F462699

General Info

Members Datasets Scaffolds Average Seq Length
552 298 520 541

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100003909|Ga0070663_1000039094
Length 593
Sequence VSRQATNAGCSLALEAHCGVAPPGRSHDYDSSARLALRCDNGAINRHLWLDATPVDAARRALLXXXXAVPLAACSKRATEYTGGWIGAQNERGHRLRDTKSGSLPAPAVQRRVGVAIVGAGVAGLACARMLAKRGVDDVHLFDLEDAAGGNSRGHRIAGMACPLGAHYLPLPGEHATEVTQLLEELGLRRTVNGQPVYNEQHLCHSPQERLFIDGHWHDGLLPPIDALPVADRATTLAQYRRFAQLVTDASRGNAFTMPTWRSAWRAEHDVLDAQTFSQWLDSQQLTATALRWYLDYCCRDDYGGGADEVSAWAGLHYFASRHGFHAPGMTSDERDGVLTWPEGNAWIASRLAEPLQDRINTSMVVLRVQEGRGGVDVDAWNARESRVERWTAKQVVLAVPIFIAARLLESPSSALTHAASRMRYAPWMVANMHIDEALDDRPGAPLSWDNVLYGVESLGYVDAMHQSMRPYPGPTVLSSYWAWGAAPAHRQSLLQQGWFTRAARVVQELSRAHPDLPSKVRQIDLMRYGHAMSIPVPGLRSRASLRALSQVRGRVMFAHSDLSAYSVFEEAYFHGVRVARDILDGERRDRGG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221638 Duganella sp. Root336D2 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2738541297 Duganella sp. GV083 Isolate Unclassified
18 2738541357 Duganella sp. GV053 Isolate Unclassified
19 2738543003 Duganella sp. GV066 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543026 Duganella sp. GV089 Isolate Unclassified
23 2738543029 Duganella sp. GV039 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2831864461 Roseateles noduli HZ7 Isolate Nodule
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
28 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
29 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
30 2929520902 Variovorax beijingensis 502 Isolate Unclassified
31 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
32 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
33 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
192 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
193 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
227 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
283 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
291 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.28
Nodule 0.72
Rhizoplane 1.45
Rhizosphere 62.68
Stem 0
Stem Tuber 0
Unclassified 12.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001523 3300002739 Bacteria 4037
2 JGI25150J39212_1002797 3300002774 Bacteria 4233
3 JGI25153J46596_10000814 3300003215 Bacteria 19064
4 rootH2_10019664 3300003320 Bacteria 4904
5 rootL2_10000530 3300003322 Bacteria 100270
6 rootL2_10010127 3300003322 Bacteria 3456
7 rootL2_10092988 3300003322 Bacteria 2732
8 rootH1_10236920 3300003323 Bacteria 3340
9 JGI25160J50197_1000076 3300003354 Bacteria 102318
10 JGI25160J50197_1015179 3300003354 Bacteria 2540
11 JGI25161J50226_1001722 3300003374 Bacteria 6220
12 Ga0055526_1002103 3300003771 Bacteria 13664
13 Ga0055526_1005737 3300003771 Bacteria 7009
14 Ga0055537_1000341 3300003773 Bacteria 31907
15 Ga0055537_1004364 3300003773 Bacteria 4057
16 Ga0055524_1000781 3300003775 Bacteria 21321
17 Ga0055524_1004439 3300003775 Bacteria 6474
18 Ga0055536_1003849 3300003781 Bacteria 7895
19 Ga0055534_1000320 3300003784 Bacteria 31907
20 Ga0055534_1003511 3300003784 Bacteria 4903
21 Ga0055528_1000765 3300003790 Bacteria 22442
22 Ga0055530_10000627 3300003791 Bacteria 30520
23 Ga0055540_1003225 3300003792 Bacteria 8000
24 Ga0055531_10003525 3300003794 Bacteria 9951
25 Ga0055531_10012401 3300003794 Bacteria 4014
26 Ga0055543_1002408 3300004625 Bacteria 6214
27 Ga0055543_1002538 3300004625 Bacteria 5966
28 Ga0055543_1009182 3300004625 Bacteria 2142
29 Ga0065165_1000006 3300005262 Bacteria 352298
30 Ga0065165_1000884 3300005262 Bacteria 38667
31 Ga0065165_1004839 3300005262 Bacteria 8007
32 Ga0065165_1007704 3300005262 Bacteria 5216
33 Ga0065714_10067056 3300005288 Bacteria 5948
34 Ga0070658_10038749 3300005327 Bacteria 3843
35 Ga0070658_10040739 3300005327 Bacteria 3748
36 Ga0070676_10006013 3300005328 Bacteria 6479
37 Ga0070683_100011636 3300005329 Bacteria 7616
38 Ga0070690_100004243 3300005330 Bacteria 7935
39 Ga0070670_100014692 3300005331 Bacteria 6723
40 Ga0070670_100033752 3300005331 Bacteria 4406
41 Ga0070670_100096805 3300005331 Bacteria 2539
42 Ga0070670_100131964 3300005331 Bacteria 2157
43 Ga0070677_10022575 3300005333 Bacteria 2320
44 Ga0070677_10034927 3300005333 Bacteria 1945
45 Ga0068869_100077319 3300005334 Bacteria 2476
46 Ga0070666_10002198 3300005335 Bacteria 11818
47 Ga0070666_10072783 3300005335 Bacteria 2340
48 Ga0070680_100026231 3300005336 Bacteria 4659
49 Ga0070680_100042474 3300005336 Bacteria 3690
50 Ga0068868_100000575 3300005338 Bacteria 24636
51 Ga0068868_100029330 3300005338 Bacteria 4212
52 Ga0068868_100036818 3300005338 Bacteria 3790
53 Ga0070660_100134611 3300005339 Bacteria 1980
54 Ga0070661_100080490 3300005344 Bacteria 2404
55 Ga0070668_100022359 3300005347 Bacteria 4779
56 Ga0070669_100044255 3300005353 Bacteria 3244
57 Ga0070675_100023617 3300005354 Bacteria 4918
58 Ga0070671_100009522 3300005355 Bacteria 7799
59 Ga0070671_100016295 3300005355 Bacteria 6011
60 Ga0070671_100018121 3300005355 Bacteria 5717
61 Ga0070671_100070032 3300005355 Bacteria 2926
62 Ga0070671_100132612 3300005355 Bacteria 2099
63 Ga0070671_100139215 3300005355 Bacteria 2047
64 Ga0070674_100015289 3300005356 Bacteria 4789
65 Ga0070673_100000934 3300005364 Bacteria 16544
66 Ga0070673_100002463 3300005364 Bacteria 11289
67 Ga0070673_100017602 3300005364 Bacteria 5087
68 Ga0070673_100098271 3300005364 Bacteria 2406
69 Ga0070659_100007229 3300005366 Bacteria 8060
70 Ga0070667_100005605 3300005367 Bacteria 10486
71 Ga0070667_100008777 3300005367 Bacteria 8377
72 Ga0070667_100017860 3300005367 Bacteria 5879
73 Ga0070667_100025997 3300005367 Bacteria 4869
74 Ga0070663_100003909 3300005455 Bacteria 8688
75 Ga0070663_100073258 3300005455 Bacteria 2498
76 Ga0070678_100002280 3300005456 Bacteria 10442
77 Ga0070678_100076194 3300005456 Bacteria 2526
78 Ga0070662_100020637 3300005457 Bacteria 4491
79 Ga0068867_100000076 3300005459 Bacteria 59983
80 Ga0068867_100002739 3300005459 Bacteria 12422
81 Ga0068867_100008736 3300005459 Bacteria 7151
82 Ga0068867_100024500 3300005459 Bacteria 4324
83 Ga0070706_100013591 3300005467 Bacteria 7527
84 Ga0070679_100008857 3300005530 Bacteria 9498
85 Ga0070679_100019855 3300005530 Bacteria 6543
86 Ga0070684_100013923 3300005535 Bacteria 6499
87 Ga0070672_100000121 3300005543 Bacteria 40117
88 Ga0070672_100004438 3300005543 Bacteria 9183
89 Ga0070672_100009643 3300005543 Bacteria 6665
90 Ga0070672_100051255 3300005543 Bacteria 3217
91 Ga0070693_100007105 3300005547 Bacteria 5457
92 Ga0068855_100081355 3300005563 Bacteria 3754
93 Ga0070664_100000246 3300005564 Bacteria 39053
94 Ga0070664_100058898 3300005564 Bacteria 3267
95 Ga0068857_100016123 3300005577 Bacteria 6545
96 Ga0068857_100037177 3300005577 Bacteria 4313
97 Ga0068854_100011979 3300005578 Bacteria 5666
98 Ga0068856_100023685 3300005614 Bacteria 5970
99 Ga0068856_100087969 3300005614 Bacteria 3089
100 Ga0068852_100003517 3300005616 Bacteria 10961
101 Ga0068852_100040660 3300005616 Bacteria 3924
102 Ga0068852_100071107 3300005616 Bacteria 3054
103 Ga0068852_100138282 3300005616 Bacteria 2251
104 Ga0068852_100165138 3300005616 Bacteria 2071
105 Ga0068859_100005691 3300005617 Bacteria 12684
106 Ga0068859_100046009 3300005617 Bacteria 4383
107 Ga0068864_100012983 3300005618 Bacteria 6894
108 Ga0068864_100015243 3300005618 Bacteria 6393
109 Ga0068861_100033415 3300005719 Bacteria 3794
110 Ga0068851_10054195 3300005834 Bacteria 2042
111 Ga0068863_100010276 3300005841 Bacteria 9094
112 Ga0068863_100023139 3300005841 Bacteria 5937
113 Ga0068863_100115433 3300005841 Bacteria 2558
114 Ga0068858_100003339 3300005842 Bacteria 15987
115 Ga0068858_100022657 3300005842 Bacteria 5858
116 Ga0068858_100045866 3300005842 Bacteria 4052
117 Ga0068860_100063193 3300005843 Bacteria 3517
118 Ga0075365_10000807 3300006038 Bacteria 12873
119 Ga0075365_10011875 3300006038 Bacteria 5142
120 Ga0075364_10006196 3300006051 Bacteria 7012
121 Ga0075364_10008509 3300006051 Bacteria 6138
122 Ga0075364_10026869 3300006051 Bacteria 3674
123 Ga0075432_10008119 3300006058 Bacteria 3580
124 Ga0075362_10006172 3300006177 Bacteria 4447
125 Ga0075367_10001086 3300006178 Bacteria 11217
126 Ga0075367_10011156 3300006178 Bacteria 4742
127 Ga0075367_10026158 3300006178 Bacteria 3306
128 Ga0075367_10034093 3300006178 Bacteria 2938
129 Ga0075369_10001782 3300006186 Bacteria 7488
130 Ga0075366_10015934 3300006195 Bacteria 4315
131 Ga0075366_10025154 3300006195 Bacteria 3475
132 Ga0075366_10028996 3300006195 Bacteria 3249
133 Ga0097621_100026018 3300006237 Bacteria 4585
134 Ga0075370_10000588 3300006353 Bacteria 14049
