414_11022067 3300032004 Bacteria 761
399 Ga0307414_11171071 3300032004 Bacteria 711
400 Ga0316586_1005355 3300033527 Bacteria 1799
401 Ga0373930_0058782 3300034816 Bacteria 854
402 Ga0373926_0106121 3300035083 Bacteria 1053
403 Ga0373926_0115693 3300035083 Bacteria 1009
404 Ga0373941_0314050 3300035115 Bacteria 629
405 Ga0373943_0037025 3300035170 Bacteria 2340
406 Ga0373946_0024372 3300035171 Bacteria 2371
407 Ga0373931_1123457 3300035691 Bacteria 536
408 Ga0373927_0022764 3300035695 Bacteria 4103
409 Ga0373927_0036356 3300035695 Bacteria 3203
410 Ga0373947_0013403 3300035725 Bacteria 4698
411 Ga0373947_1252674 3300035725 Bacteria 505
412 Ga0373937_0111079 3300036401 Bacteria 2550
413 Ga0373937_0677496 3300036401 Bacteria 977
414 Ga0373937_2127687 3300036401 Unclassified 507
415 Ga0316584_0652921 3300036712 Bacteria 725
416 Ga0373925_0007421 3300037068 Bacteria 8000
417 Ga0373925_0757100 3300037068 Bacteria 801
418 Ga0373925_0810765 3300037068 Bacteria 772
419 Ga0373925_0935393 3300037068 Bacteria 714
420 Ga0395900_0619767 3300037418 Unclassified 1021
421 Ga0395898_0536997 3300037466 Bacteria 1111
422 Ga0395905_0286632 3300037471 Bacteria 1534
423 Ga0395905_0668455 3300037471 Bacteria 941
424 Ga0436364_0026865 3300037853 Bacteria 1683
425 Ga0436364_0125100 3300037853 Bacteria 1115
426 Ga0436364_0240413 3300037853 Bacteria 9540
427 Ga0436364_0419855 3300037853 Bacteria 847
428 Ga0436364_0578648 3300037853 Unclassified 610
429 Ga0436364_0894178 3300037853 Bacteria 2420
430 Ga0436364_1006134 3300037853 Bacteria 1482
431 Ga0436364_1054367 3300037853 Bacteria 18076
432 Ga0436364_1121262 3300037853 Bacteria 32436
433 Ga0436364_1393988 3300037853 Bacteria 3361
434 Ga0436364_1400193 3300037853 Bacteria 4067
435 Ga0395901_0291374 3300038443 Bacteria 1694
436 Ga0436365_0140127 3300039437 Bacteria 1319
437 Ga0436365_0200225 3300039437 Bacteria 757
438 Ga0436365_0821682 3300039437 Bacteria 7072
439 Ga0436365_1262762 3300039437 Bacteria 8818
440 Ga0436365_1721656 3300039437 Bacteria 756
441 Ga0436365_1887503 3300039437 Bacteria 769
442 Ga0436360_0584444 3300039438 Bacteria 1690
443 Ga0436360_1049432 3300039438 Bacteria 686
444 Ga0436363_0345243 3300039450 Bacteria 1374
445 Ga0436363_0431750 3300039450 Unclassified 1120
446 Ga0436363_1096749 3300039450 Bacteria 571
447 Ga0436363_1351619 3300039450 Bacteria 2929
448 Ga0436363_1621856 3300039450 Bacteria 1096
449 Ga0436362_0534029 3300039453 Bacteria 1505
450 Ga0451787_123607 3300041441 Bacteria 651
451 Ga0451787_300709 3300041441 Bacteria 800
452 Ga0451787_315941 3300041441 Bacteria 728
453 Ga0451795_0769616 3300041456 Bacteria 1150
454 Ga0451808_34490 3300041464 Bacteria 611
455 Ga0451807_0475875 3300041486 Unclassified 621
456 Ga0451841_0349496 3300041498 Bacteria 793
457 Ga0451855_0059144 3300041511 Bacteria 905
458 Ga0451853_0975994 3300041512 Bacteria 917
459 Ga0439431_0029306 3300041997 Bacteria 1359
460 Ga0451577_1562387 3300042876 Bacteria 583
461 Ga0466969_0558443 3300044656 Bacteria 524
462 Ga0466965_0819667 3300044683 Bacteria 539
463 Ga0466966_0017481 3300044684 Bacteria 4737
464 Ga0466961_0260078 3300044693 Bacteria 1064
465 Ga0466961_0277874 3300044693 Bacteria 1025
466 Ga0466961_0280150 3300044693 Bacteria 1020
467 Ga0466961_0388179 3300044693 Bacteria 848
468 Ga0466963_0565210 3300044694 Bacteria 803
469 Ga0466963_1331630 3300044694 Unclassified 504
470 Ga0453684_0464818 3300044712 Bacteria 1406
471 Ga0466970_0206926 3300044765 Bacteria 1092
472 Ga0466970_0581394 3300044765 Bacteria 649
473 Ga0466970_0745036 3300044765 Bacteria 572
474 Ga0466957_0963322 3300044842 Bacteria 612
475 Ga0466959_0072475 3300045049 Bacteria 2493
476 Ga0466958_0050425 3300045836 Bacteria 2520
477 Ga0466958_0230842 3300045836 Bacteria 1182
478 Ga0466967_0169278 3300045976 Bacteria 2055
479 Ga0466967_0610353 3300045976 Bacteria 1077
480 Ga0466967_0703486 3300045976 Bacteria 1001
481 Ga0495580_0035122 3300046472 Bacteria 3605
482 Ga0495580_0303839 3300046472 Bacteria 1086
483 Ga0495582_0270634 3300046473 Bacteria 975
484 Ga0495666_0398497 3300046526 Bacteria 618
485 Ga0495665_0058621 3300046531 Bacteria 2033
486 Ga0495665_0465519 3300046531 Bacteria 638
487 Ga0495645_0589234 3300046543 Bacteria 685
488 Ga0495656_0648452 3300046615 Bacteria 567
489 Ga0495635_0115216 3300046663 Bacteria 1835
490 Ga0495658_0183328 3300046683 Bacteria 1299
491 Ga0495624_0677555 3300046690 Bacteria 613
492 Ga0495670_0163925 3300046691 Bacteria 1168
493 Ga0495636_0199904 3300047318 Bacteria 912
494 Ga0495593_0124579 3300047673 Bacteria 1310
495 Ga0495602_1066728 3300048088 Unclassified 531
496 Ga0496101_0374400 3300048904 Bacteria 1120
497 Ga0496105_0502990 3300048908 Bacteria 951
498 Ga0496106_0930185 3300048909 Bacteria 686
499 Ga0496106_1202591 3300048909 Unclassified 591
500 Ga0496107_1357773 3300048910 Unclassified 507
501 Ga0496110_0497506 3300048913 Bacteria 1110
502 Ga0496111_0048615 3300048914 Bacteria 3056
503 Ga0496112_0008575 3300048915 Bacteria 9163
504 Ga0496115_0011601 3300048918 Bacteria 6609
505 Ga0496115_0035714 3300048918 Bacteria 3934
506 Ga0496116_0146828 3300048919 Bacteria 1317
507 Ga0496118_0109853 3300048921 Bacteria 1834
508 Ga0496118_0221485 3300048921 Bacteria 1101
