F462664

General Info

Members Datasets Scaffolds Average Seq Length
551 287 515 161

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0023864|Ga0501034_0023864_4381_4920
Length 179
Sequence VSRVLTGREDPSDMLPTMSRIAVVPGSFDPVTLGHLDVIGRAAGIFDELHVLVVHNPDKSALLPIAQRVSLIQDSIAEAKLPGNILVTSWSVGLLVDYCTDVGASVLVKGIRSQVDVAYETPMAIVNRNLAGVETIFMLPDPGHAHVSSSLVRQVAALGGDVAPYVPKAVAAFLQKDRR

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221619 Agromyces sp. Root81 Isolate Unclassified
6 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
7 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
8 2643221649 Leifsonia sp. Root4 Isolate Unclassified
9 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
10 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
11 2808606372 Agromyces sp. 23-23 Isolate Unclassified
12 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
13 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
14 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
15 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
16 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
17 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
18 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
19 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
20 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
21 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
22 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
23 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
24 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
25 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
26 2928153084 Leifsonia sp. 563 Isolate Unclassified
27 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
28 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
29 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
30 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
31 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
32 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
266 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
270 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
285 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
286 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
287 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.91
Isolates 6.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 0
Rhizoplane 5.99
Rhizosphere 66.42
Stem 0
Stem Tuber 0.18
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018564 3300001979 Bacteria 2463
2 JGI24739J22299_10046037 3300001989 Bacteria 1429
3 JGI24737J22298_10009502 3300001990 Bacteria 3230
4 JGI24735J21928_10002269 3300002067 Bacteria 6708
5 JGI25164J39214_1000778 3300002772 Bacteria 11545
6 JGI25165J46597_1000002 3300003214 Bacteria 765387
7 Ga0006562J51391_1061877 3300003578 Bacteria 6163
8 Ga0055539_1000111 3300003752 Bacteria 90530
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055525_1000317 3300003759 Bacteria 38691
11 Ga0055527_1000012 3300003760 Bacteria 348744
12 Ga0055542_1000017 3300003762 Bacteria 348744
13 Ga0055529_1000023 3300003763 Bacteria 314383
14 Ga0055541_1008364 3300003841 Bacteria 1651
15 Ga0065714_10078159 3300005288 Bacteria 2623
16 Ga0065714_10214281 3300005288 Bacteria 858
17 Ga0065714_10216972 3300005288 Bacteria 822
18 Ga0070658_10000245 3300005327 Bacteria 48267
19 Ga0070658_10010448 3300005327 Bacteria 7445
20 Ga0070658_10039615 3300005327 Bacteria 3801
21 Ga0070658_10397069 3300005327 Bacteria 1184
22 Ga0070682_101701465 3300005337 Bacteria 548
23 Ga0068868_100737982 3300005338 Bacteria 884
24 Ga0070660_100002036 3300005339 Bacteria 13937
25 Ga0070675_100071846 3300005354 Bacteria 2872
26 Ga0070688_100288751 3300005365 Bacteria 1181
27 Ga0070659_100008194 3300005366 Bacteria 7628
28 Ga0070667_100002813 3300005367 Bacteria 15009
29 Ga0070667_100129848 3300005367 Bacteria 2198
30 Ga0070710_10002030 3300005437 Bacteria 9580
31 Ga0070710_10025336 3300005437 Bacteria 3141
32 Ga0070663_100652484 3300005455 Bacteria 890
33 Ga0070663_101286662 3300005455 Bacteria 645
34 Ga0070685_10056644 3300005466 Bacteria 2279
35 Ga0068853_100207767 3300005539 Bacteria 1784
36 Ga0070672_100932244 3300005543 Bacteria 768
37 Ga0070665_101285814 3300005548 Bacteria 742
38 Ga0068855_100013037 3300005563 Bacteria 10027
39 Ga0068855_100098007 3300005563 Bacteria 3377
40 Ga0068855_100105876 3300005563 Bacteria 3233
41 Ga0068856_100032649 3300005614 Bacteria 5097
42 Ga0068856_100049854 3300005614 Bacteria 4127
43 Ga0068856_100560126 3300005614 Bacteria 1164
44 Ga0068852_100005756 3300005616 Bacteria 8897
45 Ga0068852_100011467 3300005616 Bacteria 6674
46 Ga0068852_100408071 3300005616 Bacteria 1338
47 Ga0068859_100324331 3300005617 Bacteria 1634
48 Ga0068864_100526124 3300005618 Bacteria 1141
49 Ga0068864_102329704 3300005618 Bacteria 542
50 Ga0068851_10000001 3300005834 Bacteria 495512
51 Ga0068870_10754974 3300005840 Bacteria 676
52 Ga0068863_100216423 3300005841 Bacteria 1845
53 Ga0068858_100001161 3300005842 Bacteria 27293
54 Ga0068862_100164726 3300005844 Bacteria 1981
55 Ga0075365_10311926 3300006038 Bacteria 1107
56 Ga0075365_10387525 3300006038 Bacteria 986
57 Ga0075365_10402523 3300006038 Bacteria 966
58 Ga0075364_10014177 3300006051 Bacteria 4920
59 Ga0075364_10294758 3300006051 Bacteria 1104
60 Ga0075364_10348097 3300006051 Bacteria 1010
61 Ga0075432_10152027 3300006058 Bacteria 890
62 Ga0070716_100627468 3300006173 Bacteria 812
63 Ga0075369_10064506 3300006186 Bacteria 1604
64 Ga0075369_10095075 3300006186 Bacteria 1332
65 Ga0097620_100324363 3300006931 Bacteria 1634
66 Ga0105240_10007382 3300009093 Bacteria 15989
67 Ga0111539_10721725 3300009094 Bacteria 1160
68 Ga0105245_10005854 3300009098 Bacteria 10797
69 Ga0105245_10050848 3300009098 Bacteria 3715
70 Ga0105247_11614194 3300009101 Bacteria 533
71 Ga0105241_10001149 3300009174 Bacteria 20137
72 Ga0105248_10000326 3300009177 Bacteria 56477
73 Ga0105248_10056797 3300009177 Bacteria 4392
74 Ga0105248_10544300 3300009177 Bacteria 1309
75 Ga0105237_10000341 3300009545 Bacteria 65672
76 Ga0105237_10642474 3300009545 Bacteria 1068
77 Ga0105237_11848899 3300009545 Bacteria 612
78 Ga0105238_10030753 3300009551 Bacteria 5466
79 Ga0105249_11247153 3300009553 Bacteria 815
80 Ga0105246_10122121 3300011119 Bacteria 1932
81 Ga0105246_10242245 3300011119 Bacteria 1426
82 Ga0105246_10703476 3300011119 Bacteria 886
83 Ga0157371_10059068 3300013102 Bacteria 2720
84 Ga0157370_10006075 3300013104 Bacteria 13405
85 Ga0157369_10000573 3300013105 Bacteria 48456
86 Ga0157369_10062997 3300013105 Bacteria 3995
87 Ga0157369_10067577 3300013105 Bacteria 3842
88 Ga0157369_10079951 3300013105 Bacteria 3501
89 Ga0157369_10130247 3300013105 Bacteria 2666
90 Ga0157369_10690976 3300013105 Bacteria 1051
91 Ga0157369_10695124 3300013105 Bacteria 1047
92 Ga0157369_12223077 3300013105 Bacteria 556
93 Ga0157374_10091482 3300013296 Bacteria 2901