135 Ga0075370_10001400 3300006353 Bacteria 10412
136 Ga0075370_10059070 3300006353 Bacteria 2182
137 Ga0068871_100006590 3300006358 Bacteria 8234
138 Ga0068871_100031625 3300006358 Bacteria 4175
139 Ga0068865_100047247 3300006881 Bacteria 2957
140 Ga0097620_100005691 3300006931 Bacteria 12684
141 Ga0097620_100046010 3300006931 Bacteria 4383
142 Ga0099823_1001509 3300006944 Bacteria 19439
143 Ga0099826_10014323 3300006948 Bacteria 5987
144 Ga0105240_10011262 3300009093 Bacteria 12469
145 Ga0105240_10016550 3300009093 Bacteria 9981
146 Ga0105240_10107036 3300009093 Bacteria 3391
147 Ga0105245_10044849 3300009098 Bacteria 3947
148 Ga0105245_10131010 3300009098 Bacteria 2352
149 Ga0105243_10015999 3300009148 Bacteria 5674
150 Ga0105243_10036067 3300009148 Bacteria 3835
151 Ga0105243_10128822 3300009148 Bacteria 2144
152 Ga0105242_10115859 3300009176 Bacteria 2292
153 Ga0105248_10003500 3300009177 Bacteria 17423
154 Ga0105248_10030711 3300009177 Bacteria 6001
155 Ga0105248_10039400 3300009177 Bacteria 5292
156 Ga0105248_10074839 3300009177 Bacteria 3806
157 Ga0105248_10135172 3300009177 Bacteria 2781
158 Ga0105237_10002827 3300009545 Bacteria 21113
159 Ga0105237_10009312 3300009545 Bacteria 10521
160 Ga0105238_10027422 3300009551 Bacteria 5804
161 Ga0105239_10003016 3300010375 Bacteria 20980
162 Ga0157319_1000012 3300012497 Bacteria 165761
163 Ga0157371_10009622 3300013102 Bacteria 7599
164 Ga0157374_10021171 3300013296 Bacteria 5781
165 Ga0157374_10184630 3300013296 Bacteria 2038
166 Ga0157378_10063553 3300013297 Bacteria 3298
167 Ga0163162_10229120 3300013306 Bacteria 1988
168 Ga0157372_10017270 3300013307 Bacteria 7747
169 Ga0157375_10002902 3300013308 Bacteria 14857
170 Ga0157375_10029027 3300013308 Bacteria 5196
171 Ga0157375_10036436 3300013308 Bacteria 4706
172 Ga0157375_10039701 3300013308 Bacteria 4532
173 Ga0163163_10000906 3300014325 Bacteria 25107
174 Ga0163163_10228243 3300014325 Bacteria 1911
175 Ga0163163_10237950 3300014325 Bacteria 1870
176 Ga0157380_10034233 3300014326 Bacteria 3917
177 Ga0182008_10000260 3300014497 Bacteria 41217
178 Ga0157377_10000006 3300014745 Bacteria 419853
179 Ga0157379_10004903 3300014968 Bacteria 11489
180 Ga0157379_10009898 3300014968 Bacteria 8304
181 Ga0157379_10064845 3300014968 Bacteria 3264
182 Ga0157379_10067819 3300014968 Bacteria 3189
183 Ga0157376_10083169 3300014969 Bacteria 2753
184 Ga0163161_10012686 3300017792 Bacteria 5853
185 Ga0163161_10013260 3300017792 Bacteria 5729
186 Ga0213872_10000147 3300021361 Bacteria 64440
187 Ga0213872_10031039 3300021361 Bacteria 2449
188 Ga0213876_10046286 3300021384 Bacteria 2300
189 Ga0209436_102144 3300025208 Bacteria 6177
190 Ga0207425_1000009 3300025245 Bacteria 593135
191 Ga0207425_1000454 3300025245 Bacteria 26617
192 Ga0207425_1000833 3300025245 Bacteria 15365
193 Ga0207425_1003521 3300025245 Bacteria 4981
194 Ga0209129_1000051 3300025258 Bacteria 267104
195 Ga0209129_1000119 3300025258 Bacteria 138904
196 Ga0209129_1008028 3300025258 Bacteria 3008
197 Ga0209565_1000283 3300025263 Bacteria 49870
198 Ga0209565_1000453 3300025263 Bacteria 31642
199 Ga0209565_1002092 3300025263 Bacteria 7625
200 Ga0209673_1000136 3300025273 Bacteria 159975
201 Ga0209673_1002618 3300025273 Bacteria 12096
202 Ga0209673_1003207 3300025273 Bacteria 9909
203 Ga0209673_1003855 3300025273 Bacteria 8463
204 Ga0209673_1005746 3300025273 Bacteria 6177
205 Ga0209673_1008573 3300025273 Bacteria 4537
206 Ga0209130_1001621 3300025284 Bacteria 13906
207 Ga0209130_1005159 3300025284 Bacteria 4632
208 Ga0209675_1000071 3300025291 Bacteria 168382
209 Ga0209675_1000511 3300025291 Bacteria 28764
210 Ga0209675_1006462 3300025291 Bacteria 4691
211 Ga0209676_1000643 3300025292 Bacteria 50106
212 Ga0209025_1002974 3300025294 Bacteria 16807
213 Ga0209025_1008922 3300025294 Bacteria 7096
214 Ga0209025_1021308 3300025294 Bacteria 3497
215 Ga0209564_1000003 3300025295 Bacteria 1585848
216 Ga0209564_1000024 3300025295 Bacteria 535041
217 Ga0209564_1000067 3300025295 Bacteria 311242
218 Ga0209564_1007259 3300025295 Bacteria 5757
219 Ga0209564_1014095 3300025295 Bacteria 3348
220 Ga0209758_1000054 3300025297 Bacteria 337655
221 Ga0209758_1000367 3300025297 Bacteria 80207
222 Ga0209758_1000572 3300025297 Bacteria 57723
223 Ga0209758_1011402 3300025297 Bacteria 5154
224 Ga0209050_1000040 3300025298 Bacteria 408492
225 Ga0209050_1000365 3300025298 Bacteria 86866
226 Ga0209050_1000489 3300025298 Bacteria 68506
227 Ga0209050_1004359 3300025298 Bacteria 9608
228 Ga0209256_1000306 3300025299 Bacteria 85936
229 Ga0209256_1001208 3300025299 Bacteria 28921
230 Ga0209256_1001380 3300025299 Bacteria 25413
231 Ga0209256_1007017 3300025299 Bacteria 5718
232 Ga0207426_1000105 3300025302 Bacteria 247269
233 Ga0209051_1000180 3300025303 Bacteria 113724
234 Ga0209051_1006168 3300025303 Bacteria 6808
235 Ga0209257_1000054 3300025304 Bacteria 416957
236 Ga0209257_1001179 3300025304 Bacteria 33049
237 Ga0209257_1005272 3300025304 Bacteria 9216
238 Ga0209257_1007511 3300025304 Bacteria 6556
239 Ga0207682_10017466 3300025893 Bacteria 2802
240 Ga0207688_10022614 3300025901 Bacteria 3441
241 Ga0207645_10006247 3300025907 Bacteria 8559
242 Ga0207645_10092910 3300025907 Bacteria 1941
243 Ga0207707_10041104 3300025912 Bacteria 4037
244 Ga0207695_10004581 3300025913 Bacteria 18783
245 Ga0207695_10032789 3300025913 Bacteria 5678
246 Ga0207671_10002906 3300025914 Bacteria 17691
247 Ga0207649_10010632 3300025920 Bacteria 5060
248 Ga0207694_10027018 3300025924 Bacteria 4369
249 Ga0207650_10002435 3300025925 Bacteria 12959
250 Ga0207650_10007961 3300025925 Bacteria 7224
251 Ga0207650_10015788 3300025925 Bacteria 5265
252 Ga0207659_10001430 3300025926 Bacteria 14223
253 Ga0207659_10034006 3300025926 Bacteria 3512
254 Ga0207659_10037079 3300025926 Bacteria 3382
255 Ga0207659_10047403 3300025926 Bacteria 3039
256 Ga0207644_10001539 3300025931 Bacteria 14856
257 Ga0207644_10016347 3300025931 Bacteria 4992
258 Ga0207644_10032460 3300025931 Bacteria 3643
259 Ga0207644_10038416 3300025931 Bacteria 3372
260 Ga0207690_10082124 3300025932 Bacteria 2253
261 Ga0207706_10016730 3300025933 Bacteria 6620
262 Ga0207706_10036193 3300025933 Bacteria 4385
263 Ga0207706_10066879 3300025933 Bacteria 3163
264 Ga0207709_10000534 3300025935 Bacteria 32767
265 Ga0207709_10004359 3300025935 Bacteria 8190
266 Ga0207709_10045734 3300025935 Bacteria 2653
267 Ga0207669_10047248 3300025937 Bacteria 2548
268 Ga0207704_10096451 3300025938 Bacteria 1958
269 Ga0207691_10005185 3300025940 Bacteria 12580
270 Ga0207691_10005251 3300025940 Bacteria 12506
271 Ga0207691_10011286 3300025940 Bacteria 8572
272 Ga0207691_10021869 3300025940 Bacteria 6036
273 Ga0207691_10041216 3300025940 Bacteria 4264
274 Ga0207691_10050848 3300025940 Bacteria 3792
275 Ga0207691_10058636 3300025940 Bacteria 3501
276 Ga0207691_10080367 3300025940 Bacteria 2932
277 Ga0207711_10066151 3300025941 Bacteria 3126
278 Ga0207711_10091116 3300025941 Bacteria 2681
279 Ga0207689_10041612 3300025942 Bacteria 3802
280 Ga0207679_10000077 3300025945 Bacteria 86432
281 Ga0207679_10071442 3300025945 Bacteria 2618
282 Ga0207651_10003234 3300025960 Bacteria 7973
283 Ga0207651_10007733 3300025960 Bacteria 5744
284 Ga0207651_10042664 3300025960 Bacteria 3021
285 Ga0207712_10007285 3300025961 Bacteria 6977
286 Ga0207658_10027358 3300025986 Bacteria 4005
287 Ga0207658_10059717 3300025986 Bacteria 2842
288 Ga0207658_10156950 3300025986 Bacteria 1860
289 Ga0207677_10000913 3300026023 Bacteria 16539
290 Ga0207677_10002997 3300026023 Bacteria 8919
291 Ga0207677_10053874 3300026023 Bacteria 2741
292 Ga0207677_10059682 3300026023 Bacteria 2632
293 Ga0207677_10083463 3300026023 Bacteria 2300
294 Ga0207677_10095134 3300026023 Bacteria 2176
295 Ga0207703_10032253 3300026035 Bacteria 4145
296 Ga0207703_10051883 3300026035 Bacteria 3327
297 Ga0207678_10000060 3300026067 Bacteria 85708
298 Ga0207678_10007367 3300026067 Bacteria 9739
299 Ga0207678_10036238 3300026067 Bacteria 4294
300 Ga0207678_10076529 3300026067 Bacteria 2866
301 Ga0207702_10016025 3300026078 Bacteria 6205
302 Ga0207641_10018059 3300026088 Bacteria 5780
303 Ga0207641_10026708 3300026088 Bacteria 4766
304 Ga0207641_10034248 3300026088 Bacteria 4223
305 Ga0207648_10000023 3300026089 Bacteria 134519
306 Ga0207648_10012280 3300026089 Bacteria 8018
307 Ga0207648_10021301 3300026089 Bacteria 5827
308 Ga0207676_10002333 3300026095 Bacteria 13613
309 Ga0207676_10005190 3300026095 Bacteria 9216
310 Ga0207676_10060721 3300026095 Bacteria 2991
311 Ga0207676_10158637 3300026095 Bacteria 1957
312 Ga0207674_10007706 3300026116 Bacteria 12530