509 Ga0496118_0319084 3300048921 Bacteria 844
510 Ga0496122_0294434 3300048925 Bacteria 879
511 Ga0496124_0835150 3300048927 Bacteria 566
512 Ga0496125_0000815 3300048928 Bacteria 50702
513 Ga0501319_015186 3300049535 Bacteria 652
514 Ga0501031_0554376 3300049568 Bacteria 740
515 Ga0501032_0276586 3300049569 Bacteria 1087
516 Ga0501033_0837683 3300049570 Bacteria 620
517 Ga0501034_0010656 3300049571 Bacteria 9554
518 Ga0501034_0058419 3300049571 Bacteria 3877
519 Ga0501037_0052409 3300049573 Bacteria 2984
520 Ga0501038_0006023 3300049574 Bacteria 11222
521 Ga0501043_0105319 3300049579 Bacteria 2216
522 Ga0501046_0318591 3300049580 Bacteria 1133
523 Ga0501046_0926196 3300049580 Bacteria 607
524 Ga0501047_0038476 3300049581 Bacteria 4628
525 Ga0501048_0086023 3300049582 Bacteria 2218
526 Ga0501070_0006487 3300049586 Bacteria 9959
527 Ga0501073_0198962 3300049589 Bacteria 1386
528 Ga0501074_0043689 3300049590 Bacteria 3244
529 Ga0501256_022223 3300049685 Unclassified 673
530 Ga0501080_0070674 3300049742 Bacteria 3247
531 Ga0501080_1627891 3300049742 Bacteria 546
532 Ga0501083_0160511 3300049744 Bacteria 1471
533 Ga0501035_0028540 3300049822 Bacteria 5093
534 Ga0501044_0010929 3300049823 Bacteria 9853
535 Ga0501044_0073393 3300049823 Bacteria 3478
536 nmdc:mga0yw44_852520_c1 3300050492 Bacteria 618
537 nmdc:mga05p37_221970_c1 3300050507 Bacteria 2280
538 nmdc:mga0qj67_136084_c1 3300050509 Bacteria 1991
539 nmdc:mga06r32_10773_c1 3300050510 Bacteria 8236
540 nmdc:mga0n895_398993_c1 3300050512 Unclassified 1391
541 Ga0495601_0311785 3300053077 Bacteria 1025
542 Ga0495619_1097865 3300053085 Bacteria 529
543 Ga0500568_0002264 3300053139 Bacteria 11497
544 Ga0500604_0069550 3300053151 Bacteria 1120
545 Ga0587093_084890 3300059478 Bacteria 551
546 Ga0587088_015178 3300059508 Bacteria 1210
547 Ga0587072_003068 3300059643 Bacteria 2312
548 Ga0587072_014285 3300059643 Bacteria 1336
549 Ga0501082_0000322 3300060353 Bacteria 42523
550 Ga0466962_0194683 3300061719 Bacteria 989
551 Ga0466962_0441157 3300061719 Bacteria 655

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0926196 Ga0501046_0926196_164_490 83
2 3300026095 Ga0207676_10351270 Ga0207676_103512702 84
3 3300005347 Ga0070668_102193671 Ga0070668_1021936711 91
4 3300005459 Ga0068867_101081994 Ga0068867_1010819942 91
5 3300005719 Ga0068861_100405337 Ga0068861_1004053372 91
6 3300005842 Ga0068858_100423960 Ga0068858_1004239602 91
7 3300005843 Ga0068860_100755757 Ga0068860_1007557572 91
8 3300009551 Ga0105238_11278296 Ga0105238_112782962 91
9 3300010375 Ga0105239_11032254 Ga0105239_110322542 91
10 3300013308 Ga0157375_11184528 Ga0157375_111845282 91
11 3300026035 Ga0207703_10272200 Ga0207703_102722002 91
12 3300026041 Ga0207639_10058554 Ga0207639_100585541 91
13 3300005367 Ga0070667_100639646 Ga0070667_1006396461 92
14 3300005548 Ga0070665_100138657 Ga0070665_1001386575 92
15 3300009093 Ga0105240_11022151 Ga0105240_110221511 92
16 3300025986 Ga0207658_10560801 Ga0207658_105608012 92
17 3300028379 Ga0268266_10561309 Ga0268266_105613092 92
18 3300031712 Ga0265342_10064957 Ga0265342_100649572 92
19 3300013296 Ga0157374_12962595 Ga0157374_129625952 93
20 3300042876 Ga0451577_1562387 Ga0451577_1562387_151_531 93
21 3300005367 Ga0070667_100295936 Ga0070667_1002959362 96
22 3300005614 Ga0068856_100528183 Ga0068856_1005281833 96
23 3300005842 Ga0068858_100030046 Ga0068858_1000300466 96
24 3300005843 Ga0068860_100930917 Ga0068860_1009309172 96
25 3300006237 Ga0097621_100314685 Ga0097621_1003146852 96
26 3300006358 Ga0068871_100193630 Ga0068871_1001936303 96
27 3300006358 Ga0068871_101131592 Ga0068871_1011315922 96
28 3300009098 Ga0105245_10510093 Ga0105245_105100932 96
29 3300009177 Ga0105248_10964423 Ga0105248_109644232 96
30 3300009177 Ga0105248_12890939 Ga0105248_128909391 96
31 3300013297 Ga0157378_10229478 Ga0157378_102294781 96
32 3300013297 Ga0157378_10440451 Ga0157378_104404512 96
33 3300013297 Ga0157378_12720737 Ga0157378_127207372 96
34 3300014968 Ga0157379_10194166 Ga0157379_101941662 96
35 3300020080 Ga0206350_11563687 Ga0206350_115636872 96
36 3300021388 Ga0213875_10197171 Ga0213875_101971712 96
37 3300025927 Ga0207687_10402687 Ga0207687_104026872 96
38 3300025941 Ga0207711_10132896 Ga0207711_101328965 96
39 3300025941 Ga0207711_11572745 Ga0207711_115727452 96
40 3300025986 Ga0207658_11235217 Ga0207658_112352172 96
41 3300026035 Ga0207703_10019029 Ga0207703_100190298 96
42 3300026078 Ga0207702_10228952 Ga0207702_102289522 96
43 3300028381 Ga0268264_10571705 Ga0268264_105717052 96
44 3300037853 Ga0436364_0125100 Ga0436364_0125100_77_394 96
45 3300039437 Ga0436365_0140127 Ga0436365_0140127_678_995 96
46 3300046690 Ga0495624_0677555 Ga0495624_0677555_76_444 96
47 3300048909 Ga0496106_0930185 Ga0496106_0930185_178_546 96
48 3300005330 Ga0070690_101445468 Ga0070690_1014454681 97
49 3300005335 Ga0070666_10102938 Ga0070666_101029384 97
50 3300005338 Ga0068868_100058678 Ga0068868_1000586784 97
51 3300005339 Ga0070660_101227988 Ga0070660_1012279881 97
52 3300005355 Ga0070671_100981568 Ga0070671_1009815682 97
53 3300005367 Ga0070667_100096799 Ga0070667_1000967994 97
54 3300005445 Ga0070708_100631194 Ga0070708_1006311942 97
55 3300005457 Ga0070662_100505982 Ga0070662_1005059822 97