94 Ga0157374_10308926 3300013296 Bacteria 1565
95 Ga0157374_11239791 3300013296 Bacteria 767
96 Ga0163162_10195609 3300013306 Bacteria 2151
97 Ga0163162_11754651 3300013306 Bacteria 709
98 Ga0157372_10032991 3300013307 Bacteria 5684
99 Ga0157372_10122694 3300013307 Bacteria 2986
100 Ga0157372_10795638 3300013307 Bacteria 1099
101 Ga0157372_12838596 3300013307 Bacteria 555
102 Ga0163163_12519584 3300014325 Bacteria 572
103 Ga0157380_10009645 3300014326 Bacteria 6924
104 Ga0157379_10028386 3300014968 Bacteria 4977
105 Ga0157376_11010598 3300014969 Bacteria 854
106 Ga0197907_10185693 3300020069 Bacteria 2744
107 Ga0206354_11348532 3300020081 Bacteria 4580
108 Ga0206353_11560231 3300020082 Bacteria 22870
109 Ga0224712_10073010 3300022467 Bacteria 1398
110 Ga0209566_100026 3300025225 Bacteria 367457
111 Ga0209674_100001 3300025226 Bacteria 4013750
112 Ga0209672_100003 3300025228 Bacteria 1560476
113 Ga0209563_100001 3300025230 Bacteria 4013775
114 Ga0209563_100388 3300025230 Bacteria 15838
115 Ga0207427_100034 3300025231 Bacteria 320342
116 Ga0209437_101001 3300025233 Bacteria 9888
117 Ga0209258_101714 3300025242 Bacteria 6842
118 Ga0209677_100001 3300025253 Bacteria 4013787
119 Ga0209677_105819 3300025253 Bacteria 3103
120 Ga0209148_1000004 3300025254 Bacteria 1844481
121 Ga0209148_1000608 3300025254 Bacteria 32066
122 Ga0209129_1027869 3300025258 Bacteria 964
123 Ga0209233_1000001 3300025261 Bacteria 2992747
124 Ga0209455_1000022 3300025272 Bacteria 688910
125 Ga0209455_1002188 3300025272 Bacteria 7741
126 Ga0207656_10000002 3300025321 Bacteria 792178
127 Ga0207692_10019944 3300025898 Bacteria 3041
128 Ga0207692_10280390 3300025898 Bacteria 1008
129 Ga0207688_10205861 3300025901 Bacteria 1181
130 Ga0207647_10056822 3300025904 Bacteria 2400
131 Ga0207647_10345721 3300025904 Bacteria 842
132 Ga0207705_10000001 3300025909 Bacteria 2061880
133 Ga0207705_10042798 3300025909 Bacteria 3252
134 Ga0207705_10071930 3300025909 Bacteria 2507
135 Ga0207705_10203229 3300025909 Bacteria 1501
136 Ga0207705_10569399 3300025909 Bacteria 880
137 Ga0207654_10000001 3300025911 Bacteria 1816198
138 Ga0207695_10003239 3300025913 Bacteria 23182
139 Ga0207695_10003445 3300025913 Bacteria 22306
140 Ga0207671_10000002 3300025914 Bacteria 1144816
141 Ga0207671_10425694 3300025914 Bacteria 1056
142 Ga0207657_10013598 3300025919 Bacteria 7983
143 Ga0207649_10382338 3300025920 Bacteria 1049
144 Ga0207694_10000395 3300025924 Bacteria 40665
145 Ga0207694_11192184 3300025924 Bacteria 644
146 Ga0207659_10032770 3300025926 Bacteria 3570
147 Ga0207687_10017562 3300025927 Bacteria 4712
148 Ga0207644_10644662 3300025931 Bacteria 881
149 Ga0207690_10000874 3300025932 Bacteria 19271
150 Ga0207665_10901332 3300025939 Bacteria 701
151 Ga0207691_10744063 3300025940 Bacteria 826
152 Ga0207711_10004685 3300025941 Bacteria 11617
153 Ga0207711_10035190 3300025941 Bacteria 4244
154 Ga0207711_11505805 3300025941 Bacteria 616
155 Ga0207667_10000384 3300025949 Bacteria 59816
156 Ga0207667_10153455 3300025949 Bacteria 2370
157 Ga0207667_10175212 3300025949 Bacteria 2204
158 Ga0207667_10244337 3300025949 Bacteria 1837
159 Ga0207668_10008087 3300025972 Bacteria 6262
160 Ga0207640_10040713 3300025981 Bacteria 2950
161 Ga0207658_10173795 3300025986 Bacteria 1777
162 Ga0207658_10846635 3300025986 Bacteria 831
163 Ga0207677_10229688 3300026023 Bacteria 1494
164 Ga0207677_10232554 3300026023 Bacteria 1486
165 Ga0207703_10000982 3300026035 Bacteria 27446
166 Ga0207639_10070713 3300026041 Bacteria 2727
167 Ga0207639_10188305 3300026041 Bacteria 1761
168 Ga0207678_10132755 3300026067 Bacteria 2124
169 Ga0207678_10263191 3300026067 Bacteria 1478
170 Ga0207678_10812624 3300026067 Bacteria 826
171 Ga0207702_10114288 3300026078 Bacteria 2405
172 Ga0207702_10263157 3300026078 Bacteria 1625
173 Ga0207702_10411178 3300026078 Bacteria 1306
174 Ga0207676_10036367 3300026095 Bacteria 3745
175 Ga0207674_10589775 3300026116 Bacteria 1074
176 Ga0207675_100798387 3300026118 Bacteria 957
177 Ga0207698_10000372 3300026142 Bacteria 26230
178 Ga0207698_10003382 3300026142 Bacteria 9606
179 Ga0268266_10907709 3300028379 Bacteria 852
180 Ga0268265_10140994 3300028380 Bacteria 2018
181 Ga0268265_12320578 3300028380 Bacteria 543
182 Ga0307515_10051415 3300028794 Bacteria 6144
183 Ga0307515_10100177 3300028794 Bacteria 3510
184 Ga0307511_10245362 3300030521 Bacteria 868
185 Ga0307509_10299566 3300031507 Bacteria 1357
186 Ga0307408_100212909 3300031548 Bacteria 1572
187 Ga0307514_10016353 3300031649 Bacteria 6112
188 Ga0307514_10035564 3300031649 Bacteria 3964
189 Ga0307405_10150700 3300031731 Bacteria 1635
190 Ga0307410_10166536 3300031852 Bacteria 1657
191 Ga0307410_10471563 3300031852 Bacteria 1028
192 Ga0307410_10609585 3300031852 Bacteria 911
193 Ga0307406_10047788 3300031901 Bacteria 2699
194 Ga0307406_11134624 3300031901 Bacteria 676
195 Ga0307412_10421503 3300031911 Bacteria 1092
196 Ga0307412_10672911 3300031911 Bacteria 885
197 Ga0307412_10829929 3300031911 Bacteria 805
198 Ga0307409_100535330 3300031995 Bacteria 1147
199 Ga0307409_101277402 3300031995 Bacteria 759
200 Ga0307409_102097032 3300031995 Bacteria 595
201 Ga0307416_100696358 3300032002 Bacteria 1105
202 Ga0307416_100928744 3300032002 Bacteria 971
203 Ga0307416_102154137 3300032002 Bacteria 659
204 Ga0307414_10643913 3300032004 Bacteria 955
205 Ga0307411_10373906 3300032005 Bacteria 1170
206 Ga0307411_11280731 3300032005 Bacteria 667
207 Ga0307415_100233855 3300032126 Bacteria 1482
208 Ga0395899_0020523 3300037312 Bacteria 5008
209 Ga0395899_0080831 3300037312 Bacteria 2365
210 Ga0395900_0001562 3300037418 Bacteria 27187
211 Ga0395900_0354773 3300037418 Bacteria 1439
212 Ga0395898_0002083 3300037466 Bacteria 24880
213 Ga0395898_0264622 3300037466 Bacteria 1640
214 Ga0395901_0304743 3300038443 Bacteria 1651
215 Ga0439465_0095419 3300041413 Bacteria 1022
216 Ga0451789_0809815 3300041443 Bacteria 578
217 Ga0451789_1302198 3300041443 Bacteria 701
218 Ga0451791_0085663 3300041451 Bacteria 723
219 Ga0451791_0294488 3300041451 Bacteria 2964
220 Ga0451791_1133574 3300041451 Bacteria 885
221 Ga0451793_1534553 3300041452 Bacteria 1567
222 Ga0451793_1709792 3300041452 Bacteria 1576
223 Ga0451797_1126810 3300041453 Bacteria 901
224 Ga0451797_1381397 3300041453 Bacteria 1425
225 Ga0451795_0629196 3300041456 Bacteria 796
226 Ga0451798_1094680 3300041458 Bacteria 787
227 Ga0451802_1933098 3300041460 Bacteria 702
228 Ga0451802_2007612 3300041460 Bacteria 761
229 Ga0451841_0025360 3300041498 Bacteria 1984
230 Ga0451843_0143344 3300041509 Bacteria 1315
231 Ga0451843_0998735 3300041509 Bacteria 987
232 Ga0451855_1722690 3300041511 Bacteria 1352
233 Ga0451853_2133845 3300041512 Bacteria 1150
234 Ga0439431_0171236 3300041997 Bacteria 624
235 Ga0450912_017946 3300042116 Bacteria 665
236 Ga0439446_0159049 3300042156 Bacteria 746