313 Ga0207674_10017280 3300026116 Bacteria 7871
314 Ga0207674_10191148 3300026116 Bacteria 1997
315 Ga0207675_100018208 3300026118 Bacteria 6549
316 Ga0207683_10004105 3300026121 Bacteria 12582
317 Ga0207683_10019656 3300026121 Bacteria 5772
318 Ga0207683_10024199 3300026121 Bacteria 5227
319 Ga0207683_10028788 3300026121 Bacteria 4806
320 Ga0207698_10014931 3300026142 Bacteria 5184
321 Ga0207698_10046424 3300026142 Bacteria 3280
322 Ga0207698_10060167 3300026142 Bacteria 2953
323 Ga0207698_10062168 3300026142 Bacteria 2914
324 Ga0207698_10070247 3300026142 Bacteria 2774
325 Ga0209282_1000316 3300027666 Bacteria 24005
326 Ga0209971_1003007 3300027682 Bacteria 4030
327 Ga0209974_10006579 3300027876 Bacteria 4048
328 Ga0207428_10065357 3300027907 Bacteria 2870
329 Ga0268264_10030401 3300028381 Bacteria 4426
330 Ga0268264_10123691 3300028381 Bacteria 2283
331 Ga0307517_10002447 3300028786 Bacteria 29685
332 Ga0307515_10000109 3300028794 Bacteria 195895
333 Ga0307515_10000183 3300028794 Bacteria 154076
334 Ga0307515_10000222 3300028794 Bacteria 140902
335 Ga0307515_10004774 3300028794 Bacteria 27760
336 Ga0307515_10018912 3300028794 Bacteria 12438
337 Ga0307515_10032371 3300028794 Bacteria 8666
338 Ga0307515_10084042 3300028794 Bacteria 4094
339 Ga0307515_10142538 3300028794 Bacteria 2561
340 Ga0307512_10030278 3300030522 Bacteria 4712
341 Ga0316178_1167054 3300030735 Bacteria 3540
342 Ga0316183_1032657 3300030742 Bacteria 5984
343 Ga0316181_1198189 3300030744 Bacteria 3501
344 Ga0265330_10019751 3300031235 Bacteria 3083
345 Ga0265332_10000006 3300031238 Bacteria 327963
346 Ga0265332_10007822 3300031238 Bacteria 4825
347 Ga0265331_10020669 3300031250 Bacteria 3376
348 Ga0265327_10027826 3300031251 Bacteria 3246
349 Ga0265327_10042733 3300031251 Bacteria 2431
350 Ga0307513_10000037 3300031456 Bacteria 175364
351 Ga0307513_10006129 3300031456 Bacteria 15780
352 Ga0307513_10010871 3300031456 Bacteria 11368
353 Ga0307513_10036638 3300031456 Bacteria 5467
354 Ga0307513_10062497 3300031456 Bacteria 3935
355 Ga0307513_10094935 3300031456 Bacteria 3025
356 Ga0307513_10123153 3300031456 Bacteria 2555
357 Ga0307509_10000509 3300031507 Bacteria 66233
358 Ga0307509_10019785 3300031507 Bacteria 7659
359 Ga0307509_10038381 3300031507 Bacteria 5225
360 Ga0307509_10046126 3300031507 Bacteria 4693
361 Ga0307408_100001110 3300031548 Bacteria 20533
362 Ga0307408_100001266 3300031548 Bacteria 18967
363 Ga0307408_100026508 3300031548 Bacteria 3982
364 Ga0307508_10000099 3300031616 Bacteria 102389
365 Ga0307508_10000237 3300031616 Bacteria 67014
366 Ga0307508_10070714 3300031616 Bacteria 3063
367 Ga0307514_10001498 3300031649 Bacteria 28071
368 Ga0307514_10006643 3300031649 Bacteria 10033
369 Ga0307514_10040159 3300031649 Bacteria 3691
370 Ga0265314_10000481 3300031711 Bacteria 52341
371 Ga0265314_10024628 3300031711 Bacteria 4560
372 Ga0265342_10068950 3300031712 Bacteria 2066
373 Ga0307516_10004137 3300031730 Bacteria 18093
374 Ga0307516_10026404 3300031730 Bacteria 5897
375 Ga0307516_10060056 3300031730 Bacteria 3695
376 Ga0307405_10003647 3300031731 Bacteria 7127
377 Ga0307405_10010288 3300031731 Bacteria 4836
378 Ga0307518_10017543 3300031838 Bacteria 5133
379 Ga0307406_10002617 3300031901 Bacteria 9802
380 Ga0307406_10005341 3300031901 Bacteria 7031
381 Ga0307412_10137361 3300031911 Bacteria 1785
382 Ga0307416_100016153 3300032002 Bacteria 5178
383 Ga0307510_10000794 3300033180 Bacteria 32695
384 Ga0307510_10008283 3300033180 Bacteria 12390
385 Ga0307510_10080119 3300033180 Bacteria 3177
386 Ga0307510_10143578 3300033180 Bacteria 2024
387 Ga0373937_0026811 3300036401 Bacteria 5209
388 Ga0373937_0043482 3300036401 Bacteria 4101
389 Ga0395899_0005658 3300037312 Bacteria 9701
390 Ga0395900_0002872 3300037418 Bacteria 18772
391 Ga0395900_0008162 3300037418 Bacteria 10776
392 Ga0395900_0010853 3300037418 Bacteria 9317
393 Ga0395898_0000466 3300037466 Bacteria 80988
394 Ga0395898_0004010 3300037466 Bacteria 16200
395 Ga0395905_0000047 3300037471 Bacteria 237582
396 Ga0395905_0000701 3300037471 Bacteria 44430
397 Ga0395905_0016738 3300037471 Bacteria 6967
398 Ga0395905_0020498 3300037471 Bacteria 6263
399 Ga0395901_0006028 3300038443 Bacteria 12284
400 Ga0395901_0009495 3300038443 Bacteria 9868
401 Ga0395901_0044745 3300038443 Bacteria 4591
402 Ga0436365_0177476 3300039437 Bacteria 8656
403 Ga0436361_0102546 3300039447 Bacteria 5064
404 Ga0436361_0848343 3300039447 Bacteria 176869
405 Ga0436363_1257511 3300039450 Bacteria 3479
406 Ga0439465_0012530 3300041413 Bacteria 2650
407 Ga0451793_0805908 3300041452 Bacteria 1847
408 Ga0451800_0767489 3300041459 Bacteria 2014
409 Ga0439449_0002332 3300042007 Bacteria 7445
410 Ga0439462_0006672 3300042015 Bacteria 2876
411 Ga0450911_000141 3300042115 Bacteria 29229
412 Ga0450919_000949 3300042121 Bacteria 3751
413 Ga0450898_001543 3300042134 Bacteria 3061
414 Ga0450906_000547 3300042145 Bacteria 7937
415 Ga0450906_006812 3300042145 Bacteria 2289
416 Ga0439434_0010865 3300042435 Bacteria 2688
417 Ga0439459_0000929 3300042438 Bacteria 4127
418 Ga0450918_000181 3300042531 Bacteria 13945
419 Ga0451577_0001748 3300042876 Bacteria 27992
420 Ga0451577_0019176 3300042876 Bacteria 6292
421 Ga0451577_0116448 3300042876 Bacteria 2394
422 Ga0451577_0211038 3300042876 Bacteria 1754
423 Ga0466969_0000123 3300044656 Bacteria 41546
424 Ga0466969_0016445 3300044656 Bacteria 3870
425 Ga0466965_0014529 3300044683 Bacteria 3729
426 Ga0466966_0001145 3300044684 Bacteria 17035
427 Ga0466966_0001180 3300044684 Bacteria 16743
428 Ga0466966_0023480 3300044684 Bacteria 4037
429 Ga0466966_0078383 3300044684 Bacteria 2060
430 Ga0466961_0002198 3300044693 Bacteria 12138
431 Ga0466961_0004184 3300044693 Bacteria 9016
432 Ga0453684_0006064 3300044712 Bacteria 23358
433 Ga0453684_0052147 3300044712 Bacteria 5353
434 Ga0453684_0237457 3300044712 Bacteria 2100
435 Ga0466970_0003580 3300044765 Bacteria 7571
436 Ga0466970_0014793 3300044765 Bacteria 4011
437 Ga0466957_0003922 3300044842 Bacteria 8225
438 Ga0466960_0068637 3300044901 Bacteria 1759
439 Ga0466959_0000054 3300045049 Bacteria 79861
440 Ga0466959_0022234 3300045049 Bacteria 4686
441 Ga0466959_0127662 3300045049 Bacteria 1804
442 Ga0451576_0044287 3300045051 Bacteria 4691
443 Ga0466958_0030967 3300045836 Bacteria 3179
444 Ga0466958_0091434 3300045836 Bacteria 1884
445 Ga0466967_0168893 3300045976 Bacteria 2057
446 Ga0495617_000069 3300046452 Bacteria 87505
447 Ga0495617_001148 3300046452 Bacteria 11965
448 Ga0495592_0000140 3300046454 Bacteria 63848
449 Ga0495590_0027722 3300046457 Bacteria 1987
450 Ga0495638_0020544 3300046460 Bacteria 4362
451 Ga0495638_0077477 3300046460 Bacteria 2024
452 Ga0495650_0000141 3300046471 Bacteria 168676
453 Ga0495650_0003526 3300046471 Bacteria 11334
454 Ga0495585_0003292 3300046492 Bacteria 10973
455 Ga0495606_0001155 3300046507 Bacteria 37442
456 Ga0495610_0007568 3300046512 Bacteria 7193
457 Ga0495632_0032665 3300046519 Bacteria 2679
458 Ga0495637_0000659 3300046520 Bacteria 24056
459 Ga0495654_0000864 3300046530 Bacteria 22846
460 Ga0495597_0006252 3300046542 Bacteria 6174
461 Ga0495633_0006682 3300046558 Bacteria 6793
462 Ga0495668_0001662 3300046616 Bacteria 20710
463 Ga0495625_0003882 3300046660 Bacteria 14430
464 Ga0495625_0013353 3300046660 Bacteria 6601
465 Ga0495625_0069638 3300046660 Bacteria 2471
466 Ga0495658_0037073 3300046683 Bacteria 2694
467 Ga0495670_0014601 3300046691 Bacteria 3862
468 Ga0495671_0000005 3300046692 Bacteria 509397
469 Ga0495671_0015084 3300046692 Bacteria 4148
470 Ga0495649_0007969 3300046694 Bacteria 6406
471 Ga0495660_0002328 3300046810 Bacteria 12177
472 Ga0495676_0023410 3300047321 Bacteria 5362
473 Ga0495683_0009601 3300047323 Bacteria 5152
474 Ga0495687_000863 3300047443 Bacteria 32127
475 Ga0495679_030495 3300047446 Bacteria 1749
476 Ga0495673_0000009 3300047469 Bacteria 731993
477 Ga0496102_0000992 3300048905 Bacteria 26687
478 Ga0496104_0026526 3300048907 Bacteria 5352
479 Ga0496109_0043484 3300048912 Bacteria 4072
480 Ga0496110_0018660 3300048913 Bacteria 5820
481 Ga0496110_0034603 3300048913 Bacteria 4377
482 Ga0496113_0123979 3300048916 Bacteria 2022
483 Ga0496121_0006534 3300048924 Bacteria 14414
484 Ga0496122_0026762 3300048925 Bacteria 4958
485 Ga0496123_0019439 3300048926 Bacteria 5354
486 Ga0496124_0021890 3300048927 Bacteria 5880
487 Ga0496124_0078722 3300048927 Bacteria 2716
488 Ga0496125_0012115 3300048928 Bacteria 8579
489 Ga0501031_0000247 3300049568 Bacteria 30292
490 Ga0501227_000748 3300049665 Bacteria 7115
491 Ga0501262_000020 3300049759 Bacteria 23061