56 3300005458 Ga0070681_10084584 Ga0070681_100845842 97
57 3300005458 Ga0070681_11147217 Ga0070681_111472171 97
58 3300005458 Ga0070681_12032957 Ga0070681_120329571 97
59 3300005459 Ga0068867_100068643 Ga0068867_1000686433 97
60 3300005471 Ga0070698_101840179 Ga0070698_1018401791 97
61 3300005530 Ga0070679_100030062 Ga0070679_1000300626 97
62 3300005530 Ga0070679_101313670 Ga0070679_1013136702 97
63 3300005535 Ga0070684_100337792 Ga0070684_1003377922 97
64 3300005539 Ga0068853_100330010 Ga0068853_1003300102 97
65 3300005547 Ga0070693_101072952 Ga0070693_1010729522 97
66 3300005548 Ga0070665_100217892 Ga0070665_1002178922 97
67 3300005548 Ga0070665_101133462 Ga0070665_1011334622 97
68 3300005563 Ga0068855_100135013 Ga0068855_1001350135 97
69 3300005563 Ga0068855_100811778 Ga0068855_1008117782 97
70 3300005577 Ga0068857_100839846 Ga0068857_1008398462 97
71 3300005577 Ga0068857_101465735 Ga0068857_1014657352 97
72 3300005614 Ga0068856_100073064 Ga0068856_1000730642 97
73 3300005614 Ga0068856_100326750 Ga0068856_1003267504 97
74 3300005618 Ga0068864_100018412 Ga0068864_1000184126 97
75 3300005618 Ga0068864_100429064 Ga0068864_1004290641 97
76 3300005718 Ga0068866_10164217 Ga0068866_101642172 97
77 3300005841 Ga0068863_100335315 Ga0068863_1003353154 97
78 3300005841 Ga0068863_101508729 Ga0068863_1015087292 97
79 3300005842 Ga0068858_100060954 Ga0068858_1000609545 97
80 3300005843 Ga0068860_100036229 Ga0068860_1000362298 97
81 3300006237 Ga0097621_100850574 Ga0097621_1008505741 97
82 3300006358 Ga0068871_100544580 Ga0068871_1005445802 97
83 3300006358 Ga0068871_100603408 Ga0068871_1006034082 97
84 3300006881 Ga0068865_100113414 Ga0068865_1001134144 97
85 3300009093 Ga0105240_11466362 Ga0105240_114663622 97
86 3300009098 Ga0105245_10234129 Ga0105245_102341295 97
87 3300009098 Ga0105245_10948397 Ga0105245_109483972 97
88 3300009148 Ga0105243_10207725 Ga0105243_102077253 97
89 3300009148 Ga0105243_10497711 Ga0105243_104977112 97
90 3300009174 Ga0105241_10017868 Ga0105241_100178684 97
91 3300009174 Ga0105241_10307637 Ga0105241_103076373 97
92 3300009174 Ga0105241_10641622 Ga0105241_106416222 97
93 3300009174 Ga0105241_12187915 Ga0105241_121879152 97
94 3300009176 Ga0105242_11356956 Ga0105242_113569562 97
95 3300009176 Ga0105242_11785462 Ga0105242_117854622 97
96 3300009176 Ga0105242_11843140 Ga0105242_118431402 97
97 3300009177 Ga0105248_10438568 Ga0105248_104385684 97
98 3300009177 Ga0105248_10611825 Ga0105248_106118253 97
99 3300009545 Ga0105237_10047955 Ga0105237_100479559 97
100 3300009545 Ga0105237_10284777 Ga0105237_102847772 97
101 3300009545 Ga0105237_10461628 Ga0105237_104616282 97
102 3300009545 Ga0105237_10739499 Ga0105237_107394992 97
103 3300009551 Ga0105238_10094337 Ga0105238_100943377 97
104 3300009551 Ga0105238_10636338 Ga0105238_106363383 97
105 3300009551 Ga0105238_10990376 Ga0105238_109903762 97
106 3300009551 Ga0105238_11221281 Ga0105238_112212812 97
107 3300009551 Ga0105238_11891438 Ga0105238_118914381 97
108 3300010375 Ga0105239_10592207 Ga0105239_105922072 97
109 3300010375 Ga0105239_11010016 Ga0105239_110100162 97
110 3300010375 Ga0105239_11070745 Ga0105239_110707452 97
111 3300010375 Ga0105239_11095099 Ga0105239_110950992 97
112 3300010375 Ga0105239_13382250 Ga0105239_133822501 97
113 3300011119 Ga0105246_10123544 Ga0105246_101235442 97
114 3300013296 Ga0157374_12492985 Ga0157374_124929852 97
115 3300013297 Ga0157378_10291716 Ga0157378_102917163 97
116 3300013307 Ga0157372_10601174 Ga0157372_106011743 97
117 3300013307 Ga0157372_11118920 Ga0157372_111189202 97
118 3300013307 Ga0157372_11216088 Ga0157372_112160882 97
119 3300013308 Ga0157375_10103709 Ga0157375_101037095 97
120 3300014325 Ga0163163_10753571 Ga0163163_107535712 97
121 3300014325 Ga0163163_12159637 Ga0163163_121596372 97
122 3300014968 Ga0157379_11081170 Ga0157379_110811703 97
123 3300014969 Ga0157376_11222967 Ga0157376_112229672 97
124 3300020070 Ga0206356_11605749 Ga0206356_116057491 97
125 3300022467 Ga0224712_10543632 Ga0224712_105436322 97
126 3300025321 Ga0207656_10510455 Ga0207656_105104552 97
127 3300025899 Ga0207642_10184590 Ga0207642_101845902 97
128 3300025903 Ga0207680_10019671 Ga0207680_100196718 97
129 3300025904 Ga0207647_10010255 Ga0207647_100102552 97
130 3300025911 Ga0207654_10041690 Ga0207654_100416903 97
131 3300025911 Ga0207654_11134319 Ga0207654_111343192 97
132 3300025912 Ga0207707_10063636 Ga0207707_100636362 97
133 3300025913 Ga0207695_11030362 Ga0207695_110303622 97
134 3300025914 Ga0207671_10060155 Ga0207671_100601555 97
135 3300025914 Ga0207671_10094035 Ga0207671_100940355 97
136 3300025914 Ga0207671_10300698 Ga0207671_103006982 97
137 3300025916 Ga0207663_10640053 Ga0207663_106400531 97
138 3300025919 Ga0207657_10050665 Ga0207657_100506658 97
139 3300025919 Ga0207657_10331518 Ga0207657_103315182 97
140 3300025920 Ga0207649_10696864 Ga0207649_106968642 97
141 3300025921 Ga0207652_10096220 Ga0207652_100962202 97
142 3300025921 Ga0207652_11325523 Ga0207652_113255232 97
143 3300025924 Ga0207694_10573243 Ga0207694_105732432 97
144 3300025927 Ga0207687_10194230 Ga0207687_101942303 97
145 3300025932 Ga0207690_10120468 Ga0207690_101204681 97
146 3300025933 Ga0207706_11397236 Ga0207706_113972362 97