237 Ga0439459_0206899 3300042438 Bacteria 538
238 Ga0466972_0027508 3300044658 Bacteria 2812
239 Ga0466972_0028357 3300044658 Bacteria 2762
240 Ga0466972_0049075 3300044658 Bacteria 2039
241 Ga0466972_0084668 3300044658 Bacteria 1507
242 Ga0466965_0000016 3300044683 Bacteria 81402
243 Ga0466965_0096611 3300044683 Bacteria 1507
244 Ga0466966_0117863 3300044684 Bacteria 1633
245 Ga0466966_0204141 3300044684 Bacteria 1195
246 Ga0466961_0078879 3300044693 Bacteria 2085
247 Ga0466961_0090006 3300044693 Bacteria 1938
248 Ga0466961_0220761 3300044693 Bacteria 1168
249 Ga0466961_0505571 3300044693 Bacteria 729
250 Ga0466964_0191676 3300044706 Bacteria 976
251 Ga0466971_0040044 3300044719 Bacteria 2104
252 Ga0466971_0132837 3300044719 Bacteria 1156
253 Ga0466968_0025044 3300044735 Bacteria 2442
254 Ga0466970_0008550 3300044765 Bacteria 5154
255 Ga0466970_0034454 3300044765 Bacteria 2680
256 Ga0466970_0084779 3300044765 Bacteria 1715
257 Ga0466970_0425268 3300044765 Bacteria 760
258 Ga0466957_0025480 3300044842 Bacteria 3506
259 Ga0466957_0150632 3300044842 Bacteria 1504
260 Ga0466957_0161044 3300044842 Bacteria 1457
261 Ga0466960_0023062 3300044901 Bacteria 2790
262 Ga0466960_0101444 3300044901 Bacteria 1482
263 Ga0466960_0128974 3300044901 Bacteria 1333
264 Ga0466959_0005711 3300045049 Bacteria 8560
265 Ga0466959_0036468 3300045049 Bacteria 3633
266 Ga0466959_0240515 3300045049 Bacteria 1250
267 Ga0466958_0043586 3300045836 Bacteria 2702
268 Ga0466958_0406981 3300045836 Bacteria 879
269 Ga0466967_0894078 3300045976 Bacteria 883
270 Ga0495590_0000331 3300046457 Bacteria 24551
271 Ga0495638_0203731 3300046460 Bacteria 1115
272 Ga0495650_0000989 3300046471 Bacteria 32345
273 Ga0495652_0211376 3300046529 Bacteria 1464
274 Ga0495654_0265631 3300046530 Bacteria 710
275 Ga0495611_0357069 3300046648 Bacteria 670
276 Ga0495625_0284502 3300046660 Bacteria 1063
277 Ga0495581_0310308 3300047315 Bacteria 922
278 Ga0495672_0010044 3300047320 Bacteria 6779
279 Ga0495672_0020872 3300047320 Bacteria 4283
280 Ga0495686_0231894 3300047472 Bacteria 1045
281 Ga0496100_0163134 3300048903 Bacteria 1599
282 Ga0496101_0046669 3300048904 Bacteria 3107
283 Ga0496101_0358455 3300048904 Bacteria 1146
284 Ga0496102_0100558 3300048905 Bacteria 2686
285 Ga0496102_0300740 3300048905 Bacteria 1512
286 Ga0496102_0315529 3300048905 Bacteria 1473
287 Ga0496102_0410431 3300048905 Bacteria 1272
288 Ga0496102_0812866 3300048905 Bacteria 857
289 Ga0496103_0208076 3300048906 Bacteria 1258
290 Ga0496103_0438132 3300048906 Bacteria 838
291 Ga0496104_0111725 3300048907 Bacteria 2620
292 Ga0496104_0861210 3300048907 Bacteria 811
293 Ga0496105_0029524 3300048908 Bacteria 4488
294 Ga0496105_0216894 3300048908 Bacteria 1558
295 Ga0496105_0388114 3300048908 Bacteria 1110
296 Ga0496107_0064555 3300048910 Bacteria 2654
297 Ga0496107_0126931 3300048910 Bacteria 1882
298 Ga0496113_0057504 3300048916 Bacteria 2923
299 Ga0496114_0099333 3300048917 Bacteria 2482
300 Ga0496115_0011036 3300048918 Bacteria 6766
301 Ga0496116_0162477 3300048919 Bacteria 1223
302 Ga0496117_0000620 3300048920 Bacteria 57459
303 Ga0496117_0006271 3300048920 Bacteria 12116
304 Ga0496117_0084197 3300048920 Bacteria 2076
305 Ga0496117_0097560 3300048920 Bacteria 1871
306 Ga0496117_0281197 3300048920 Bacteria 891
307 Ga0496118_0027091 3300048921 Bacteria 4859
308 Ga0496118_0045946 3300048921 Bacteria 3402
309 Ga0496118_0055056 3300048921 Bacteria 3006
310 Ga0496118_0101044 3300048921 Bacteria 1949
311 Ga0496119_0000462 3300048922 Bacteria 55546
312 Ga0496119_0001409 3300048922 Bacteria 29104
313 Ga0496119_0060789 3300048922 Bacteria 2260
314 Ga0496119_0080595 3300048922 Bacteria 1877
315 Ga0496119_0245520 3300048922 Bacteria 905
316 Ga0496119_0412158 3300048922 Bacteria 643
317 Ga0496120_0000882 3300048923 Bacteria 42252
318 Ga0496120_0156719 3300048923 Bacteria 1139
319 Ga0496121_0000025 3300048924 Bacteria 453467
320 Ga0496121_0104638 3300048924 Bacteria 2174
321 Ga0496121_0165411 3300048924 Bacteria 1613
322 Ga0496122_0002058 3300048925 Bacteria 29852
323 Ga0496122_0005357 3300048925 Bacteria 15325
324 Ga0496122_0336890 3300048925 Bacteria 794
325 Ga0496122_0508200 3300048925 Bacteria 584
326 Ga0496123_0003992 3300048926 Bacteria 15973
327 Ga0496123_0025110 3300048926 Bacteria 4502
328 Ga0496125_0274580 3300048928 Bacteria 1048
329 Ga0496125_0505720 3300048928 Bacteria 679
330 Ga0496126_0005351 3300048929 Bacteria 14670
331 Ga0496126_0082034 3300048929 Bacteria 2850
332 Ga0496126_0110196 3300048929 Bacteria 2398
333 Ga0496126_0158735 3300048929 Bacteria 1934
334 Ga0496126_0163323 3300048929 Bacteria 1902
335 Ga0496126_0547391 3300048929 Bacteria 919
336 Ga0496126_1062025 3300048929 Bacteria 604
337 Ga0501031_0016602 3300049568 Bacteria 4780
338 Ga0501031_0093172 3300049568 Bacteria 1966
339 Ga0501031_0104937 3300049568 Bacteria 1844
340 Ga0501031_0363057 3300049568 Bacteria 937
341 Ga0501032_0014588 3300049569 Bacteria 5566
342 Ga0501032_0027787 3300049569 Bacteria 3887
343 Ga0501032_0031313 3300049569 Bacteria 3647
344 Ga0501032_0043987 3300049569 Bacteria 3023
345 Ga0501032_0062436 3300049569 Bacteria 2497
346 Ga0501032_0709216 3300049569 Bacteria 637
347 Ga0501033_0002059 3300049570 Bacteria 17483
348 Ga0501033_0011913 3300049570 Bacteria 6643
349 Ga0501033_0038554 3300049570 Bacteria 3572
350 Ga0501033_0157154 3300049570 Bacteria 1638
351 Ga0501033_0924037 3300049570 Bacteria 586
352 Ga0501034_0023864 3300049571 Bacteria 6227
353 Ga0501034_0041781 3300049571 Bacteria 4639
354 Ga0501034_0053217 3300049571 Bacteria 4078
355 Ga0501034_0053994 3300049571 Bacteria 4045
356 Ga0501034_0094477 3300049571 Bacteria 2986
357 Ga0501034_0180235 3300049571 Bacteria 2077
358 Ga0501034_0220423 3300049571 Bacteria 1849
359 Ga0501034_0265502 3300049571 Bacteria 1658
360 Ga0501034_0271026 3300049571 Bacteria 1638
361 Ga0501034_0623536 3300049571 Bacteria 982
362 Ga0501036_0002187 3300049572 Bacteria 15263
363 Ga0501036_0003312 3300049572 Bacteria 12859
364 Ga0501036_0078757 3300049572 Bacteria 2787
365 Ga0501036_0390429 3300049572 Bacteria 1161
366 Ga0501036_0627239 3300049572 Bacteria 891
367 Ga0501036_0635583 3300049572 Bacteria 884
368 Ga0501037_0010008 3300049573 Bacteria 6956
369 Ga0501037_0017808 3300049573 Bacteria 5230
370 Ga0501037_0018671 3300049573 Bacteria 5111
371 Ga0501037_0075266 3300049573 Bacteria 2452
372 Ga0501037_0108605 3300049573 Bacteria 1999
373 Ga0501037_0599318 3300049573 Bacteria 740
374 Ga0501037_0788145 3300049573 Bacteria 628
375 Ga0501038_0019458 3300049574 Bacteria 6119
376 Ga0501038_0029954 3300049574 Bacteria 4818
377 Ga0501038_0041434 3300049574 Bacteria 4016
378 Ga0501038_0077019 3300049574 Bacteria 2816
379 Ga0501038_0236738 3300049574 Bacteria 1451
380 Ga0501039_0009905 3300049575 Bacteria 7266
381 Ga0501039_0148724 3300049575 Bacteria 1840
382 Ga0501039_0647307 3300049575 Bacteria 827
383 Ga0501040_0028238 3300049576 Bacteria 3781