492 nmdc:mga03683_6098_c1 3300050489 Bacteria 4110
493 nmdc:mga03683_6561_c1 3300050489 Bacteria 3991
494 nmdc:mga00v17_18485_c1 3300050491 Bacteria 3961
495 nmdc:mga0yw44_43204_c1 3300050492 Bacteria 2690
496 nmdc:mga0k408_12860_c1 3300050493 Bacteria 4582
497 nmdc:mga0k408_20408_c1 3300050493 Bacteria 3711
498 nmdc:mga0k408_27651_c1 3300050493 Bacteria 3222
499 nmdc:mga0k408_28329_c1 3300050493 Bacteria 3184
500 nmdc:mga0k408_30937_c1 3300050493 Bacteria 3054
501 nmdc:mga0k408_41036_c1 3300050493 Bacteria 2664
502 nmdc:mga0k408_54901_c1 3300050493 Bacteria 2309
503 nmdc:mga0k408_59015_c1 3300050493 Bacteria 2229
504 nmdc:mga0k408_9844_c1 3300050493 Bacteria 5161
505 nmdc:mga06z11_3675_c1 3300050494 Bacteria 5958
506 nmdc:mga07m45_12793_c1 3300050496 Bacteria 4439
507 nmdc:mga07m45_1340_c1 3300050496 Bacteria 11228
508 nmdc:mga07m45_1377_c1 3300050496 Bacteria 5351
509 nmdc:mga07m45_30258_c1 3300050496 Bacteria 2998
510 Ga0500578_0000057 3300053086 Bacteria 120178
511 Ga0500652_000211 3300053131 Bacteria 22467
512 Ga0500658_0010713 3300053134 Bacteria 3382
513 Ga0500559_0000027 3300053136 Bacteria 118758
514 Ga0500568_0023088 3300053139 Bacteria 2649
515 Ga0500586_001044 3300053145 Bacteria 5726
516 Ga0500604_0034210 3300053151 Bacteria 1506
517 Ga0500622_0000187 3300053156 Bacteria 65366
518 Ga0500622_0009546 3300053156 Bacteria 5363
519 Ga0500645_000250 3300053730 Bacteria 40018
520 Ga0500645_005125 3300053730 Bacteria 4888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053151 Ga0500604_0034210 Ga0500604_0034210_145_1470 411
2 3300046683 Ga0495658_0037073 Ga0495658_0037073_1246_2676 445
3 3300050489 nmdc:mga03683_6098_c1 nmdc:mga03683_6098_c1_2647_4092 453
4 3300031911 Ga0307412_10137361 Ga0307412_101373612 454
5 3300003790 Ga0055528_1000765 Ga0055528_10007659 456
6 3300025901 Ga0207688_10022614 Ga0207688_100226141 457
7 3300025945 Ga0207679_10071442 Ga0207679_100714422 464
8 3300036401 Ga0373937_0043482 Ga0373937_0043482_19_1518 466
9 3300041452 Ga0451793_0805908 Ga0451793_0805908_333_1808 468
10 3300050493 nmdc:mga0k408_12860_c1 nmdc:mga0k408_12860_c1_2913_4424 468
11 3300003771 Ga0055526_1002103 Ga0055526_10021032 469
12 3300025273 Ga0209673_1008573 Ga0209673_10085732 469
13 3300025295 Ga0209564_1000003 Ga0209564_10000031028 469
14 3300026067 Ga0207678_10036238 Ga0207678_100362384 470
15 3300009098 Ga0105245_10131010 Ga0105245_101310102 472
16 3300005331 Ga0070670_100131964 Ga0070670_1001319642 475
17 3300006178 Ga0075367_10034093 Ga0075367_100340932 475
18 3300005331 Ga0070670_100014692 Ga0070670_1000146926 476
19 3300005355 Ga0070671_100016295 Ga0070671_1000162952 476
20 3300005364 Ga0070673_100017602 Ga0070673_1000176025 476
21 3300005543 Ga0070672_100000121 Ga0070672_10000012132 476
22 3300006237 Ga0097621_100026018 Ga0097621_1000260185 476
23 3300013308 Ga0157375_10029027 Ga0157375_100290274 476
24 3300025925 Ga0207650_10007961 Ga0207650_100079616 476
25 3300025926 Ga0207659_10047403 Ga0207659_100474032 476
26 3300025931 Ga0207644_10038416 Ga0207644_100384162 476
27 3300025940 Ga0207691_10005251 Ga0207691_100052518 476
28 3300025960 Ga0207651_10007733 Ga0207651_100077332 476
29 3300025986 Ga0207658_10059717 Ga0207658_100597172 476
30 3300026095 Ga0207676_10005190 Ga0207676_100051902 476
31 3300026121 Ga0207683_10019656 Ga0207683_100196564 476
32 3300031730 Ga0307516_10004137 Ga0307516_1000413714 476
33 3300046691 Ga0495670_0014601 Ga0495670_0014601_82_1722 476
34 3300021361 Ga0213872_10000147 Ga0213872_1000014736 477
35 3300039447 Ga0436361_0848343 Ga0436361_0848343_144832_146424 477
36 3300005329 Ga0070683_100011636 Ga0070683_1000116366 478
37 3300005547 Ga0070693_100007105 Ga0070693_1000071054 478
38 3300005834 Ga0068851_10054195 Ga0068851_100541952 478
39 3300025932 Ga0207690_10082124 Ga0207690_100821241 478
40 3300050493 nmdc:mga0k408_59015_c1 nmdc:mga0k408_59015_c1_86_1729 478
41 3300005355 Ga0070671_100139215 Ga0070671_1001392151 479
42 3300005616 Ga0068852_100138282 Ga0068852_1001382822 479
43 3300013296 Ga0157374_10021171 Ga0157374_100211715 479
44 3300025907 Ga0207645_10092910 Ga0207645_100929101 479
45 3300026067 Ga0207678_10007367 Ga0207678_100073675 479
46 3300026142 Ga0207698_10014931 Ga0207698_100149312 479
47 3300048912 Ga0496109_0043484 Ga0496109_0043484_305_1909 479
48 3300048913 Ga0496110_0018660 Ga0496110_0018660_247_1923 479
49 3300027682 Ga0209971_1003007 Ga0209971_10030071 480
50 3300005333 Ga0070677_10034927 Ga0070677_100349271 481
51 3300005459 Ga0068867_100008736 Ga0068867_1000087361 481
52 3300026089 Ga0207648_10012280 Ga0207648_100122804 481
53 3300026121 Ga0207683_10024199 Ga0207683_100241994 481
54 3300004625 Ga0055543_1009182 Ga0055543_10091822 482
55 3300005262 Ga0065165_1000884 Ga0065165_100088418 482
56 3300005355 Ga0070671_100009522 Ga0070671_1000095223 482
57 3300025931 Ga0207644_10001539 Ga0207644_1000153913 482
58 3300005355 Ga0070671_100132612 Ga0070671_1001326122 483
59 3300005618 Ga0068864_100012983 Ga0068864_1000129832 483
60 3300025941 Ga0207711_10091116 Ga0207711_100911162 483
61 3300042015 Ga0439462_0006672 Ga0439462_0006672_22_1548 483
62 iso_pu_bacteria 2928115317 2928118912 483
63 3300039450 Ga0436363_1257511 Ga0436363_1257511_918_2591 484
64 3300003320 rootH2_10019664 rootH2_100196643 485
65 3300003322 rootL2_10000530 rootL2_100005302 485
66 3300003775 Ga0055524_1000781 Ga0055524_100078113 485
67 3300005467 Ga0070706_100013591 Ga0070706_1000135912 485
68 3300006038 Ga0075365_10000807 Ga0075365_100008071 485
69 3300006178 Ga0075367_10011156 Ga0075367_100111564 485
70 3300006178 Ga0075367_10026158 Ga0075367_100261582 485
71 3300006195 Ga0075366_10028996 Ga0075366_100289963 485
72 3300012497 Ga0157319_1000012 Ga0157319_100001251 485
73 3300025299 Ga0209256_1000306 Ga0209256_100030628 485
74 3300025304 Ga0209257_1001179 Ga0209257_100117922 485
75 3300042438 Ga0439459_0000929 Ga0439459_0000929_301_1947 485
76 3300050493 nmdc:mga0k408_27651_c1 nmdc:mga0k408_27651_c1_452_2098 485
77 3300050496 nmdc:mga07m45_12793_c1 nmdc:mga07m45_12793_c1_1447_3093 485
78 3300003794 Ga0055531_10012401 Ga0055531_100124016 486
79 3300004625 Ga0055543_1002538 Ga0055543_10025382 486
80 3300005262 Ga0065165_1000006 Ga0065165_100000673 486
81 3300005327 Ga0070658_10040739 Ga0070658_100407392 486
82 3300006944 Ga0099823_1001509 Ga0099823_10015093 486
83 3300009177 Ga0105248_10039400 Ga0105248_100394004 486
84 3300025273 Ga0209673_1003207 Ga0209673_10032079 486
85 3300025299 Ga0209256_1007017 Ga0209256_10070178 486
86 3300025303 Ga0209051_1006168 Ga0209051_10061687 486
87 3300025304 Ga0209257_1007511 Ga0209257_10075113 486
88 3300038443 Ga0395901_0044745 Ga0395901_0044745_2117_3673 486
89 3300048927 Ga0496124_0021890 Ga0496124_0021890_503_2155 486
90 3300005614 Ga0068856_100023685 Ga0068856_1000236853 487
91 3300013102 Ga0157371_10009622 Ga0157371_100096225 487
92 3300013307 Ga0157372_10017270 Ga0157372_100172706 487
93 3300026116 Ga0207674_10017280 Ga0207674_100172806 487
94 3300028794 Ga0307515_10004774 Ga0307515_1000477418 487
95 3300031616 Ga0307508_10000237 Ga0307508_1000023721 487
96 3300031649 Ga0307514_10006643 Ga0307514_100066432 487
97 3300048907 Ga0496104_0026526 Ga0496104_0026526_1624_3285 487
98 3300006358 Ga0068871_100031625 Ga0068871_1000316252 488
99 3300014968 Ga0157379_10004903 Ga0157379_100049037 488
100 3300026023 Ga0207677_10000913 Ga0207677_1000091314 488
101 3300031711 Ga0265314_10024628 Ga0265314_100246282 488
102 3300031712 Ga0265342_10068950 Ga0265342_100689502 488
103 3300042876 Ga0451577_0019176 Ga0451577_0019176_926_2527 488
104 3300003322 rootL2_10092988 rootL2_100929882 489
105 3300005364 Ga0070673_100098271 Ga0070673_1000982712 489
106 3300009177 Ga0105248_10074839 Ga0105248_100748392 489
107 3300013306 Ga0163162_10229120 Ga0163162_102291202 489
108 3300013308 Ga0157375_10039701 Ga0157375_100397013 489
109 3300014325 Ga0163163_10228243 Ga0163163_102282432 489
110 3300014497 Ga0182008_10000260 Ga0182008_1000026017 489
111 3300025940 Ga0207691_10021869 Ga0207691_100218692 489
112 3300025941 Ga0207711_10066151 Ga0207711_100661512 489
113 3300025960 Ga0207651_10042664 Ga0207651_100426643 489
114 3300026088 Ga0207641_10034248 Ga0207641_100342483 489
115 3300028794 Ga0307515_10000183 Ga0307515_10000183120 489
116 3300031507 Ga0307509_10038381 Ga0307509_100383812 489
117 3300031730 Ga0307516_10060056 Ga0307516_100600562 489
118 3300042007 Ga0439449_0002332 Ga0439449_0002332_925_2493 489
119 iso_pu_bacteria 2831864461 2831864999 489
120 3300003773 Ga0055537_1000341 Ga0055537_100034114 490
121 3300003784 Ga0055534_1000320 Ga0055534_100032014 490