147 3300025934 Ga0207686_10311570 Ga0207686_103115702 97
148 3300025934 Ga0207686_10462219 Ga0207686_104622192 97
149 3300025935 Ga0207709_10108056 Ga0207709_101080562 97
150 3300025938 Ga0207704_10233860 Ga0207704_102338602 97
151 3300025941 Ga0207711_10091511 Ga0207711_100915112 97
152 3300025941 Ga0207711_10306669 Ga0207711_103066691 97
153 3300025944 Ga0207661_10225484 Ga0207661_102254842 97
154 3300025945 Ga0207679_10547783 Ga0207679_105477832 97
155 3300025949 Ga0207667_11387472 Ga0207667_113874721 97
156 3300025981 Ga0207640_10631814 Ga0207640_106318142 97
157 3300025986 Ga0207658_10437822 Ga0207658_104378222 97
158 3300026023 Ga0207677_10483582 Ga0207677_104835822 97
159 3300026035 Ga0207703_10064766 Ga0207703_100647664 97
160 3300026041 Ga0207639_10105527 Ga0207639_101055272 97
161 3300026078 Ga0207702_10030901 Ga0207702_100309019 97
162 3300026078 Ga0207702_10043789 Ga0207702_100437892 97
163 3300026088 Ga0207641_10023693 Ga0207641_100236935 97
164 3300026088 Ga0207641_10197637 Ga0207641_101976372 97
165 3300026089 Ga0207648_10308547 Ga0207648_103085472 97
166 3300026095 Ga0207676_10009610 Ga0207676_100096106 97
167 3300026095 Ga0207676_10086376 Ga0207676_100863764 97
168 3300026116 Ga0207674_10013233 Ga0207674_1001323317 97
169 3300028379 Ga0268266_10370969 Ga0268266_103709692 97
170 3300028381 Ga0268264_10060239 Ga0268264_100602396 97
171 3300031241 Ga0265325_10234454 Ga0265325_102344542 97
172 3300031249 Ga0265339_10141364 Ga0265339_101413643 97
173 3300031250 Ga0265331_10077798 Ga0265331_100777983 97
174 3300031595 Ga0265313_10171480 Ga0265313_101714802 97
175 3300031595 Ga0265313_10245930 Ga0265313_102459302 97
176 3300031711 Ga0265314_10009286 Ga0265314_1000928610 97
177 3300034816 Ga0373930_0058782 Ga0373930_0058782_66_434 97
178 3300035115 Ga0373941_0314050 Ga0373941_0314050_71_439 97
179 3300036401 Ga0373937_0677496 Ga0373937_0677496_398_766 97
180 3300037068 Ga0373925_0935393 Ga0373925_0935393_140_508 97
181 3300044684 Ga0466966_0017481 Ga0466966_0017481_1796_2116 97
182 3300044693 Ga0466961_0260078 Ga0466961_0260078_277_597 97
183 3300044693 Ga0466961_0280150 Ga0466961_0280150_70_390 97
184 3300044693 Ga0466961_0388179 Ga0466961_0388179_325_645 97
185 3300044694 Ga0466963_0565210 Ga0466963_0565210_453_773 97
186 3300044765 Ga0466970_0206926 Ga0466970_0206926_84_404 97
187 3300044765 Ga0466970_0581394 Ga0466970_0581394_246_566 97
188 3300045049 Ga0466959_0072475 Ga0466959_0072475_1812_2132 97
189 3300046473 Ga0495582_0270634 Ga0495582_0270634_375_743 97
190 3300046531 Ga0495665_0465519 Ga0495665_0465519_87_455 97
191 3300046691 Ga0495670_0163925 Ga0495670_0163925_765_1133 97
192 3300059478 Ga0587093_084890 Ga0587093_084890_172_492 97
193 3300059508 Ga0587088_015178 Ga0587088_015178_766_1086 97
194 3300061719 Ga0466962_0194683 Ga0466962_0194683_143_463 97
195 3300009551 Ga0105238_11211882 Ga0105238_112118822 99
196 3300025924 Ga0207694_10520951 Ga0207694_105209512 99
197 3300028558 Ga0265326_10054192 Ga0265326_100541922 99
198 3300028577 Ga0265318_10068893 Ga0265318_100688932 99
199 3300028800 Ga0265338_10097186 Ga0265338_100971865 99
200 3300031240 Ga0265320_10021417 Ga0265320_100214178 99
201 3300031711 Ga0265314_10077276 Ga0265314_100772763 99
202 3300041486 Ga0451807_0475875 Ga0451807_0475875_284_598 99
203 3300044842 Ga0466957_0963322 Ga0466957_0963322_149_520 99
204 iso_pu_bacteria 2643221591 2643963609 99
205 3300005337 Ga0070682_100681905 Ga0070682_1006819051 100
206 3300006051 Ga0075364_10295262 Ga0075364_102952623 100
207 3300025939 Ga0207665_10968425 Ga0207665_109684252 100
208 3300037068 Ga0373925_0810765 Ga0373925_0810765_108_452 100
209 3300037853 Ga0436364_0419855 Ga0436364_0419855_485_811 100
210 3300041512 Ga0451853_0975994 Ga0451853_0975994_370_684 100
211 3300044694 Ga0466963_1331630 Ga0466963_1331630_136_462 100
212 3300048921 Ga0496118_0109853 Ga0496118_0109853_92_442 100
213 3300005564 Ga0070664_100572917 Ga0070664_1005729171 101
214 3300006871 Ga0075434_100242298 Ga0075434_1002422983 101
215 3300031711 Ga0265314_10272587 Ga0265314_102725872 101
216 3300031712 Ga0265342_10052436 Ga0265342_100524362 101
217 3300041441 Ga0451787_123607 Ga0451787_123607_34_351 101
218 3300041441 Ga0451787_300709 Ga0451787_300709_296_613 101
219 3300041441 Ga0451787_315941 Ga0451787_315941_378_701 101
220 3300041456 Ga0451795_0769616 Ga0451795_0769616_366_683 101
221 3300044712 Ga0453684_0464818 Ga0453684_0464818_593_916 101
222 3300048088 Ga0495602_1066728 Ga0495602_1066728_29_358 101
223 3300048921 Ga0496118_0319084 Ga0496118_0319084_260_628 101
224 3300049571 Ga0501034_0058419 Ga0501034_0058419_678_1025 101
225 3300050512 nmdc:mga0n895_398993_c1 nmdc:mga0n895_398993_c1_542_853 101
226 3300005455 Ga0070663_101022850 Ga0070663_1010228501 102
227 3300005535 Ga0070684_102307355 Ga0070684_1023073551 102
228 3300005539 Ga0068853_100017302 Ga0068853_1000173022 102
229 3300005543 Ga0070672_100640382 Ga0070672_1006403821 102
230 3300005548 Ga0070665_101383489 Ga0070665_1013834892 102
231 3300005548 Ga0070665_102135397 Ga0070665_1021353971 102
232 3300005563 Ga0068855_100084797 Ga0068855_1000847975 102
233 3300005563 Ga0068855_102016327 Ga0068855_1020163272 102