384 Ga0501040_0781166 3300049576 Bacteria 691
385 Ga0501041_0026756 3300049577 Bacteria 3472
386 Ga0501041_0620550 3300049577 Bacteria 690
387 Ga0501042_0000189 3300049578 Bacteria 28855
388 Ga0501042_0122980 3300049578 Bacteria 1868
389 Ga0501043_0002868 3300049579 Bacteria 14395
390 Ga0501043_0072950 3300049579 Bacteria 2696
391 Ga0501043_0144179 3300049579 Bacteria 1865
392 Ga0501043_0171583 3300049579 Bacteria 1692
393 Ga0501043_0408749 3300049579 Bacteria 1025
394 Ga0501046_0004032 3300049580 Bacteria 13399
395 Ga0501046_0073716 3300049580 Bacteria 2649
396 Ga0501046_0099169 3300049580 Bacteria 2236
397 Ga0501046_0188775 3300049580 Bacteria 1538
398 Ga0501047_0041524 3300049581 Bacteria 4444
399 Ga0501047_0061647 3300049581 Bacteria 3618
400 Ga0501047_0066995 3300049581 Bacteria 3460
401 Ga0501047_0147272 3300049581 Bacteria 2231
402 Ga0501047_0293176 3300049581 Bacteria 1470
403 Ga0501048_0003937 3300049582 Bacteria 11286
404 Ga0501048_0027985 3300049582 Bacteria 4094
405 Ga0501048_0502253 3300049582 Bacteria 869
406 Ga0501048_0564727 3300049582 Bacteria 817
407 Ga0501067_0363822 3300049583 Bacteria 806
408 Ga0501068_0442830 3300049584 Bacteria 840
409 Ga0501069_0010568 3300049585 Bacteria 4890
410 Ga0501069_0100167 3300049585 Bacteria 1644
411 Ga0501070_0000133 3300049586 Bacteria 67036
412 Ga0501070_0001501 3300049586 Bacteria 20837
413 Ga0501070_0021716 3300049586 Bacteria 5382
414 Ga0501070_0055855 3300049586 Bacteria 3273
415 Ga0501070_0134749 3300049586 Bacteria 2039
416 Ga0501070_0141798 3300049586 Bacteria 1984
417 Ga0501070_0895194 3300049586 Bacteria 693
418 Ga0501071_0000105 3300049587 Bacteria 32519
419 Ga0501071_0001973 3300049587 Bacteria 12253
420 Ga0501071_0255113 3300049587 Bacteria 1324
421 Ga0501071_0368364 3300049587 Bacteria 1095
422 Ga0501071_1144071 3300049587 Bacteria 601
423 Ga0501072_0160424 3300049588 Bacteria 1794
424 Ga0501072_0692834 3300049588 Bacteria 801
425 Ga0501073_0000028 3300049589 Bacteria 118187
426 Ga0501073_0051043 3300049589 Bacteria 2897
427 Ga0501073_0100396 3300049589 Bacteria 2009
428 Ga0501073_0131765 3300049589 Bacteria 1733
429 Ga0501073_0747485 3300049589 Bacteria 674
430 Ga0501074_0024221 3300049590 Bacteria 4411
431 Ga0501075_0007696 3300049591 Bacteria 7480
432 Ga0501076_0003620 3300049592 Bacteria 10848
433 Ga0501076_1044927 3300049592 Bacteria 673
434 Ga0501077_0129708 3300049593 Bacteria 1598
435 Ga0501079_0013151 3300049741 Bacteria 6308
436 Ga0501079_0490145 3300049741 Bacteria 966
437 Ga0501079_1089376 3300049741 Bacteria 629
438 Ga0501080_0000152 3300049742 Bacteria 49340
439 Ga0501080_0018954 3300049742 Bacteria 6375
440 Ga0501080_0084253 3300049742 Bacteria 2953
441 Ga0501083_0121717 3300049744 Bacteria 1711
442 Ga0501083_0316019 3300049744 Bacteria 1016
443 Ga0501035_0000582 3300049822 Bacteria 40291
444 Ga0501035_0058013 3300049822 Bacteria 3450
445 Ga0501035_0094245 3300049822 Bacteria 2633
446 Ga0501044_0009817 3300049823 Bacteria 10408
447 Ga0501044_0235304 3300049823 Bacteria 1778
448 Ga0501044_0285470 3300049823 Bacteria 1583
449 Ga0501044_0301638 3300049823 Bacteria 1530
450 Ga0501044_0442898 3300049823 Bacteria 1206
451 Ga0501044_0750410 3300049823 Bacteria 858
452 Ga0501045_0009089 3300049824 Bacteria 6943
453 nmdc:mga00v17_11932_c1 3300050491 Bacteria 4784
454 nmdc:mga00v17_241180_c1 3300050491 Bacteria 1172
455 nmdc:mga00v17_353343_c1 3300050491 Bacteria 955
456 nmdc:mga00v17_358526_c1 3300050491 Bacteria 948
457 nmdc:mga0yw44_4594_c1 3300050492 Bacteria 6365
458 nmdc:mga0yw44_497739_c1 3300050492 Bacteria 827
459 nmdc:mga0sz30_189161_c1 3300050516 Bacteria 914
460 nmdc:mga0sz30_314406_c1 3300050516 Bacteria 699
461 nmdc:mga0sz30_3315_c2 3300050516 Bacteria 1119
462 Ga0495601_0080048 3300053077 Bacteria 2096
463 Ga0500610_0402460 3300053079 Bacteria 556
464 Ga0500635_0000023 3300053080 Bacteria 108024
465 Ga0500635_0009463 3300053080 Bacteria 2705
466 Ga0495619_0106380 3300053085 Bacteria 1913
467 Ga0500643_000913 3300053087 Bacteria 18624
468 Ga0500651_0000170 3300053093 Bacteria 42448
469 Ga0500650_0039463 3300053098 Bacteria 2176
470 Ga0500554_040596 3300053102 Bacteria 1426
471 Ga0500556_0000001 3300053104 Bacteria 1135060
472 Ga0500556_0000064 3300053104 Bacteria 109213
473 Ga0500562_000411 3300053108 Bacteria 10396
474 Ga0500593_000556 3300053117 Bacteria 14451
475 Ga0500621_155032 3300053126 Bacteria 855
476 Ga0500652_200759 3300053131 Bacteria 809
477 Ga0500655_001460 3300053133 Bacteria 4484
478 Ga0500559_0000043 3300053136 Bacteria 100617
479 Ga0500559_0000281 3300053136 Bacteria 39297
480 Ga0500559_0000373 3300053136 Bacteria 33009
481 Ga0500559_0005479 3300053136 Bacteria 5835
482 Ga0500559_0058088 3300053136 Bacteria 1720
483 Ga0500559_0072502 3300053136 Bacteria 1552
484 Ga0500568_0000003 3300053139 Bacteria 863587
485 Ga0500568_0000028 3300053139 Bacteria 161589
486 Ga0500568_0003633 3300053139 Bacteria 8503
487 Ga0500568_0004245 3300053139 Bacteria 7702
488 Ga0500568_0010277 3300053139 Bacteria 4392
489 Ga0500573_0000001 3300053140 Bacteria 436394
490 Ga0500573_0000487 3300053140 Bacteria 17122
491 Ga0500573_0008949 3300053140 Bacteria 5533
492 Ga0500573_0015167 3300053140 Bacteria 4366
493 Ga0500573_0018519 3300053140 Bacteria 3970
494 Ga0500573_0026061 3300053140 Bacteria 3361
495 Ga0500573_0033706 3300053140 Bacteria 2954
496 Ga0500573_0066004 3300053140 Bacteria 2069
497 Ga0500573_0126716 3300053140 Bacteria 1417
498 Ga0500573_0129840 3300053140 Bacteria 1396
499 Ga0500573_0155243 3300053140 Bacteria 1250
500 Ga0500573_0215662 3300053140 Bacteria 1010
501 Ga0500573_0459321 3300053140 Bacteria 586
502 Ga0500577_0010400 3300053142 Bacteria 2738
503 Ga0500577_0039727 3300053142 Bacteria 1707
504 Ga0500590_024944 3300053148 Bacteria 3105
505 Ga0500616_0000864 3300053153 Bacteria 33621
506 Ga0500616_0001099 3300053153 Bacteria 28063
507 Ga0500616_0086989 3300053153 Bacteria 1557
508 Ga0500620_000292 3300053155 Bacteria 9632
509 Ga0500645_083275 3300053730 Bacteria 912
510 Ga0501084_0042282 3300054114 Bacteria 3812
511 Ga0501082_0044414 3300060353 Bacteria 3833
512 Ga0501082_0315077 3300060353 Bacteria 1363
513 Ga0501082_0831150 3300060353 Bacteria 808
514 Ga0466962_0135722 3300061719 Bacteria 1190
515 Ga0466962_0233998 3300061719 Bacteria 901

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100798387 Ga0207675_1007983871 128
2 3300041451 Ga0451791_0294488 Ga0451791_0294488_1874_2362 143
3 3300041452 Ga0451793_1709792 Ga0451793_1709792_738_1226 143
4 3300041453 Ga0451797_1381397 Ga0451797_1381397_577_1065 143
5 3300041498 Ga0451841_0025360 Ga0451841_0025360_218_706 143
6 3300041511 Ga0451855_1722690 Ga0451855_1722690_789_1277 143
7 3300041512 Ga0451853_2133845 Ga0451853_2133845_278_766 143
8 3300049568 Ga0501031_0016602 Ga0501031_0016602_2339_2794 143
9 3300049572 Ga0501036_0003312 Ga0501036_0003312_5347_5802 143