122 3300005328 Ga0070676_10006013 Ga0070676_100060134 490
123 3300005333 Ga0070677_10022575 Ga0070677_100225752 490
124 3300005335 Ga0070666_10072783 Ga0070666_100727832 490
125 3300005347 Ga0070668_100022359 Ga0070668_1000223593 490
126 3300005353 Ga0070669_100044255 Ga0070669_1000442552 490
127 3300005356 Ga0070674_100015289 Ga0070674_1000152894 490
128 3300005367 Ga0070667_100017860 Ga0070667_1000178605 490
129 3300005457 Ga0070662_100020637 Ga0070662_1000206373 490
130 3300005459 Ga0068867_100024500 Ga0068867_1000245002 490
131 3300005617 Ga0068859_100046009 Ga0068859_1000460093 490
132 3300005719 Ga0068861_100033415 Ga0068861_1000334152 490
133 3300005841 Ga0068863_100115433 Ga0068863_1001154332 490
134 3300005842 Ga0068858_100045866 Ga0068858_1000458664 490
135 3300006881 Ga0068865_100047247 Ga0068865_1000472472 490
136 3300006931 Ga0097620_100046010 Ga0097620_1000460102 490
137 3300006948 Ga0099826_10014323 Ga0099826_100143232 490
138 3300014968 Ga0157379_10064845 Ga0157379_100648452 490
139 3300017792 Ga0163161_10012686 Ga0163161_100126865 490
140 3300021361 Ga0213872_10031039 Ga0213872_100310392 490
141 3300025263 Ga0209565_1000283 Ga0209565_100028314 490
142 3300025273 Ga0209673_1000136 Ga0209673_1000136133 490
143 3300025291 Ga0209675_1000071 Ga0209675_1000071133 490
144 3300025907 Ga0207645_10006247 Ga0207645_100062476 490
145 3300025937 Ga0207669_10047248 Ga0207669_100472482 490
146 3300025940 Ga0207691_10050848 Ga0207691_100508483 490
147 3300025942 Ga0207689_10041612 Ga0207689_100416123 490
148 3300025961 Ga0207712_10007285 Ga0207712_100072855 490
149 3300026088 Ga0207641_10026708 Ga0207641_100267082 490
150 3300026095 Ga0207676_10060721 Ga0207676_100607212 490
151 3300026118 Ga0207675_100018208 Ga0207675_1000182083 490
152 3300026121 Ga0207683_10028788 Ga0207683_100287884 490
153 3300027666 Ga0209282_1000316 Ga0209282_10003162 490
154 3300028381 Ga0268264_10030401 Ga0268264_100304012 490
155 3300039447 Ga0436361_0102546 Ga0436361_0102546_389_1987 490
156 3300046530 Ga0495654_0000864 Ga0495654_0000864_12234_13853 490
157 3300005334 Ga0068869_100077319 Ga0068869_1000773192 491
158 3300005338 Ga0068868_100036818 Ga0068868_1000368183 491
159 3300005578 Ga0068854_100011979 Ga0068854_1000119796 491
160 3300005616 Ga0068852_100165138 Ga0068852_1001651382 491
161 3300009148 Ga0105243_10015999 Ga0105243_100159994 491
162 3300025298 Ga0209050_1000489 Ga0209050_10004895 491
163 3300025935 Ga0207709_10000534 Ga0207709_1000053430 491
164 3300026023 Ga0207677_10053874 Ga0207677_100538742 491
165 3300026142 Ga0207698_10060167 Ga0207698_100601673 491
166 3300031456 Ga0307513_10010871 Ga0307513_100108716 491
167 3300053730 Ga0500645_000250 Ga0500645_000250_17533_19158 491
168 iso_pu_bacteria 2643221683 2644465762 491
169 iso_pu_bacteria 2929520902 2929526229 491
170 3300025291 Ga0209675_1006462 Ga0209675_10064623 492
171 3300025294 Ga0209025_1008922 Ga0209025_10089226 492
172 3300031251 Ga0265327_10027826 Ga0265327_100278262 492
173 3300042115 Ga0450911_000141 Ga0450911_000141_17221_18798 492
174 3300042876 Ga0451577_0001748 Ga0451577_0001748_4407_5990 492
175 3300048924 Ga0496121_0006534 Ga0496121_0006534_2382_3953 492
176 3300048926 Ga0496123_0019439 Ga0496123_0019439_732_2369 492
177 3300048927 Ga0496124_0078722 Ga0496124_0078722_1069_2640 492
178 3300048928 Ga0496125_0012115 Ga0496125_0012115_3098_4669 492
179 3300050493 nmdc:mga0k408_54901_c1 nmdc:mga0k408_54901_c1_615_2201 492
180 3300005367 Ga0070667_100008777 Ga0070667_1000087776 493
181 3300028794 Ga0307515_10000222 Ga0307515_1000022274 493
182 3300028794 Ga0307515_10032371 Ga0307515_100323715 493
183 3300031649 Ga0307514_10001498 Ga0307514_1000149810 493
184 3300042145 Ga0450906_006812 Ga0450906_006812_483_2111 493
185 3300046457 Ga0495590_0027722 Ga0495590_0027722_307_1953 493
186 3300048913 Ga0496110_0034603 Ga0496110_0034603_2452_4035 493
187 iso_pu_bacteria 2643221628 2644163570 493
188 iso_pu_bacteria 2842677519 2842678136 493
189 iso_pu_bacteria 2919462493 2919466719 493
190 3300005456 Ga0070678_100076194 Ga0070678_1000761942 494
191 3300025273 Ga0209673_1003855 Ga0209673_10038553 494
192 3300025940 Ga0207691_10058636 Ga0207691_100586362 494
193 3300005355 Ga0070671_100070032 Ga0070671_1000700322 495
194 3300005841 Ga0068863_100023139 Ga0068863_1000231392 495
195 3300025931 Ga0207644_10032460 Ga0207644_100324602 495
196 3300031456 Ga0307513_10000037 Ga0307513_10000037102 495
197 3300037418 Ga0395900_0010853 Ga0395900_0010853_7489_9120 495
198 3300037466 Ga0395898_0000466 Ga0395898_0000466_71322_72953 495
199 iso_pu_bacteria 2588253510 2588290164 495
200 3300005327 Ga0070658_10038749 Ga0070658_100387494 496
201 3300044712 Ga0453684_0006064 Ga0453684_0006064_14972_16609 496
202 3300050493 nmdc:mga0k408_28329_c1 nmdc:mga0k408_28329_c1_1499_3079 496
203 3300003354 JGI25160J50197_1000076 JGI25160J50197_100007619 497
204 3300003781 Ga0055536_1003849 Ga0055536_10038495 497
205 3300003792 Ga0055540_1003225 Ga0055540_10032254 497
206 3300005288 Ga0065714_10067056 Ga0065714_100670562 497
207 3300006051 Ga0075364_10026869 Ga0075364_100268692 497
208 3300006058 Ga0075432_10008119 Ga0075432_100081193 497
209 3300009148 Ga0105243_10128822 Ga0105243_101288222 497
210 3300017792 Ga0163161_10013260 Ga0163161_100132604 497
211 3300025245 Ga0207425_1003521 Ga0207425_10035212 497
212 3300025292 Ga0209676_1000643 Ga0209676_100064327 497
213 3300025294 Ga0209025_1002974 Ga0209025_10029745 497
214 3300025294 Ga0209025_1021308 Ga0209025_10213081 497
215 3300025297 Ga0209758_1011402 Ga0209758_10114022 497
216 3300025303 Ga0209051_1000180 Ga0209051_100018016 497
217 3300030735 Ga0316178_1167054 Ga0316178_11670542 497
218 3300030742 Ga0316183_1032657 Ga0316183_10326573 497
219 3300031731 Ga0307405_10003647 Ga0307405_100036474 497
220 3300041413 Ga0439465_0012530 Ga0439465_0012530_599_2209 497
221 3300042145 Ga0450906_000547 Ga0450906_000547_828_2438 497
222 3300042435 Ga0439434_0010865 Ga0439434_0010865_118_1728 497
223 3300046542 Ga0495597_0006252 Ga0495597_0006252_420_2042 497
224 3300046660 Ga0495625_0069638 Ga0495625_0069638_112_1758 497
225 3300046694 Ga0495649_0007969 Ga0495649_0007969_36_1682 497
226 3300047321 Ga0495676_0023410 Ga0495676_0023410_1463_3091 497
227 3300047443 Ga0495687_000863 Ga0495687_000863_18946_20568 497
228 3300049759 Ga0501262_000020 Ga0501262_000020_17477_19087 497
229 3300053134 Ga0500658_0010713 Ga0500658_0010713_160_1806 497
230 iso_pu_bacteria 2511231002 2511245982 497
231 3300003322 rootL2_10010127 rootL2_100101272 498
232 3300005338 Ga0068868_100029330 Ga0068868_1000293303 498
233 3300005339 Ga0070660_100134611 Ga0070660_1001346111 498
234 3300005543 Ga0070672_100009643 Ga0070672_1000096435 498
235 3300005563 Ga0068855_100081355 Ga0068855_1000813552 498
236 3300005842 Ga0068858_100022657 Ga0068858_1000226577 498
237 3300006038 Ga0075365_10011875 Ga0075365_100118754 498
238 3300006051 Ga0075364_10008509 Ga0075364_100085092 498
239 3300006177 Ga0075362_10006172 Ga0075362_100061722 498
240 3300006353 Ga0075370_10000588 Ga0075370_1000058812 498
241 3300009098 Ga0105245_10044849 Ga0105245_100448493 498
242 3300009176 Ga0105242_10115859 Ga0105242_101158592 498
243 3300014326 Ga0157380_10034233 Ga0157380_100342335 498
244 3300021384 Ga0213876_10046286 Ga0213876_100462862 498
245 3300025938 Ga0207704_10096451 Ga0207704_100964512 498
246 3300025940 Ga0207691_10005185 Ga0207691_100051857 498
247 3300025940 Ga0207691_10080367 Ga0207691_100803672 498
248 3300026023 Ga0207677_10059682 Ga0207677_100596821 498
249 3300026023 Ga0207677_10083463 Ga0207677_100834631 498
250 3300026035 Ga0207703_10051883 Ga0207703_100518832 498
251 3300027907 Ga0207428_10065357 Ga0207428_100653572 498
252 3300031235 Ga0265330_10019751 Ga0265330_100197512 498
253 3300031238 Ga0265332_10007822 Ga0265332_100078222 498
254 3300031548 Ga0307408_100026508 Ga0307408_1000265082 498
255 3300031711 Ga0265314_10000481 Ga0265314_1000048118 498
256 3300031731 Ga0307405_10010288 Ga0307405_100102882 498
257 3300031901 Ga0307406_10002617 Ga0307406_100026172 498
258 3300037312 Ga0395899_0005658 Ga0395899_0005658_1909_3489 498
259 3300037418 Ga0395900_0002872 Ga0395900_0002872_3891_5471 498
260 3300037466 Ga0395898_0004010 Ga0395898_0004010_9704_11284 498
261 3300037471 Ga0395905_0000047 Ga0395905_0000047_104309_105916 498
262 3300037471 Ga0395905_0000701 Ga0395905_0000701_34871_36469 498
263 3300037471 Ga0395905_0016738 Ga0395905_0016738_696_2279 498
264 3300037471 Ga0395905_0020498 Ga0395905_0020498_4521_6101 498
265 3300038443 Ga0395901_0009495 Ga0395901_0009495_598_2178 498