234 3300005564 Ga0070664_100055154 Ga0070664_1000551548 102
235 3300005564 Ga0070664_100488332 Ga0070664_1004883322 102
236 3300005578 Ga0068854_101021145 Ga0068854_1010211452 102
237 3300005578 Ga0068854_101472932 Ga0068854_1014729322 102
238 3300005614 Ga0068856_100009432 Ga0068856_10000943211 102
239 3300005614 Ga0068856_100267581 Ga0068856_1002675812 102
240 3300005616 Ga0068852_100871218 Ga0068852_1008712182 102
241 3300005616 Ga0068852_101890105 Ga0068852_1018901052 102
242 3300005618 Ga0068864_101030018 Ga0068864_1010300181 102
243 3300005937 Ga0081455_10386263 Ga0081455_103862632 102
244 3300006028 Ga0070717_10033750 Ga0070717_100337502 102
245 3300006028 Ga0070717_10859219 Ga0070717_108592191 102
246 3300006175 Ga0070712_100511026 Ga0070712_1005110261 102
247 3300006237 Ga0097621_102163375 Ga0097621_1021633752 102
248 3300009174 Ga0105241_10631040 Ga0105241_106310403 102
249 3300009545 Ga0105237_10357318 Ga0105237_103573182 102
250 3300009545 Ga0105237_10498738 Ga0105237_104987382 102
251 3300009551 Ga0105238_12157697 Ga0105238_121576972 102
252 3300009551 Ga0105238_12825968 Ga0105238_128259682 102
253 3300010375 Ga0105239_10236062 Ga0105239_102360622 102
254 3300010375 Ga0105239_10526954 Ga0105239_105269544 102
255 3300010375 Ga0105239_10902550 Ga0105239_109025502 102
256 3300013100 Ga0157373_10190846 Ga0157373_101908464 102
257 3300013102 Ga0157371_10024961 Ga0157371_100249619 102
258 3300013105 Ga0157369_10004638 Ga0157369_1000463822 102
259 3300013105 Ga0157369_10033746 Ga0157369_100337466 102
260 3300013105 Ga0157369_10595136 Ga0157369_105951362 102
261 3300013105 Ga0157369_11533474 Ga0157369_115334742 102
262 3300013296 Ga0157374_10030570 Ga0157374_1003057010 102
263 3300013307 Ga0157372_11804768 Ga0157372_118047682 102
264 3300013307 Ga0157372_12231672 Ga0157372_122316721 102
265 3300014969 Ga0157376_10087903 Ga0157376_100879036 102
266 3300014969 Ga0157376_10108272 Ga0157376_101082725 102
267 3300021384 Ga0213876_10441877 Ga0213876_104418771 102
268 3300021388 Ga0213875_10005759 Ga0213875_1000575911 102
269 3300021388 Ga0213875_10045320 Ga0213875_100453203 102
270 3300021388 Ga0213875_10069891 Ga0213875_100698914 102
271 3300021388 Ga0213875_10333567 Ga0213875_103335672 102
272 3300025909 Ga0207705_10057980 Ga0207705_100579804 102
273 3300025911 Ga0207654_10648728 Ga0207654_106487281 102
274 3300025913 Ga0207695_10140217 Ga0207695_101402175 102
275 3300025913 Ga0207695_10342860 Ga0207695_103428602 102
276 3300025914 Ga0207671_11025134 Ga0207671_110251342 102
277 3300025919 Ga0207657_10063775 Ga0207657_100637753 102
278 3300025920 Ga0207649_10032767 Ga0207649_100327676 102
279 3300025929 Ga0207664_10726910 Ga0207664_107269102 102
280 3300025931 Ga0207644_10291825 Ga0207644_102918252 102
281 3300025932 Ga0207690_10172572 Ga0207690_101725723 102
282 3300025940 Ga0207691_10540892 Ga0207691_105408922 102
283 3300025949 Ga0207667_10068480 Ga0207667_100684805 102
284 3300025949 Ga0207667_10114447 Ga0207667_101144475 102
285 3300025949 Ga0207667_10436094 Ga0207667_104360943 102
286 3300025949 Ga0207667_11535863 Ga0207667_115358632 102
287 3300025981 Ga0207640_11152549 Ga0207640_111525492 102
288 3300026041 Ga0207639_10992341 Ga0207639_109923412 102
289 3300026067 Ga0207678_10009839 Ga0207678_100098397 102
290 3300026067 Ga0207678_10590067 Ga0207678_105900672 102
291 3300026078 Ga0207702_10007772 Ga0207702_1000777210 102
292 3300026078 Ga0207702_10015414 Ga0207702_1001541411 102
293 3300026078 Ga0207702_10499911 Ga0207702_104999111 102
294 3300028379 Ga0268266_11727742 Ga0268266_117277422 102
295 3300031824 Ga0307413_10578933 Ga0307413_105789332 102
296 3300031995 Ga0307409_100451110 Ga0307409_1004511102 102
297 3300032004 Ga0307414_10861318 Ga0307414_108613182 102
298 3300032004 Ga0307414_11171071 Ga0307414_111710712 102
299 3300033527 Ga0316586_1005355 Ga0316586_10053553 102
300 3300035691 Ga0373931_1123457 Ga0373931_1123457_72_449 102
301 3300035725 Ga0373947_1252674 Ga0373947_1252674_111_494 102
302 3300036712 Ga0316584_0652921 Ga0316584_0652921_334_714 102
303 3300037471 Ga0395905_0668455 Ga0395905_0668455_346_723 102
304 3300037853 Ga0436364_0026865 Ga0436364_0026865_529_912 102
305 3300037853 Ga0436364_0240413 Ga0436364_0240413_2995_3378 102
306 3300037853 Ga0436364_0578648 Ga0436364_0578648_35_418 102
307 3300037853 Ga0436364_0894178 Ga0436364_0894178_1012_1395 102
308 3300037853 Ga0436364_1006134 Ga0436364_1006134_594_977 102
309 3300037853 Ga0436364_1054367 Ga0436364_1054367_14313_14696 102
310 3300037853 Ga0436364_1121262 Ga0436364_1121262_9710_10093 102
311 3300037853 Ga0436364_1393988 Ga0436364_1393988_1109_1492 102
312 3300037853 Ga0436364_1400193 Ga0436364_1400193_2746_3129 102
313 3300039437 Ga0436365_0200225 Ga0436365_0200225_266_649 102
314 3300039437 Ga0436365_0821682 Ga0436365_0821682_6169_6552 102
315 3300039437 Ga0436365_1262762 Ga0436365_1262762_41_424 102
316 3300039437 Ga0436365_1721656 Ga0436365_1721656_313_699 102
317 3300039437 Ga0436365_1887503 Ga0436365_1887503_315_701 102
318 3300039438 Ga0436360_0584444 Ga0436360_0584444_1026_1409 102
319 3300039438 Ga0436360_1049432 Ga0436360_1049432_53_436 102
320 3300039450 Ga0436363_0345243 Ga0436363_0345243_322_705 102