10 3300049573 Ga0501037_0010008 Ga0501037_0010008_4518_4973 143
11 3300049574 Ga0501038_0041434 Ga0501038_0041434_3022_3477 143
12 3300049575 Ga0501039_0009905 Ga0501039_0009905_4741_5196 143
13 3300049576 Ga0501040_0028238 Ga0501040_0028238_1895_2350 143
14 3300049577 Ga0501041_0026756 Ga0501041_0026756_345_800 143
15 3300049578 Ga0501042_0000189 Ga0501042_0000189_4898_5353 143
16 3300049582 Ga0501048_0027985 Ga0501048_0027985_2955_3410 143
17 3300049586 Ga0501070_0021716 Ga0501070_0021716_959_1414 143
18 3300049587 Ga0501071_0001973 Ga0501071_0001973_7454_7909 143
19 3300049589 Ga0501073_0131765 Ga0501073_0131765_321_776 143
20 3300049590 Ga0501074_0024221 Ga0501074_0024221_2371_2826 143
21 3300049591 Ga0501075_0007696 Ga0501075_0007696_2172_2627 143
22 3300049593 Ga0501077_0129708 Ga0501077_0129708_794_1249 143
23 3300049741 Ga0501079_0013151 Ga0501079_0013151_1320_1775 143
24 3300049742 Ga0501080_0018954 Ga0501080_0018954_1419_1874 143
25 3300049822 Ga0501035_0094245 Ga0501035_0094245_56_511 143
26 3300049824 Ga0501045_0009089 Ga0501045_0009089_3196_3651 143
27 3300054114 Ga0501084_0042282 Ga0501084_0042282_3212_3667 143
28 3300060353 Ga0501082_0044414 Ga0501082_0044414_947_1402 143
29 3300042438 Ga0439459_0206899 Ga0439459_0206899_22_471 147
30 3300044765 Ga0466970_0425268 Ga0466970_0425268_10_465 147
31 3300050491 nmdc:mga00v17_11932_c1 nmdc:mga00v17_11932_c1_1126_1575 147
32 3300048926 Ga0496123_0025110 Ga0496123_0025110_72_560 151
33 3300005367 Ga0070667_100129848 Ga0070667_1001298482 154
34 3300005563 Ga0068855_100098007 Ga0068855_1000980074 154
35 3300005614 Ga0068856_100032649 Ga0068856_1000326493 154
36 3300005617 Ga0068859_100324331 Ga0068859_1003243312 154
37 3300005841 Ga0068863_100216423 Ga0068863_1002164231 154
38 3300005842 Ga0068858_100001161 Ga0068858_10000116110 154
39 3300006173 Ga0070716_100627468 Ga0070716_1006274682 154
40 3300006931 Ga0097620_100324363 Ga0097620_1003243632 154
41 3300025909 Ga0207705_10042798 Ga0207705_100427983 154
42 3300025919 Ga0207657_10013598 Ga0207657_1001359810 154
43 3300025920 Ga0207649_10382338 Ga0207649_103823382 154
44 3300025927 Ga0207687_10017562 Ga0207687_100175622 154
45 3300025949 Ga0207667_10000384 Ga0207667_1000038422 154
46 3300025949 Ga0207667_10175212 Ga0207667_101752122 154
47 3300025981 Ga0207640_10040713 Ga0207640_100407134 154
48 3300025986 Ga0207658_10846635 Ga0207658_108466351 154
49 3300026035 Ga0207703_10000982 Ga0207703_1000098221 154
50 3300026078 Ga0207702_10411178 Ga0207702_104111782 154
51 3300041509 Ga0451843_0143344 Ga0451843_0143344_680_1165 154
52 3300005437 Ga0070710_10025336 Ga0070710_100253362 155
53 3300025898 Ga0207692_10280390 Ga0207692_102803902 155
54 3300046529 Ga0495652_0211376 Ga0495652_0211376_720_1229 155
55 3300049579 Ga0501043_0408749 Ga0501043_0408749_54_545 155
56 3300049580 Ga0501046_0073716 Ga0501046_0073716_1772_2263 155
57 3300049592 Ga0501076_0003620 Ga0501076_0003620_5027_5518 155
58 3300049741 Ga0501079_0490145 Ga0501079_0490145_405_887 155
59 3300049823 Ga0501044_0235304 Ga0501044_0235304_1210_1701 155
60 3300053077 Ga0495601_0080048 Ga0495601_0080048_254_763 155
61 3300053085 Ga0495619_0106380 Ga0495619_0106380_1265_1774 155
62 3300005327 Ga0070658_10397069 Ga0070658_103970692 156
63 3300047315 Ga0495581_0310308 Ga0495581_0310308_148_660 156
64 iso_pu_bacteria 2585428094 2587863267 156
65 iso_pu_bacteria 2643221549 2643768038 156
66 iso_pu_bacteria 2643221572 2643875624 156
67 iso_pu_bacteria 2643221616 2644095707 156
68 iso_pu_bacteria 2643221619 2644111425 156
69 iso_pu_bacteria 2643221632 2644183023 156
70 iso_pu_bacteria 2643221635 2644198730 156
71 iso_pu_bacteria 2643221649 2644277147 156
72 iso_pu_bacteria 2643221669 2644382679 156
73 iso_pu_bacteria 2721755702 2723641735 156
74 iso_pu_bacteria 2808606372 2808901727 156
75 iso_pu_bacteria 2844841374 2844842090 156
76 iso_pu_bacteria 2852643534 2852646049 156
77 iso_pu_bacteria 2852677369 2852680106 156
78 iso_pu_bacteria 2857729791 2857730173 156
79 iso_pu_bacteria 2857733635 2857734007 156
80 iso_pu_bacteria 2857737099 2857739766 156
81 iso_pu_bacteria 2862993130 2862995010 156
82 iso_pu_bacteria 2870622029 2870624301 156
83 iso_pu_bacteria 2884763398 2884765079 156
84 iso_pu_bacteria 2895660088 2895661682 156
85 iso_pu_bacteria 2919055335 2919057730 156
86 iso_pu_bacteria 2919443155 2919446519 156
87 iso_pu_bacteria 2919523602 2919524134 156
88 iso_pu_bacteria 2928121344 2928123396 156
89 iso_pu_bacteria 2928153084 2928155697 156
90 iso_pu_bacteria 2935409751 2935411144 156
91 iso_pu_bacteria 2939657138 2939658783 156
92 iso_pu_bacteria 2939660829 2939662552 156
93 iso_pu_bacteria 2964326757 2964327224 156
94 iso_pu_bacteria 2966924647 2966926313 156
95 iso_pu_bacteria 2995726249 2995727818 156
96 iso_pu_bacteria 8046352972 8046353161 156
97 iso_pu_bacteria 8055034563 8055036212 156
98 iso_pu_bacteria 8055037949 8055038307 156
99 iso_pu_bacteria 8057345674 8057348136 156
100 3300049586 Ga0501070_0895194 Ga0501070_0895194_122_607 157
101 3300046660 Ga0495625_0284502 Ga0495625_0284502_447_923 158
102 3300053140 Ga0500573_0066004 Ga0500573_0066004_852_1328 158
103 3300005618 Ga0068864_102329704 Ga0068864_1023297041 159
104 3300006038 Ga0075365_10402523 Ga0075365_104025232 159
105 3300013306 Ga0163162_11754651 Ga0163162_117546512 159
106 3300046530 Ga0495654_0265631 Ga0495654_0265631_173_655 159
107 3300053098 Ga0500650_0039463 Ga0500650_0039463_1271_1750 159
108 3300053131 Ga0500652_200759 Ga0500652_200759_288_773 159
109 3300053140 Ga0500573_0215662 Ga0500573_0215662_380_862 159
110 3300053140 Ga0500573_0459321 Ga0500573_0459321_79_564 159
111 3300053142 Ga0500577_0039727 Ga0500577_0039727_521_1000 159
112 3300001979 JGI24740J21852_10018564 JGI24740J21852_100185643 160
113 3300001989 JGI24739J22299_10046037 JGI24739J22299_100460372 160
114 3300001990 JGI24737J22298_10009502 JGI24737J22298_100095022 160
115 3300002067 JGI24735J21928_10002269 JGI24735J21928_100022697 160
116 3300002772 JGI25164J39214_1000778 JGI25164J39214_100077810 160
117 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002364 160
118 3300003578 Ga0006562J51391_1061877 Ga0006562J51391_10618774 160
119 3300003752 Ga0055539_1000111 Ga0055539_10001115 160
120 3300003756 Ga0055533_1000001 Ga0055533_1000001426 160
121 3300003759 Ga0055525_1000317 Ga0055525_100031725 160
122 3300003760 Ga0055527_1000012 Ga0055527_1000012238 160
123 3300003762 Ga0055542_1000017 Ga0055542_1000017238 160
124 3300003763 Ga0055529_1000023 Ga0055529_1000023205 160
125 3300003841 Ga0055541_1008364 Ga0055541_10083643 160
126 3300005288 Ga0065714_10078159 Ga0065714_100781592 160
127 3300005288 Ga0065714_10214281 Ga0065714_102142811 160
128 3300005288 Ga0065714_10216972 Ga0065714_102169721 160
129 3300005327 Ga0070658_10000245 Ga0070658_1000024510 160
130 3300005327 Ga0070658_10010448 Ga0070658_100104482 160