266 3300039437 Ga0436365_0177476 Ga0436365_0177476_3427_5082 498
267 3300042134 Ga0450898_001543 Ga0450898_001543_1174_2787 498
268 3300044656 Ga0466969_0016445 Ga0466969_0016445_2011_3591 498
269 3300044693 Ga0466961_0004184 Ga0466961_0004184_3771_5351 498
270 3300044765 Ga0466970_0014793 Ga0466970_0014793_2229_3809 498
271 3300044901 Ga0466960_0068637 Ga0466960_0068637_83_1669 498
272 3300045976 Ga0466967_0168893 Ga0466967_0168893_366_1946 498
273 3300046660 Ga0495625_0013353 Ga0495625_0013353_1278_2897 498
274 3300050491 nmdc:mga00v17_18485_c1 nmdc:mga00v17_18485_c1_803_2422 498
275 3300050492 nmdc:mga0yw44_43204_c1 nmdc:mga0yw44_43204_c1_530_2149 498
276 3300050493 nmdc:mga0k408_20408_c1 nmdc:mga0k408_20408_c1_555_2216 498
277 3300050493 nmdc:mga0k408_41036_c1 nmdc:mga0k408_41036_c1_504_2123 498
278 3300050496 nmdc:mga07m45_1377_c1 nmdc:mga07m45_1377_c1_195_1856 498
279 3300003323 rootH1_10236920 rootH1_102369201 499
280 3300003771 Ga0055526_1005737 Ga0055526_10057373 499
281 3300005543 Ga0070672_100051255 Ga0070672_1000512552 499
282 3300005843 Ga0068860_100063193 Ga0068860_1000631932 499
283 3300014968 Ga0157379_10067819 Ga0157379_100678192 499
284 3300025245 Ga0207425_1000454 Ga0207425_100045412 499
285 3300025258 Ga0209129_1000119 Ga0209129_100011934 499
286 3300025295 Ga0209564_1000024 Ga0209564_100002434 499
287 3300025297 Ga0209758_1000572 Ga0209758_100057235 499
288 3300025893 Ga0207682_10017466 Ga0207682_100174662 499
289 3300025933 Ga0207706_10036193 Ga0207706_100361933 499
290 3300025935 Ga0207709_10045734 Ga0207709_100457342 499
291 3300026089 Ga0207648_10021301 Ga0207648_100213013 499
292 3300031238 Ga0265332_10000006 Ga0265332_1000000644 499
293 3300037418 Ga0395900_0008162 Ga0395900_0008162_6187_7785 499
294 3300038443 Ga0395901_0006028 Ga0395901_0006028_2855_4453 499
295 3300044656 Ga0466969_0000123 Ga0466969_0000123_16304_17917 499
296 3300044683 Ga0466965_0014529 Ga0466965_0014529_1202_2821 499
297 3300044684 Ga0466966_0001180 Ga0466966_0001180_6540_8153 499
298 3300044684 Ga0466966_0023480 Ga0466966_0023480_1260_2879 499
299 3300044693 Ga0466961_0002198 Ga0466961_0002198_1315_2934 499
300 3300044712 Ga0453684_0052147 Ga0453684_0052147_2463_4124 499
301 3300044712 Ga0453684_0237457 Ga0453684_0237457_161_1822 499
302 3300044765 Ga0466970_0003580 Ga0466970_0003580_1285_2904 499
303 3300044842 Ga0466957_0003922 Ga0466957_0003922_4961_6580 499
304 3300045049 Ga0466959_0000054 Ga0466959_0000054_32046_33665 499
305 3300045051 Ga0451576_0044287 Ga0451576_0044287_568_2229 499
306 3300045836 Ga0466958_0030967 Ga0466958_0030967_402_2021 499
307 3300045836 Ga0466958_0091434 Ga0466958_0091434_208_1812 499
308 3300046471 Ga0495650_0003526 Ga0495650_0003526_4137_5732 499
309 3300048905 Ga0496102_0000992 Ga0496102_0000992_14472_16067 499
310 3300049568 Ga0501031_0000247 Ga0501031_0000247_20169_21845 499
311 iso_pu_bacteria 2585428062 2587757123 499
312 iso_pu_bacteria 2643221644 2644247244 499
313 3300003215 JGI25153J46596_10000814 JGI25153J46596_100008144 500
314 3300003784 Ga0055534_1003511 Ga0055534_10035112 500
315 3300005262 Ga0065165_1004839 Ga0065165_10048392 500
316 3300005330 Ga0070690_100004243 Ga0070690_1000042437 500
317 3300005331 Ga0070670_100033752 Ga0070670_1000337522 500
318 3300005335 Ga0070666_10002198 Ga0070666_1000219812 500
319 3300005336 Ga0070680_100042474 Ga0070680_1000424743 500
320 3300005338 Ga0068868_100000575 Ga0068868_10000057512 500
321 3300005344 Ga0070661_100080490 Ga0070661_1000804902 500
322 3300005355 Ga0070671_100018121 Ga0070671_1000181214 500
323 3300005364 Ga0070673_100000934 Ga0070673_1000009342 500
324 3300005366 Ga0070659_100007229 Ga0070659_1000072294 500
325 3300005367 Ga0070667_100005605 Ga0070667_1000056055 500
326 3300005367 Ga0070667_100025997 Ga0070667_1000259973 500
327 3300005455 Ga0070663_100003909 Ga0070663_1000039094 500
328 3300005456 Ga0070678_100002280 Ga0070678_10000228010 500
329 3300005459 Ga0068867_100000076 Ga0068867_10000007614 500
330 3300005530 Ga0070679_100008857 Ga0070679_1000088574 500
331 3300005564 Ga0070664_100000246 Ga0070664_10000024637 500
332 3300005564 Ga0070664_100058898 Ga0070664_1000588982 500
333 3300005614 Ga0068856_100087969 Ga0068856_1000879692 500
334 3300005616 Ga0068852_100003517 Ga0068852_10000351710 500
335 3300005617 Ga0068859_100005691 Ga0068859_1000056915 500
336 3300005618 Ga0068864_100015243 Ga0068864_1000152435 500
337 3300005841 Ga0068863_100010276 Ga0068863_1000102765 500
338 3300005842 Ga0068858_100003339 Ga0068858_1000033396 500
339 3300006931 Ga0097620_100005691 Ga0097620_10000569110 500
340 3300009148 Ga0105243_10036067 Ga0105243_100360673 500
341 3300009177 Ga0105248_10003500 Ga0105248_100035006 500
342 3300009177 Ga0105248_10030711 Ga0105248_100307114 500
343 3300009177 Ga0105248_10135172 Ga0105248_101351722 500
344 3300013297 Ga0157378_10063553 Ga0157378_100635533 500
345 3300013308 Ga0157375_10002902 Ga0157375_1000290212 500
346 3300013308 Ga0157375_10036436 Ga0157375_100364364 500
347 3300014325 Ga0163163_10000906 Ga0163163_1000090624 500
348 3300014325 Ga0163163_10237950 Ga0163163_102379501 500
349 3300014745 Ga0157377_10000006 Ga0157377_10000006157 500
350 3300014968 Ga0157379_10009898 Ga0157379_100098988 500
351 3300014969 Ga0157376_10083169 Ga0157376_100831692 500
352 3300025273 Ga0209673_1005746 Ga0209673_10057465 500
353 3300025291 Ga0209675_1000511 Ga0209675_100051116 500
354 3300025297 Ga0209758_1000367 Ga0209758_10003675 500
355 3300025920 Ga0207649_10010632 Ga0207649_100106323 500
356 3300025925 Ga0207650_10002435 Ga0207650_100024354 500
357 3300025926 Ga0207659_10001430 Ga0207659_1000143012 500
358 3300025926 Ga0207659_10034006 Ga0207659_100340062 500
359 3300025931 Ga0207644_10016347 Ga0207644_100163474 500
360 3300025933 Ga0207706_10066879 Ga0207706_100668793 500
361 3300025935 Ga0207709_10004359 Ga0207709_100043592 500
362 3300025940 Ga0207691_10041216 Ga0207691_100412163 500
363 3300025945 Ga0207679_10000077 Ga0207679_1000007775 500
364 3300025986 Ga0207658_10027358 Ga0207658_100273582 500
365 3300025986 Ga0207658_10156950 Ga0207658_101569502 500
366 3300026023 Ga0207677_10002997 Ga0207677_100029975 500
367 3300026035 Ga0207703_10032253 Ga0207703_100322533 500
368 3300026067 Ga0207678_10000060 Ga0207678_1000006060 500
369 3300026078 Ga0207702_10016025 Ga0207702_100160255 500
370 3300026088 Ga0207641_10018059 Ga0207641_100180595 500
371 3300026089 Ga0207648_10000023 Ga0207648_1000002318 500
372 3300026095 Ga0207676_10002333 Ga0207676_100023332 500
373 3300026095 Ga0207676_10158637 Ga0207676_101586372 500
374 3300026121 Ga0207683_10004105 Ga0207683_100041052 500
375 3300026142 Ga0207698_10062168 Ga0207698_100621681 500
376 3300028381 Ga0268264_10123691 Ga0268264_101236912 500
377 3300028794 Ga0307515_10084042 Ga0307515_100840422 500
378 3300030522 Ga0307512_10030278 Ga0307512_100302784 500
379 3300031251 Ga0265327_10042733 Ga0265327_100427331 500
380 3300031456 Ga0307513_10006129 Ga0307513_1000612911 500
381 3300031456 Ga0307513_10062497 Ga0307513_100624972 500
382 3300031507 Ga0307509_10000509 Ga0307509_1000050942 500
383 3300031649 Ga0307514_10040159 Ga0307514_100401592 500
384 3300032002 Ga0307416_100016153 Ga0307416_1000161534 500
385 3300033180 Ga0307510_10000794 Ga0307510_1000079417 500
386 3300033180 Ga0307510_10008283 Ga0307510_100082836 500
387 3300041459 Ga0451800_0767489 Ga0451800_0767489_158_1759 500
388 3300042121 Ga0450919_000949 Ga0450919_000949_1286_2962 500
389 3300042531 Ga0450918_000181 Ga0450918_000181_1530_3206 500
390 3300042876 Ga0451577_0211038 Ga0451577_0211038_71_1744 500
391 3300046454 Ga0495592_0000140 Ga0495592_0000140_38638_40263 500
392 3300046660 Ga0495625_0003882 Ga0495625_0003882_9857_11458 500
393 3300048916 Ga0496113_0123979 Ga0496113_0123979_372_1997 500
394 3300050496 nmdc:mga07m45_30258_c1 nmdc:mga07m45_30258_c1_1223_2824 500
395 3300053086 Ga0500578_0000057 Ga0500578_0000057_30361_31992 500
396 3300053730 Ga0500645_005125 Ga0500645_005125_3064_4716 500
397 iso_pu_bacteria 2547132374 2548500541 500
398 iso_pu_bacteria 2585428057 2587729380 500
399 iso_pu_bacteria 2643221592 2643967708 500
400 iso_pu_bacteria 2643221625 2644140530 500
401 iso_pu_bacteria 2643221648 2644273497 500
402 iso_pu_bacteria 2643221717 2644646911 500
403 3300003354 JGI25160J50197_1015179 JGI25160J50197_10151791 501
404 3300005331 Ga0070670_100096805 Ga0070670_1000968052 501
405 3300005354 Ga0070675_100023617 Ga0070675_1000236172 501
406 3300005364 Ga0070673_100002463 Ga0070673_1000024635 501
407 3300005455 Ga0070663_100073258 Ga0070663_1000732581 501