321 3300039450 Ga0436363_0431750 Ga0436363_0431750_450_833 102
322 3300039450 Ga0436363_1351619 Ga0436363_1351619_907_1293 102
323 3300039453 Ga0436362_0534029 Ga0436362_0534029_585_968 102
324 3300041511 Ga0451855_0059144 Ga0451855_0059144_176_496 102
325 3300041997 Ga0439431_0029306 Ga0439431_0029306_678_1007 102
326 3300044693 Ga0466961_0277874 Ga0466961_0277874_316_699 102
327 3300044765 Ga0466970_0745036 Ga0466970_0745036_175_558 102
328 3300045836 Ga0466958_0050425 Ga0466958_0050425_20_403 102
329 3300045976 Ga0466967_0610353 Ga0466967_0610353_271_654 102
330 3300045976 Ga0466967_0703486 Ga0466967_0703486_376_759 102
331 3300048904 Ga0496101_0374400 Ga0496101_0374400_305_682 102
332 3300048908 Ga0496105_0502990 Ga0496105_0502990_466_849 102
333 3300048909 Ga0496106_1202591 Ga0496106_1202591_56_439 102
334 3300048910 Ga0496107_1357773 Ga0496107_1357773_110_493 102
335 3300048915 Ga0496112_0008575 Ga0496112_0008575_7980_8363 102
336 3300048918 Ga0496115_0011601 Ga0496115_0011601_1764_2147 102
337 3300048918 Ga0496115_0035714 Ga0496115_0035714_1202_1570 102
338 3300049685 Ga0501256_022223 Ga0501256_022223_262_639 102
339 3300049742 Ga0501080_1627891 Ga0501080_1627891_192_536 102
340 3300049744 Ga0501083_0160511 Ga0501083_0160511_582_950 102
341 3300053077 Ga0495601_0311785 Ga0495601_0311785_614_997 102
342 3300053139 Ga0500568_0002264 Ga0500568_0002264_281_658 102
343 3300053151 Ga0500604_0069550 Ga0500604_0069550_336_674 102
344 3300059643 Ga0587072_014285 Ga0587072_014285_398_736 102
345 3300004799 Ga0058863_10010406 Ga0058863_100104065 103
346 3300004799 Ga0058863_11587924 Ga0058863_115879242 103
347 3300004800 Ga0058861_11690222 Ga0058861_116902222 103
348 3300004803 Ga0058862_11737220 Ga0058862_117372201 103
349 3300004803 Ga0058862_12843351 Ga0058862_128433512 103
350 3300005336 Ga0070680_100072638 Ga0070680_1000726385 103
351 3300005336 Ga0070680_100287817 Ga0070680_1002878173 103
352 3300005336 Ga0070680_100421425 Ga0070680_1004214253 103
353 3300005337 Ga0070682_100352310 Ga0070682_1003523102 103
354 3300005339 Ga0070660_101227932 Ga0070660_1012279321 103
355 3300005341 Ga0070691_10212610 Ga0070691_102126103 103
356 3300005345 Ga0070692_10085623 Ga0070692_100856233 103
357 3300005434 Ga0070709_10204906 Ga0070709_102049063 103
358 3300005434 Ga0070709_10665610 Ga0070709_106656102 103
359 3300005436 Ga0070713_100338754 Ga0070713_1003387542 103
360 3300005458 Ga0070681_10169369 Ga0070681_101693692 103
361 3300005458 Ga0070681_10307388 Ga0070681_103073883 103
362 3300005458 Ga0070681_11311227 Ga0070681_113112271 103
363 3300005530 Ga0070679_100418617 Ga0070679_1004186171 103
364 3300005530 Ga0070679_100443699 Ga0070679_1004436992 103
365 3300005535 Ga0070684_100324235 Ga0070684_1003242351 103
366 3300005545 Ga0070695_101344339 Ga0070695_1013443391 103
367 3300005548 Ga0070665_100341650 Ga0070665_1003416504 103
368 3300005614 Ga0068856_100200510 Ga0068856_1002005102 103
369 3300005617 Ga0068859_100094099 Ga0068859_1000940993 103
370 3300005719 Ga0068861_100250890 Ga0068861_1002508903 103
371 3300005841 Ga0068863_100016102 Ga0068863_10001610210 103
372 3300006038 Ga0075365_10551026 Ga0075365_105510262 103
373 3300006358 Ga0068871_101947175 Ga0068871_1019471752 103
374 3300006844 Ga0075428_101617485 Ga0075428_1016174852 103
375 3300006846 Ga0075430_100033273 Ga0075430_1000332739 103
376 3300006847 Ga0075431_100068526 Ga0075431_1000685269 103
377 3300006880 Ga0075429_100267471 Ga0075429_1002674712 103
378 3300006931 Ga0097620_100094100 Ga0097620_1000941003 103
379 3300009093 Ga0105240_10000499 Ga0105240_1000049914 103
380 3300009147 Ga0114129_10375592 Ga0114129_103755922 103
381 3300009545 Ga0105237_10086917 Ga0105237_100869176 103
382 3300009545 Ga0105237_10221528 Ga0105237_102215284 103
383 3300009553 Ga0105249_10103809 Ga0105249_101038094 103
384 3300013104 Ga0157370_11623581 Ga0157370_116235811 103
385 3300013105 Ga0157369_10242494 Ga0157369_102424942 103
386 3300013105 Ga0157369_12575534 Ga0157369_125755341 103
387 3300013297 Ga0157378_10293253 Ga0157378_102932533 103
388 3300014969 Ga0157376_10437357 Ga0157376_104373574 103
389 3300020069 Ga0197907_10880964 Ga0197907_108809642 103
390 3300020078 Ga0206352_10460690 Ga0206352_104606901 103
391 3300021377 Ga0213874_10048447 Ga0213874_100484472 103
392 3300022467 Ga0224712_10486813 Ga0224712_104868131 103
393 3300025904 Ga0207647_10181916 Ga0207647_101819162 103
394 3300025906 Ga0207699_10205929 Ga0207699_102059292 103
395 3300025912 Ga0207707_10113466 Ga0207707_101134664 103
396 3300025912 Ga0207707_10173157 Ga0207707_101731574 103
397 3300025912 Ga0207707_10419917 Ga0207707_104199172 103
398 3300025913 Ga0207695_10008431 Ga0207695_1000843121 103
399 3300025914 Ga0207671_10017757 Ga0207671_100177575 103
400 3300025921 Ga0207652_10279989 Ga0207652_102799891 103
401 3300025921 Ga0207652_10369965 Ga0207652_103699651 103
402 3300025928 Ga0207700_10710310 Ga0207700_107103102 103
403 3300025942 Ga0207689_10111916 Ga0207689_101119165 103
404 3300025986 Ga0207658_10055258 Ga0207658_100552587 103
405 3300026078 Ga0207702_11160057 Ga0207702_111600571 103
406 3300026088 Ga0207641_10011436 Ga0207641_1001143614 103
407 3300026095 Ga0207676_10600908 Ga0207676_106009082 103