131 3300005327 Ga0070658_10039615 Ga0070658_100396152 160
132 3300005337 Ga0070682_101701465 Ga0070682_1017014651 160
133 3300005338 Ga0068868_100737982 Ga0068868_1007379821 160
134 3300005339 Ga0070660_100002036 Ga0070660_10000203610 160
135 3300005354 Ga0070675_100071846 Ga0070675_1000718462 160
136 3300005365 Ga0070688_100288751 Ga0070688_1002887512 160
137 3300005366 Ga0070659_100008194 Ga0070659_1000081943 160
138 3300005367 Ga0070667_100002813 Ga0070667_1000028132 160
139 3300005437 Ga0070710_10002030 Ga0070710_1000203011 160
140 3300005455 Ga0070663_100652484 Ga0070663_1006524842 160
141 3300005455 Ga0070663_101286662 Ga0070663_1012866621 160
142 3300005466 Ga0070685_10056644 Ga0070685_100566441 160
143 3300005539 Ga0068853_100207767 Ga0068853_1002077673 160
144 3300005543 Ga0070672_100932244 Ga0070672_1009322442 160
145 3300005548 Ga0070665_101285814 Ga0070665_1012858141 160
146 3300005563 Ga0068855_100013037 Ga0068855_10001303710 160
147 3300005563 Ga0068855_100105876 Ga0068855_1001058762 160
148 3300005614 Ga0068856_100049854 Ga0068856_1000498542 160
149 3300005614 Ga0068856_100560126 Ga0068856_1005601262 160
150 3300005616 Ga0068852_100005756 Ga0068852_1000057568 160
151 3300005616 Ga0068852_100011467 Ga0068852_1000114672 160
152 3300005616 Ga0068852_100408071 Ga0068852_1004080712 160
153 3300005618 Ga0068864_100526124 Ga0068864_1005261242 160
154 3300005834 Ga0068851_10000001 Ga0068851_10000001428 160
155 3300005840 Ga0068870_10754974 Ga0068870_107549741 160
156 3300005844 Ga0068862_100164726 Ga0068862_1001647262 160
157 3300006038 Ga0075365_10311926 Ga0075365_103119263 160
158 3300006038 Ga0075365_10387525 Ga0075365_103875252 160
159 3300006051 Ga0075364_10014177 Ga0075364_100141774 160
160 3300006051 Ga0075364_10294758 Ga0075364_102947582 160
161 3300006051 Ga0075364_10348097 Ga0075364_103480972 160
162 3300006058 Ga0075432_10152027 Ga0075432_101520272 160
163 3300006186 Ga0075369_10064506 Ga0075369_100645062 160
164 3300006186 Ga0075369_10095075 Ga0075369_100950752 160
165 3300009093 Ga0105240_10007382 Ga0105240_100073829 160
166 3300009094 Ga0111539_10721725 Ga0111539_107217252 160
167 3300009098 Ga0105245_10005854 Ga0105245_100058549 160
168 3300009098 Ga0105245_10050848 Ga0105245_100508483 160
169 3300009101 Ga0105247_11614194 Ga0105247_116141941 160
170 3300009174 Ga0105241_10001149 Ga0105241_100011493 160
171 3300009177 Ga0105248_10000326 Ga0105248_1000032624 160
172 3300009177 Ga0105248_10056797 Ga0105248_100567972 160
173 3300009177 Ga0105248_10544300 Ga0105248_105443001 160
174 3300009545 Ga0105237_10000341 Ga0105237_1000034122 160
175 3300009545 Ga0105237_10642474 Ga0105237_106424743 160
176 3300009545 Ga0105237_11848899 Ga0105237_118488991 160
177 3300009551 Ga0105238_10030753 Ga0105238_100307532 160
178 3300009553 Ga0105249_11247153 Ga0105249_112471532 160
179 3300011119 Ga0105246_10122121 Ga0105246_101221212 160
180 3300011119 Ga0105246_10242245 Ga0105246_102422452 160
181 3300011119 Ga0105246_10703476 Ga0105246_107034761 160
182 3300013102 Ga0157371_10059068 Ga0157371_100590682 160
183 3300013104 Ga0157370_10006075 Ga0157370_100060752 160
184 3300013105 Ga0157369_10000573 Ga0157369_1000057343 160
185 3300013105 Ga0157369_10062997 Ga0157369_100629972 160
186 3300013105 Ga0157369_10067577 Ga0157369_100675773 160
187 3300013105 Ga0157369_10079951 Ga0157369_100799513 160
188 3300013105 Ga0157369_10130247 Ga0157369_101302472 160
189 3300013105 Ga0157369_10690976 Ga0157369_106909761 160
190 3300013105 Ga0157369_10695124 Ga0157369_106951242 160
191 3300013105 Ga0157369_12223077 Ga0157369_122230771 160
192 3300013296 Ga0157374_10091482 Ga0157374_100914823 160
193 3300013296 Ga0157374_10308926 Ga0157374_103089262 160
194 3300013296 Ga0157374_11239791 Ga0157374_112397912 160
195 3300013306 Ga0163162_10195609 Ga0163162_101956092 160
196 3300013307 Ga0157372_10032991 Ga0157372_100329912 160
197 3300013307 Ga0157372_10122694 Ga0157372_101226943 160
198 3300013307 Ga0157372_10795638 Ga0157372_107956381 160
199 3300013307 Ga0157372_12838596 Ga0157372_128385961 160
200 3300014325 Ga0163163_12519584 Ga0163163_125195841 160
201 3300014326 Ga0157380_10009645 Ga0157380_100096452 160
202 3300014968 Ga0157379_10028386 Ga0157379_100283862 160
203 3300014969 Ga0157376_11010598 Ga0157376_110105982 160
204 3300020069 Ga0197907_10185693 Ga0197907_101856931 160
205 3300020081 Ga0206354_11348532 Ga0206354_113485322 160
206 3300020082 Ga0206353_11560231 Ga0206353_1156023114 160
207 3300022467 Ga0224712_10073010 Ga0224712_100730102 160
208 3300025225 Ga0209566_100026 Ga0209566_100026297 160
209 3300025226 Ga0209674_100001 Ga0209674_100001427 160
210 3300025228 Ga0209672_100003 Ga0209672_100003108 160
211 3300025230 Ga0209563_100001 Ga0209563_100001427 160
212 3300025230 Ga0209563_100388 Ga0209563_10038816 160
213 3300025231 Ga0207427_100034 Ga0207427_100034292 160
214 3300025233 Ga0209437_101001 Ga0209437_1010018 160
215 3300025242 Ga0209258_101714 Ga0209258_1017143 160
216 3300025253 Ga0209677_100001 Ga0209677_100001427 160
217 3300025253 Ga0209677_105819 Ga0209677_1058193 160
218 3300025254 Ga0209148_1000004 Ga0209148_1000004403 160
219 3300025254 Ga0209148_1000608 Ga0209148_100060831 160
220 3300025258 Ga0209129_1027869 Ga0209129_10278692 160
221 3300025261 Ga0209233_1000001 Ga0209233_10000012441 160
222 3300025272 Ga0209455_1000022 Ga0209455_1000022581 160
223 3300025272 Ga0209455_1002188 Ga0209455_10021885 160
224 3300025321 Ga0207656_10000002 Ga0207656_10000002501 160
225 3300025898 Ga0207692_10019944 Ga0207692_100199443 160
226 3300025901 Ga0207688_10205861 Ga0207688_102058612 160
227 3300025904 Ga0207647_10056822 Ga0207647_100568221 160
228 3300025904 Ga0207647_10345721 Ga0207647_103457211 160
229 3300025909 Ga0207705_10000001 Ga0207705_100000011665 160
230 3300025909 Ga0207705_10071930 Ga0207705_100719301 160
231 3300025909 Ga0207705_10203229 Ga0207705_102032292 160
232 3300025909 Ga0207705_10569399 Ga0207705_105693992 160
233 3300025911 Ga0207654_10000001 Ga0207654_100000011361 160
234 3300025913 Ga0207695_10003239 Ga0207695_1000323911 160
235 3300025913 Ga0207695_10003445 Ga0207695_1000344511 160
236 3300025914 Ga0207671_10000002 Ga0207671_10000002795 160
237 3300025914 Ga0207671_10425694 Ga0207671_104256943 160
238 3300025924 Ga0207694_10000395 Ga0207694_1000039514 160
239 3300025924 Ga0207694_11192184 Ga0207694_111921841 160
240 3300025926 Ga0207659_10032770 Ga0207659_100327702 160
241 3300025931 Ga0207644_10644662 Ga0207644_106446622 160
242 3300025932 Ga0207690_10000874 Ga0207690_1000087416 160
243 3300025939 Ga0207665_10901332 Ga0207665_109013321 160
244 3300025940 Ga0207691_10744063 Ga0207691_107440631 160
245 3300025941 Ga0207711_10004685 Ga0207711_1000468511 160
246 3300025941 Ga0207711_10035190 Ga0207711_100351906 160
247 3300025941 Ga0207711_11505805 Ga0207711_115058051 160
248 3300025949 Ga0207667_10153455 Ga0207667_101534553 160