408 3300005459 Ga0068867_100002739 Ga0068867_1000027394 501
409 3300005543 Ga0070672_100004438 Ga0070672_1000044382 501
410 3300005577 Ga0068857_100016123 Ga0068857_1000161235 501
411 3300005577 Ga0068857_100037177 Ga0068857_1000371774 501
412 3300005616 Ga0068852_100040660 Ga0068852_1000406605 501
413 3300005616 Ga0068852_100071107 Ga0068852_1000711072 501
414 3300006178 Ga0075367_10001086 Ga0075367_100010866 501
415 3300006186 Ga0075369_10001782 Ga0075369_100017823 501
416 3300006195 Ga0075366_10025154 Ga0075366_100251542 501
417 3300006353 Ga0075370_10001400 Ga0075370_100014002 501
418 3300009093 Ga0105240_10011262 Ga0105240_100112627 501
419 3300009093 Ga0105240_10016550 Ga0105240_100165508 501
420 3300009545 Ga0105237_10002827 Ga0105237_100028277 501
421 3300009545 Ga0105237_10009312 Ga0105237_100093126 501
422 3300009551 Ga0105238_10027422 Ga0105238_100274223 501
423 3300010375 Ga0105239_10003016 Ga0105239_100030167 501
424 3300025302 Ga0207426_1000105 Ga0207426_1000105118 501
425 3300025913 Ga0207695_10004581 Ga0207695_100045817 501
426 3300025913 Ga0207695_10032789 Ga0207695_100327893 501
427 3300025914 Ga0207671_10002906 Ga0207671_100029067 501
428 3300025924 Ga0207694_10027018 Ga0207694_100270182 501
429 3300025925 Ga0207650_10015788 Ga0207650_100157884 501
430 3300025926 Ga0207659_10037079 Ga0207659_100370791 501
431 3300025933 Ga0207706_10016730 Ga0207706_100167302 501
432 3300025940 Ga0207691_10011286 Ga0207691_100112862 501
433 3300025960 Ga0207651_10003234 Ga0207651_100032346 501
434 3300026023 Ga0207677_10095134 Ga0207677_100951341 501
435 3300026067 Ga0207678_10076529 Ga0207678_100765292 501
436 3300026116 Ga0207674_10007706 Ga0207674_100077062 501
437 3300026116 Ga0207674_10191148 Ga0207674_101911482 501
438 3300026142 Ga0207698_10046424 Ga0207698_100464243 501
439 3300026142 Ga0207698_10070247 Ga0207698_100702472 501
440 3300027876 Ga0209974_10006579 Ga0209974_100065792 501
441 3300028794 Ga0307515_10000109 Ga0307515_10000109143 501
442 3300028794 Ga0307515_10018912 Ga0307515_100189126 501
443 3300028794 Ga0307515_10142538 Ga0307515_101425382 501
444 3300031456 Ga0307513_10036638 Ga0307513_100366382 501
445 3300031507 Ga0307509_10019785 Ga0307509_100197858 501
446 3300031507 Ga0307509_10046126 Ga0307509_100461262 501
447 3300031616 Ga0307508_10000099 Ga0307508_1000009944 501
448 3300031616 Ga0307508_10070714 Ga0307508_100707142 501
449 3300033180 Ga0307510_10080119 Ga0307510_100801192 501
450 3300033180 Ga0307510_10143578 Ga0307510_101435781 501
451 3300036401 Ga0373937_0026811 Ga0373937_0026811_921_2588 501
452 3300046519 Ga0495632_0032665 Ga0495632_0032665_147_1802 501
453 3300050489 nmdc:mga03683_6561_c1 nmdc:mga03683_6561_c1_236_1882 501
454 3300050493 nmdc:mga0k408_30937_c1 nmdc:mga0k408_30937_c1_61_1713 501
455 3300050493 nmdc:mga0k408_9844_c1 nmdc:mga0k408_9844_c1_236_1882 501
456 3300050494 nmdc:mga06z11_3675_c1 nmdc:mga06z11_3675_c1_2546_4192 501
457 3300050496 nmdc:mga07m45_1340_c1 nmdc:mga07m45_1340_c1_8103_9749 501
458 3300053136 Ga0500559_0000027 Ga0500559_0000027_85651_87279 501
459 3300053139 Ga0500568_0023088 Ga0500568_0023088_280_1935 501
460 3300053156 Ga0500622_0009546 Ga0500622_0009546_3487_5115 501
461 iso_pu_bacteria 2738543013 2739247669 501
462 3300006195 Ga0075366_10015934 Ga0075366_100159342 502
463 3300006353 Ga0075370_10059070 Ga0075370_100590702 502
464 3300031730 Ga0307516_10026404 Ga0307516_100264042 502
465 3300042876 Ga0451577_0116448 Ga0451577_0116448_204_1901 502
466 3300046460 Ga0495638_0077477 Ga0495638_0077477_246_1916 502
467 3300053131 Ga0500652_000211 Ga0500652_000211_16805_18475 502
468 3300053156 Ga0500622_0000187 Ga0500622_0000187_21853_23523 502
469 iso_pu_bacteria 2585428058 2587732772 502
470 iso_pu_bacteria 2643221609 2644058139 503
471 iso_pu_bacteria 2643221611 2644073175 503
472 iso_pu_bacteria 2738543012 2739242426 503
473 iso_pu_bacteria 2816332133 2816469957 503
474 3300031456 Ga0307513_10094935 Ga0307513_100949352 504
475 3300031456 Ga0307513_10123153 Ga0307513_101231532 504
476 iso_pu_bacteria 2974320154 2974321567 504
477 3300006051 Ga0075364_10006196 Ga0075364_100061964 505
478 3300028786 Ga0307517_10002447 Ga0307517_1000244721 505
479 3300031548 Ga0307408_100001110 Ga0307408_10000111013 505
480 3300031901 Ga0307406_10005341 Ga0307406_100053414 505
481 iso_pu_bacteria 2919186247 2919190452 507
482 iso_pu_bacteria 2939664404 2939668733 507
483 3300009093 Ga0105240_10107036 Ga0105240_101070362 508
484 3300044684 Ga0466966_0001145 Ga0466966_0001145_3961_5616 508
485 3300045049 Ga0466959_0127662 Ga0466959_0127662_118_1773 508
486 3300003775 Ga0055524_1004439 Ga0055524_10044396 523
487 3300003791 Ga0055530_10000627 Ga0055530_1000062717 523
488 3300025295 Ga0209564_1000067 Ga0209564_100006722 523
489 3300025298 Ga0209050_1000365 Ga0209050_100036518 523
490 3300025299 Ga0209256_1001380 Ga0209256_100138022 523
491 3300046810 Ga0495660_0002328 Ga0495660_0002328_17_1618 523
492 iso_pu_bacteria 2738541297 2738826411 526
493 iso_pu_bacteria 2738541357 2739150208 526
494 iso_pu_bacteria 2738543003 2739192127 526
495 iso_pu_bacteria 2738543026 2739318604 526
496 iso_pu_bacteria 2738543029 2739336845 526
497 3300005336 Ga0070680_100026231 Ga0070680_1000262314 528
498 3300005530 Ga0070679_100019855 Ga0070679_1000198556 528
499 3300005535 Ga0070684_100013923 Ga0070684_1000139233 528
500 3300006358 Ga0068871_100006590 Ga0068871_1000065902 528
501 3300013296 Ga0157374_10184630 Ga0157374_101846302 528
502 3300025912 Ga0207707_10041104 Ga0207707_100411043 528
503 3300031250 Ga0265331_10020669 Ga0265331_100206693 528
504 3300031838 Ga0307518_10017543 Ga0307518_100175434 528
505 3300044684 Ga0466966_0078383 Ga0466966_0078383_321_1940 528
506 3300045049 Ga0466959_0022234 Ga0466959_0022234_1428_3047 528
507 iso_pu_bacteria 2643221638 2644212586 528
508 3300030744 Ga0316181_1198189 Ga0316181_11981892 530
509 3300046452 Ga0495617_000069 Ga0495617_000069_34619_36241 530
510 3300046452 Ga0495617_001148 Ga0495617_001148_1419_3041 530
511 3300046460 Ga0495638_0020544 Ga0495638_0020544_690_2321 530
512 3300046471 Ga0495650_0000141 Ga0495650_0000141_11324_12946 530
513 3300046492 Ga0495585_0003292 Ga0495585_0003292_1398_3020 530
514 3300046507 Ga0495606_0001155 Ga0495606_0001155_8874_10505 530
515 3300046512 Ga0495610_0007568 Ga0495610_0007568_4089_5711 530
516 3300046520 Ga0495637_0000659 Ga0495637_0000659_18863_20494 530
517 3300046558 Ga0495633_0006682 Ga0495633_0006682_728_2350 530
518 3300046616 Ga0495668_0001662 Ga0495668_0001662_8791_10413 530
519 3300046692 Ga0495671_0000005 Ga0495671_0000005_473008_474630 530
520 3300046692 Ga0495671_0015084 Ga0495671_0015084_1887_3509 530
521 3300047323 Ga0495683_0009601 Ga0495683_0009601_1813_3435 530
522 3300047446 Ga0495679_030495 Ga0495679_030495_54_1676 530
523 3300047469 Ga0495673_0000009 Ga0495673_0000009_305167_306789 530
524 3300048925 Ga0496122_0026762 Ga0496122_0026762_2640_4262 530
525 3300053145 Ga0500586_001044 Ga0500586_001044_3823_5445 530
526 3300002774 JGI25150J39212_1002797 JGI25150J39212_10027974 532
527 3300003374 JGI25161J50226_1001722 JGI25161J50226_10017225 532
528 3300003794 Ga0055531_10003525 Ga0055531_100035252 532
529 3300004625 Ga0055543_1002408 Ga0055543_10024085 532
530 3300005262 Ga0065165_1007704 Ga0065165_10077043 532
531 3300025208 Ga0209436_102144 Ga0209436_1021443 532
532 3300025245 Ga0207425_1000009 Ga0207425_1000009288 532
533 3300025258 Ga0209129_1000051 Ga0209129_1000051212 532
534 3300025284 Ga0209130_1001621 Ga0209130_10016216 532
535 3300025295 Ga0209564_1014095 Ga0209564_10140951 532
536 3300025297 Ga0209758_1000054 Ga0209758_1000054289 532
537 3300025298 Ga0209050_1000040 Ga0209050_1000040130 532
538 3300025304 Ga0209257_1000054 Ga0209257_1000054268 532
539 3300049665 Ga0501227_000748 Ga0501227_000748_3069_4691 533
540 3300002739 JGI25158J39367_1001523 JGI25158J39367_10015232 539
541 3300003773 Ga0055537_1004364 Ga0055537_10043642 539
542 3300025245 Ga0207425_1000833 Ga0207425_100083313 539
543 3300025258 Ga0209129_1008028 Ga0209129_10080282 539
544 3300025263 Ga0209565_1000453 Ga0209565_10004536 539
545 3300025263 Ga0209565_1002092 Ga0209565_10020929 539
546 3300025273 Ga0209673_1002618 Ga0209673_10026183 539
547 3300025284 Ga0209130_1005159 Ga0209130_10051596 539
548 3300025295 Ga0209564_1007259 Ga0209564_10072598 539
549 3300025298 Ga0209050_1004359 Ga0209050_100435910 539
550 3300025299 Ga0209256_1001208 Ga0209256_100120829 539
551 3300025304 Ga0209257_1005272 Ga0209257_10052729 539
552 3300031548 Ga0307408_100001266 Ga0307408_10000126615 539