408 3300026116 Ga0207674_12021362 Ga0207674_120213622 103
409 3300028381 Ga0268264_10951624 Ga0268264_109516242 103
410 3300028794 Ga0307515_10201561 Ga0307515_102015614 103
411 3300031456 Ga0307513_10343349 Ga0307513_103433492 103
412 3300031901 Ga0307406_10024184 Ga0307406_100241846 103
413 3300031911 Ga0307412_12193671 Ga0307412_121936711 103
414 3300032004 Ga0307414_11022067 Ga0307414_110220672 103
415 3300035083 Ga0373926_0106121 Ga0373926_0106121_164_544 103
416 3300035083 Ga0373926_0115693 Ga0373926_0115693_540_908 103
417 3300035170 Ga0373943_0037025 Ga0373943_0037025_612_992 103
418 3300035171 Ga0373946_0024372 Ga0373946_0024372_1565_1945 103
419 3300035695 Ga0373927_0022764 Ga0373927_0022764_909_1277 103
420 3300035695 Ga0373927_0036356 Ga0373927_0036356_2282_2662 103
421 3300035725 Ga0373947_0013403 Ga0373947_0013403_2248_2628 103
422 3300036401 Ga0373937_0111079 Ga0373937_0111079_585_965 103
423 3300036401 Ga0373937_2127687 Ga0373937_2127687_109_489 103
424 3300037068 Ga0373925_0007421 Ga0373925_0007421_4355_4735 103
425 3300037418 Ga0395900_0619767 Ga0395900_0619767_515_901 103
426 3300037466 Ga0395898_0536997 Ga0395898_0536997_401_787 103
427 3300037471 Ga0395905_0286632 Ga0395905_0286632_972_1358 103
428 3300038443 Ga0395901_0291374 Ga0395901_0291374_885_1271 103
429 3300039450 Ga0436363_1096749 Ga0436363_1096749_73_459 103
430 3300039450 Ga0436363_1621856 Ga0436363_1621856_490_870 103
431 3300041464 Ga0451808_34490 Ga0451808_34490_270_581 103
432 3300041498 Ga0451841_0349496 Ga0451841_0349496_51_362 103
433 3300044656 Ga0466969_0558443 Ga0466969_0558443_75_467 103
434 3300044683 Ga0466965_0819667 Ga0466965_0819667_10_402 103
435 3300045836 Ga0466958_0230842 Ga0466958_0230842_140_526 103
436 3300046472 Ga0495580_0035122 Ga0495580_0035122_854_1234 103
437 3300046472 Ga0495580_0303839 Ga0495580_0303839_647_1027 103
438 3300046526 Ga0495666_0398497 Ga0495666_0398497_87_467 103
439 3300046531 Ga0495665_0058621 Ga0495665_0058621_241_621 103
440 3300046615 Ga0495656_0648452 Ga0495656_0648452_80_463 103
441 3300046663 Ga0495635_0115216 Ga0495635_0115216_177_557 103
442 3300046683 Ga0495658_0183328 Ga0495658_0183328_197_577 103
443 3300047318 Ga0495636_0199904 Ga0495636_0199904_166_549 103
444 3300047673 Ga0495593_0124579 Ga0495593_0124579_618_998 103
445 3300048913 Ga0496110_0497506 Ga0496110_0497506_685_996 103
446 3300048914 Ga0496111_0048615 Ga0496111_0048615_2376_2687 103
447 3300048919 Ga0496116_0146828 Ga0496116_0146828_212_523 103
448 3300048921 Ga0496118_0221485 Ga0496118_0221485_510_821 103
449 3300048925 Ga0496122_0294434 Ga0496122_0294434_386_697 103
450 3300048927 Ga0496124_0835150 Ga0496124_0835150_233_544 103
451 3300048928 Ga0496125_0000815 Ga0496125_0000815_32830_33141 103
452 3300049535 Ga0501319_015186 Ga0501319_015186_193_504 103
453 3300049568 Ga0501031_0554376 Ga0501031_0554376_309_695 103
454 3300049569 Ga0501032_0276586 Ga0501032_0276586_506_892 103
455 3300049570 Ga0501033_0837683 Ga0501033_0837683_46_432 103
456 3300049571 Ga0501034_0010656 Ga0501034_0010656_452_838 103
457 3300049573 Ga0501037_0052409 Ga0501037_0052409_2147_2533 103
458 3300049574 Ga0501038_0006023 Ga0501038_0006023_7923_8309 103
459 3300049579 Ga0501043_0105319 Ga0501043_0105319_710_1096 103
460 3300049580 Ga0501046_0318591 Ga0501046_0318591_642_1028 103
461 3300049581 Ga0501047_0038476 Ga0501047_0038476_1494_1880 103
462 3300049582 Ga0501048_0086023 Ga0501048_0086023_1046_1432 103
463 3300049586 Ga0501070_0006487 Ga0501070_0006487_9122_9508 103
464 3300049589 Ga0501073_0198962 Ga0501073_0198962_298_684 103
465 3300049590 Ga0501074_0043689 Ga0501074_0043689_91_477 103
466 3300049742 Ga0501080_0070674 Ga0501080_0070674_450_836 103
467 3300049822 Ga0501035_0028540 Ga0501035_0028540_608_994 103
468 3300049823 Ga0501044_0010929 Ga0501044_0010929_6638_7024 103
469 3300049823 Ga0501044_0073393 Ga0501044_0073393_101_412 103
470 3300050492 nmdc:mga0yw44_852520_c1 nmdc:mga0yw44_852520_c1_231_542 103
471 3300050507 nmdc:mga05p37_221970_c1 nmdc:mga05p37_221970_c1_1297_1662 103
472 3300050509 nmdc:mga0qj67_136084_c1 nmdc:mga0qj67_136084_c1_1333_1698 103
473 3300050510 nmdc:mga06r32_10773_c1 nmdc:mga06r32_10773_c1_6031_6396 103
474 3300053085 Ga0495619_1097865 Ga0495619_1097865_85_465 103
475 3300059643 Ga0587072_003068 Ga0587072_003068_358_669 103
476 3300003214 JGI25165J46597_1000961 JGI25165J46597_100096117 104
477 3300005335 Ga0070666_10796447 Ga0070666_107964472 104
478 3300005366 Ga0070659_100853103 Ga0070659_1008531032 104
479 3300005367 Ga0070667_101017746 Ga0070667_1010177462 104
480 3300005434 Ga0070709_11279138 Ga0070709_112791382 104
481 3300005436 Ga0070713_102306310 Ga0070713_1023063101 104
482 3300005455 Ga0070663_100066762 Ga0070663_1000667624 104
483 3300005458 Ga0070681_10283993 Ga0070681_102839933 104
484 3300005466 Ga0070685_11605353 Ga0070685_116053531 104
485 3300005530 Ga0070679_100048764 Ga0070679_1000487646 104
486 3300005539 Ga0068853_100796650 Ga0068853_1007966502 104
487 3300005539 Ga0068853_101307603 Ga0068853_1013076032 104
488 3300005548 Ga0070665_100225239 Ga0070665_1002252396 104
489 3300005563 Ga0068855_100018562 Ga0068855_1000185626 104
490 3300005563 Ga0068855_100151277 Ga0068855_1001512775 104