249 3300025949 Ga0207667_10244337 Ga0207667_102443372 160
250 3300025972 Ga0207668_10008087 Ga0207668_100080872 160
251 3300025986 Ga0207658_10173795 Ga0207658_101737952 160
252 3300026023 Ga0207677_10229688 Ga0207677_102296882 160
253 3300026023 Ga0207677_10232554 Ga0207677_102325542 160
254 3300026041 Ga0207639_10070713 Ga0207639_100707132 160
255 3300026041 Ga0207639_10188305 Ga0207639_101883051 160
256 3300026067 Ga0207678_10132755 Ga0207678_101327553 160
257 3300026067 Ga0207678_10263191 Ga0207678_102631912 160
258 3300026067 Ga0207678_10812624 Ga0207678_108126241 160
259 3300026078 Ga0207702_10114288 Ga0207702_101142881 160
260 3300026078 Ga0207702_10263157 Ga0207702_102631572 160
261 3300026095 Ga0207676_10036367 Ga0207676_100363672 160
262 3300026116 Ga0207674_10589775 Ga0207674_105897752 160
263 3300026142 Ga0207698_10000372 Ga0207698_1000037219 160
264 3300026142 Ga0207698_10003382 Ga0207698_100033827 160
265 3300028379 Ga0268266_10907709 Ga0268266_109077091 160
266 3300028380 Ga0268265_10140994 Ga0268265_101409942 160
267 3300028380 Ga0268265_12320578 Ga0268265_123205781 160
268 3300028794 Ga0307515_10051415 Ga0307515_100514156 160
269 3300028794 Ga0307515_10100177 Ga0307515_101001773 160
270 3300030521 Ga0307511_10245362 Ga0307511_102453622 160
271 3300031507 Ga0307509_10299566 Ga0307509_102995662 160
272 3300031548 Ga0307408_100212909 Ga0307408_1002129092 160
273 3300031649 Ga0307514_10016353 Ga0307514_100163532 160
274 3300031649 Ga0307514_10035564 Ga0307514_100355642 160
275 3300031731 Ga0307405_10150700 Ga0307405_101507002 160
276 3300031852 Ga0307410_10166536 Ga0307410_101665361 160
277 3300031852 Ga0307410_10471563 Ga0307410_104715632 160
278 3300031852 Ga0307410_10609585 Ga0307410_106095852 160
279 3300031901 Ga0307406_10047788 Ga0307406_100477882 160
280 3300031901 Ga0307406_11134624 Ga0307406_111346241 160
281 3300031911 Ga0307412_10421503 Ga0307412_104215032 160
282 3300031911 Ga0307412_10672911 Ga0307412_106729111 160
283 3300031911 Ga0307412_10829929 Ga0307412_108299291 160
284 3300031995 Ga0307409_100535330 Ga0307409_1005353302 160
285 3300031995 Ga0307409_101277402 Ga0307409_1012774021 160
286 3300031995 Ga0307409_102097032 Ga0307409_1020970321 160
287 3300032002 Ga0307416_100696358 Ga0307416_1006963582 160
288 3300032002 Ga0307416_100928744 Ga0307416_1009287442 160
289 3300032002 Ga0307416_102154137 Ga0307416_1021541371 160
290 3300032004 Ga0307414_10643913 Ga0307414_106439132 160
291 3300032005 Ga0307411_10373906 Ga0307411_103739062 160
292 3300032005 Ga0307411_11280731 Ga0307411_112807311 160
293 3300032126 Ga0307415_100233855 Ga0307415_1002338551 160
294 3300037312 Ga0395899_0020523 Ga0395899_0020523_4358_4840 160
295 3300037312 Ga0395899_0080831 Ga0395899_0080831_1367_1849 160
296 3300037418 Ga0395900_0001562 Ga0395900_0001562_4248_4730 160
297 3300037418 Ga0395900_0354773 Ga0395900_0354773_625_1107 160
298 3300037466 Ga0395898_0002083 Ga0395898_0002083_16734_17216 160
299 3300037466 Ga0395898_0264622 Ga0395898_0264622_982_1464 160
300 3300038443 Ga0395901_0304743 Ga0395901_0304743_972_1454 160
301 3300041413 Ga0439465_0095419 Ga0439465_0095419_170_661 160
302 3300041443 Ga0451789_0809815 Ga0451789_0809815_73_564 160
303 3300041443 Ga0451789_1302198 Ga0451789_1302198_70_561 160
304 3300041451 Ga0451791_0085663 Ga0451791_0085663_136_618 160
305 3300041451 Ga0451791_1133574 Ga0451791_1133574_381_872 160
306 3300041452 Ga0451793_1534553 Ga0451793_1534553_568_1056 160
307 3300041453 Ga0451797_1126810 Ga0451797_1126810_240_722 160
308 3300041456 Ga0451795_0629196 Ga0451795_0629196_145_633 160
309 3300041458 Ga0451798_1094680 Ga0451798_1094680_281_769 160
310 3300041460 Ga0451802_1933098 Ga0451802_1933098_117_605 160
311 3300041460 Ga0451802_2007612 Ga0451802_2007612_173_661 160
312 3300041509 Ga0451843_0998735 Ga0451843_0998735_175_663 160
313 3300041997 Ga0439431_0171236 Ga0439431_0171236_100_591 160
314 3300042116 Ga0450912_017946 Ga0450912_017946_129_614 160
315 3300042156 Ga0439446_0159049 Ga0439446_0159049_192_683 160
316 3300044658 Ga0466972_0027508 Ga0466972_0027508_857_1339 160
317 3300044658 Ga0466972_0028357 Ga0466972_0028357_1479_1961 160
318 3300044658 Ga0466972_0049075 Ga0466972_0049075_1403_1885 160
319 3300044658 Ga0466972_0084668 Ga0466972_0084668_958_1440 160
320 3300044683 Ga0466965_0000016 Ga0466965_0000016_15204_15689 160
321 3300044683 Ga0466965_0096611 Ga0466965_0096611_807_1289 160
322 3300044684 Ga0466966_0117863 Ga0466966_0117863_955_1437 160
323 3300044684 Ga0466966_0204141 Ga0466966_0204141_345_827 160
324 3300044693 Ga0466961_0078879 Ga0466961_0078879_1001_1483 160
325 3300044693 Ga0466961_0090006 Ga0466961_0090006_74_556 160
326 3300044693 Ga0466961_0220761 Ga0466961_0220761_218_700 160
327 3300044693 Ga0466961_0505571 Ga0466961_0505571_62_544 160
328 3300044706 Ga0466964_0191676 Ga0466964_0191676_255_737 160
329 3300044719 Ga0466971_0040044 Ga0466971_0040044_1153_1635 160
330 3300044719 Ga0466971_0132837 Ga0466971_0132837_553_1035 160
331 3300044735 Ga0466968_0025044 Ga0466968_0025044_1833_2315 160
332 3300044765 Ga0466970_0008550 Ga0466970_0008550_1625_2107 160
333 3300044765 Ga0466970_0034454 Ga0466970_0034454_1901_2383 160
334 3300044765 Ga0466970_0084779 Ga0466970_0084779_169_651 160
335 3300044842 Ga0466957_0025480 Ga0466957_0025480_2388_2870 160
336 3300044842 Ga0466957_0150632 Ga0466957_0150632_916_1398 160
337 3300044842 Ga0466957_0161044 Ga0466957_0161044_61_543 160
338 3300044901 Ga0466960_0023062 Ga0466960_0023062_756_1238 160
339 3300044901 Ga0466960_0101444 Ga0466960_0101444_175_657 160
340 3300044901 Ga0466960_0128974 Ga0466960_0128974_143_637 160
341 3300045049 Ga0466959_0005711 Ga0466959_0005711_40_522 160
342 3300045049 Ga0466959_0036468 Ga0466959_0036468_637_1119 160
343 3300045049 Ga0466959_0240515 Ga0466959_0240515_37_519 160
344 3300045836 Ga0466958_0043586 Ga0466958_0043586_1248_1730 160
345 3300045836 Ga0466958_0406981 Ga0466958_0406981_321_803 160
346 3300045976 Ga0466967_0894078 Ga0466967_0894078_352_834 160
347 3300046457 Ga0495590_0000331 Ga0495590_0000331_17459_17959 160
348 3300046460 Ga0495638_0203731 Ga0495638_0203731_206_697 160
349 3300046471 Ga0495650_0000989 Ga0495650_0000989_29879_30367 160
350 3300046648 Ga0495611_0357069 Ga0495611_0357069_139_630 160
351 3300047320 Ga0495672_0010044 Ga0495672_0010044_2155_2643 160
352 3300047320 Ga0495672_0020872 Ga0495672_0020872_1615_2130 160
353 3300047472 Ga0495686_0231894 Ga0495686_0231894_446_937 160
354 3300048903 Ga0496100_0163134 Ga0496100_0163134_628_1110 160
355 3300048904 Ga0496101_0046669 Ga0496101_0046669_600_1082 160
356 3300048904 Ga0496101_0358455 Ga0496101_0358455_411_893 160
357 3300048905 Ga0496102_0100558 Ga0496102_0100558_1806_2288 160
358 3300048905 Ga0496102_0300740 Ga0496102_0300740_561_1052 160
359 3300048905 Ga0496102_0315529 Ga0496102_0315529_923_1405 160