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

117

186

0.91

PF01266

DAO

FAD dependent oxidoreductase

114

191

0.77

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

122

584

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvi-assembly2.cif.gz_B crystal structure of pennisetum glaucum monodehydroascorbate reductase 0.9323 58 90
1cl0-assembly1.cif.gz_A crystal structure of reduced thioredoxin reductase from escherichia coli. 0.9129 55 98
7btj-assembly4.cif.gz_D crystal structure of pennisetum glaucum monodehydroascorbate reductase in complex with fadh2 0.907 58 90
5utx-assembly1.cif.gz_A crystal structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 - apo form 0.9014 58 91
5u63-assembly1.cif.gz_A crystal structure of putative thioredoxin reductase from haemophilus influenzae 0.8965 56 98
ID Description Score Start End Superfamily
5jcmB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9333 58 90 3.50.50.60
af_Q7JY94_307_684_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.905 60 89 3.40.50.720
af_A0A1D8PG18_47_310_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.902 60 89 3.40.50.720
af_Q5ZDX5_681_1042_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9018 60 89 3.40.50.720
af_Q8IIA3_862_1308_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.899 60 89 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A239CPT7-F1-model_v4 NAD(P)-binding Rossmann-like domain-containing protein 0.9686 13 537
AF-A0A7W8DPG3-F1-model_v4 Phytoene dehydrogenase-like protein 0.9579 28 534 GO:0016491
AF-A0A239CPT7-F1-model_v4 NAD(P)-binding Rossmann-like domain-containing protein 0.9577 13 537
AF-A0A2N9NFW7-F1-model_v4 Twin-arginine translocation pathway signal 0.9569 30 537 GO:0016491
AF-A0A507WFR8-F1-model_v4 FAD-dependent oxidoreductase 0.9566 30 538 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map