491 3300005564 Ga0070664_101764062 Ga0070664_1017640621 104
492 3300005577 Ga0068857_100646626 Ga0068857_1006466262 104
493 3300005616 Ga0068852_100565939 Ga0068852_1005659392 104
494 3300005617 Ga0068859_100847934 Ga0068859_1008479342 104
495 3300005841 Ga0068863_102250603 Ga0068863_1022506032 104
496 3300005842 Ga0068858_101042353 Ga0068858_1010423532 104
497 3300006237 Ga0097621_101025163 Ga0097621_1010251632 104
498 3300006931 Ga0097620_100848098 Ga0097620_1008480982 104
499 3300009174 Ga0105241_10116070 Ga0105241_101160702 104
500 3300009174 Ga0105241_10358286 Ga0105241_103582863 104
501 3300009177 Ga0105248_10045011 Ga0105248_1004501110 104
502 3300009545 Ga0105237_10002619 Ga0105237_1000261924 104
503 3300009545 Ga0105237_10007763 Ga0105237_100077639 104
504 3300009545 Ga0105237_10797399 Ga0105237_107973991 104
505 3300010375 Ga0105239_10012303 Ga0105239_100123038 104
506 3300010375 Ga0105239_10061221 Ga0105239_100612219 104
507 3300010375 Ga0105239_10632459 Ga0105239_106324592 104
508 3300013105 Ga0157369_10157491 Ga0157369_101574916 104
509 3300013297 Ga0157378_11981799 Ga0157378_119817992 104
510 3300013297 Ga0157378_12452433 Ga0157378_124524332 104
511 3300013306 Ga0163162_12618686 Ga0163162_126186862 104
512 3300013307 Ga0157372_11008767 Ga0157372_110087672 104
513 3300014969 Ga0157376_12397327 Ga0157376_123973272 104
514 3300020070 Ga0206356_10096870 Ga0206356_100968701 104
515 3300020070 Ga0206356_10970685 Ga0206356_109706852 104
516 3300020078 Ga0206352_10076272 Ga0206352_1007627219 104
517 3300020078 Ga0206352_11128396 Ga0206352_111283963 104
518 3300020081 Ga0206354_10778596 Ga0206354_107785962 104
519 3300020082 Ga0206353_11142864 Ga0206353_111428641 104
520 3300025261 Ga0209233_1000293 Ga0209233_100029325 104
521 3300025909 Ga0207705_10001453 Ga0207705_1000145321 104
522 3300025911 Ga0207654_10463730 Ga0207654_104637302 104
523 3300025911 Ga0207654_11454183 Ga0207654_114541832 104
524 3300025912 Ga0207707_10347458 Ga0207707_103474582 104
525 3300025914 Ga0207671_10001074 Ga0207671_1000107424 104
526 3300025914 Ga0207671_10055914 Ga0207671_100559144 104
527 3300025919 Ga0207657_10008060 Ga0207657_1000806015 104
528 3300025921 Ga0207652_10228861 Ga0207652_102288612 104
529 3300025924 Ga0207694_10464431 Ga0207694_104644312 104
530 3300025928 Ga0207700_10072432 Ga0207700_100724326 104
531 3300025932 Ga0207690_10268939 Ga0207690_102689395 104
532 3300025932 Ga0207690_10340918 Ga0207690_103409182 104
533 3300025941 Ga0207711_10071486 Ga0207711_100714862 104
534 3300025949 Ga0207667_10002756 Ga0207667_1000275621 104
535 3300025949 Ga0207667_10148768 Ga0207667_101487685 104
536 3300025960 Ga0207651_11845809 Ga0207651_118458091 104
537 3300025981 Ga0207640_10670427 Ga0207640_106704272 104
538 3300026041 Ga0207639_10956554 Ga0207639_109565542 104
539 3300026041 Ga0207639_11019033 Ga0207639_110190332 104
540 3300026067 Ga0207678_10022593 Ga0207678_100225936 104
541 3300026078 Ga0207702_11426348 Ga0207702_114263482 104
542 3300026116 Ga0207674_12125202 Ga0207674_121252021 104
543 3300026142 Ga0207698_10077237 Ga0207698_100772373 104
544 3300026142 Ga0207698_12275662 Ga0207698_122756621 104
545 3300028379 Ga0268266_10000321 Ga0268266_1000032121 104
546 3300030760 Ga0265762_1080043 Ga0265762_10800432 104
547 3300031090 Ga0265760_10157730 Ga0265760_101577302 104
548 3300037068 Ga0373925_0757100 Ga0373925_0757100_19_390 104
549 3300045976 Ga0466967_0169278 Ga0466967_0169278_1078_1392 104
550 3300046543 Ga0495645_0589234 Ga0495645_0589234_113_484 104
551 3300060353 Ga0501082_0000322 Ga0501082_0000322_36130_36501 104
552 3300061719 Ga0466962_0441157 Ga0466962_0441157_299_613 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

28

59

0.97

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

61

128

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9577 5 37
5mmm-assembly1.cif.gz_V structure of the 70s chloroplast ribosome 0.9276 5 102
6eri-assembly1.cif.gz_AU structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.9193 5 102
5mlc-assembly1.cif.gz_W cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9089 1 101
5h1s-assembly1.cif.gz_W structure of the large subunit of the chloro-ribosome 0.9089 4 101
ID Description Score Start End Superfamily
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9439 4 98 2.30.30.30
af_Q55D16_393_444_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9275 5 37 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9243 5 97 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9071 4 98 2.30.30.30
af_P9WHB7_1_104_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9037 4 98 2.30.30.30
ID Description Score Start End GO Terms
AF-A6DEY5-F1-model_v4 deleted 0.9677 4 71
AF-B9L6M2-F1-model_v4 Large ribosomal subunit protein uL24 0.9676 4 71 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3N1YKF1-F1-model_v4 deleted 0.9663 4 71
AF-Q11QC3-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9557 4 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A832CLV5-F1-model_v4 Large ribosomal subunit protein uL24 0.9519 4 69 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.41 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map