360 3300048905 Ga0496102_0410431 Ga0496102_0410431_59_541 160
361 3300048905 Ga0496102_0812866 Ga0496102_0812866_232_732 160
362 3300048906 Ga0496103_0208076 Ga0496103_0208076_523_1005 160
363 3300048906 Ga0496103_0438132 Ga0496103_0438132_118_609 160
364 3300048907 Ga0496104_0111725 Ga0496104_0111725_2110_2592 160
365 3300048907 Ga0496104_0861210 Ga0496104_0861210_119_601 160
366 3300048908 Ga0496105_0029524 Ga0496105_0029524_1554_2036 160
367 3300048908 Ga0496105_0216894 Ga0496105_0216894_277_759 160
368 3300048908 Ga0496105_0388114 Ga0496105_0388114_491_973 160
369 3300048910 Ga0496107_0064555 Ga0496107_0064555_564_1046 160
370 3300048910 Ga0496107_0126931 Ga0496107_0126931_1169_1651 160
371 3300048916 Ga0496113_0057504 Ga0496113_0057504_989_1480 160
372 3300048917 Ga0496114_0099333 Ga0496114_0099333_1225_1707 160
373 3300048918 Ga0496115_0011036 Ga0496115_0011036_2524_3006 160
374 3300048919 Ga0496116_0162477 Ga0496116_0162477_689_1171 160
375 3300048920 Ga0496117_0000620 Ga0496117_0000620_12178_12669 160
376 3300048920 Ga0496117_0006271 Ga0496117_0006271_5539_6021 160
377 3300048920 Ga0496117_0084197 Ga0496117_0084197_723_1211 160
378 3300048920 Ga0496117_0097560 Ga0496117_0097560_1271_1753 160
379 3300048920 Ga0496117_0281197 Ga0496117_0281197_317_799 160
380 3300048921 Ga0496118_0027091 Ga0496118_0027091_1991_2473 160
381 3300048921 Ga0496118_0045946 Ga0496118_0045946_2289_2777 160
382 3300048921 Ga0496118_0055056 Ga0496118_0055056_1569_2051 160
383 3300048921 Ga0496118_0101044 Ga0496118_0101044_364_846 160
384 3300048922 Ga0496119_0000462 Ga0496119_0000462_17598_18086 160
385 3300048922 Ga0496119_0001409 Ga0496119_0001409_21525_22013 160
386 3300048922 Ga0496119_0060789 Ga0496119_0060789_341_823 160
387 3300048922 Ga0496119_0080595 Ga0496119_0080595_1329_1817 160
388 3300048922 Ga0496119_0245520 Ga0496119_0245520_221_715 160
389 3300048922 Ga0496119_0412158 Ga0496119_0412158_41_529 160
390 3300048923 Ga0496120_0000882 Ga0496120_0000882_27053_27541 160
391 3300048923 Ga0496120_0156719 Ga0496120_0156719_95_577 160
392 3300048924 Ga0496121_0000025 Ga0496121_0000025_37487_37975 160
393 3300048924 Ga0496121_0104638 Ga0496121_0104638_1224_1712 160
394 3300048924 Ga0496121_0165411 Ga0496121_0165411_1011_1499 160
395 3300048925 Ga0496122_0002058 Ga0496122_0002058_18224_18724 160
396 3300048925 Ga0496122_0005357 Ga0496122_0005357_11486_11977 160
397 3300048925 Ga0496122_0336890 Ga0496122_0336890_288_770 160
398 3300048925 Ga0496122_0508200 Ga0496122_0508200_83_571 160
399 3300048926 Ga0496123_0003992 Ga0496123_0003992_1520_2020 160
400 3300048928 Ga0496125_0274580 Ga0496125_0274580_281_772 160
401 3300048928 Ga0496125_0505720 Ga0496125_0505720_172_660 160
402 3300048929 Ga0496126_0005351 Ga0496126_0005351_471_953 160
403 3300048929 Ga0496126_0082034 Ga0496126_0082034_2229_2717 160
404 3300048929 Ga0496126_0110196 Ga0496126_0110196_1085_1567 160
405 3300048929 Ga0496126_0158735 Ga0496126_0158735_1349_1834 160
406 3300048929 Ga0496126_0163323 Ga0496126_0163323_1245_1727 160
407 3300048929 Ga0496126_0547391 Ga0496126_0547391_20_508 160
408 3300048929 Ga0496126_1062025 Ga0496126_1062025_22_516 160
409 3300049568 Ga0501031_0093172 Ga0501031_0093172_526_1014 160
410 3300049568 Ga0501031_0104937 Ga0501031_0104937_856_1341 160
411 3300049568 Ga0501031_0363057 Ga0501031_0363057_400_885 160
412 3300049569 Ga0501032_0014588 Ga0501032_0014588_3837_4322 160
413 3300049569 Ga0501032_0027787 Ga0501032_0027787_2013_2495 160
414 3300049569 Ga0501032_0031313 Ga0501032_0031313_209_694 160
415 3300049569 Ga0501032_0043987 Ga0501032_0043987_1762_2250 160
416 3300049569 Ga0501032_0062436 Ga0501032_0062436_319_804 160
417 3300049569 Ga0501032_0709216 Ga0501032_0709216_49_534 160
418 3300049570 Ga0501033_0002059 Ga0501033_0002059_13204_13686 160
419 3300049570 Ga0501033_0011913 Ga0501033_0011913_5676_6158 160
420 3300049570 Ga0501033_0038554 Ga0501033_0038554_944_1429 160
421 3300049570 Ga0501033_0157154 Ga0501033_0157154_861_1349 160
422 3300049570 Ga0501033_0924037 Ga0501033_0924037_19_501 160
423 3300049571 Ga0501034_0023864 Ga0501034_0023864_4381_4920 160
424 3300049571 Ga0501034_0041781 Ga0501034_0041781_248_730 160
425 3300049571 Ga0501034_0053217 Ga0501034_0053217_3117_3599 160
426 3300049571 Ga0501034_0053994 Ga0501034_0053994_1009_1509 160
427 3300049571 Ga0501034_0094477 Ga0501034_0094477_1602_2090 160
428 3300049571 Ga0501034_0180235 Ga0501034_0180235_433_933 160
429 3300049571 Ga0501034_0220423 Ga0501034_0220423_911_1393 160
430 3300049571 Ga0501034_0265502 Ga0501034_0265502_1000_1488 160
431 3300049571 Ga0501034_0271026 Ga0501034_0271026_590_1075 160
432 3300049571 Ga0501034_0623536 Ga0501034_0623536_127_615 160
433 3300049572 Ga0501036_0002187 Ga0501036_0002187_2559_3041 160
434 3300049572 Ga0501036_0078757 Ga0501036_0078757_1737_2219 160
435 3300049572 Ga0501036_0390429 Ga0501036_0390429_50_535 160
436 3300049572 Ga0501036_0627239 Ga0501036_0627239_21_509 160
437 3300049572 Ga0501036_0635583 Ga0501036_0635583_374_859 160
438 3300049573 Ga0501037_0017808 Ga0501037_0017808_3287_3772 160
439 3300049573 Ga0501037_0018671 Ga0501037_0018671_2632_3117 160
440 3300049573 Ga0501037_0075266 Ga0501037_0075266_1324_1863 160
441 3300049573 Ga0501037_0108605 Ga0501037_0108605_893_1381 160
442 3300049573 Ga0501037_0599318 Ga0501037_0599318_61_561 160
443 3300049573 Ga0501037_0788145 Ga0501037_0788145_21_512 160
444 3300049574 Ga0501038_0019458 Ga0501038_0019458_3207_3692 160
445 3300049574 Ga0501038_0029954 Ga0501038_0029954_1382_1864 160
446 3300049574 Ga0501038_0077019 Ga0501038_0077019_222_707 160
447 3300049574 Ga0501038_0236738 Ga0501038_0236738_209_691 160
448 3300049575 Ga0501039_0148724 Ga0501039_0148724_343_825 160
449 3300049575 Ga0501039_0647307 Ga0501039_0647307_28_513 160
450 3300049576 Ga0501040_0781166 Ga0501040_0781166_156_638 160
451 3300049577 Ga0501041_0620550 Ga0501041_0620550_15_506 160
452 3300049578 Ga0501042_0122980 Ga0501042_0122980_931_1413 160
453 3300049579 Ga0501043_0002868 Ga0501043_0002868_6638_7177 160
454 3300049579 Ga0501043_0072950 Ga0501043_0072950_1308_1793 160
455 3300049579 Ga0501043_0144179 Ga0501043_0144179_1218_1703 160
456 3300049579 Ga0501043_0171583 Ga0501043_0171583_1167_1649 160
457 3300049580 Ga0501046_0004032 Ga0501046_0004032_12826_13308 160
458 3300049580 Ga0501046_0099169 Ga0501046_0099169_551_1033 160
459 3300049580 Ga0501046_0188775 Ga0501046_0188775_366_854 160
460 3300049581 Ga0501047_0041524 Ga0501047_0041524_1108_1596 160
461 3300049581 Ga0501047_0061647 Ga0501047_0061647_1298_1780 160
462 3300049581 Ga0501047_0066995 Ga0501047_0066995_2014_2496 160
463 3300049581 Ga0501047_0147272 Ga0501047_0147272_875_1414 160
464 3300049581 Ga0501047_0293176 Ga0501047_0293176_95_580 160
465 3300049582 Ga0501048_0003937 Ga0501048_0003937_5464_5946 160
466 3300049582 Ga0501048_0502253 Ga0501048_0502253_360_842 160
467 3300049582 Ga0501048_0564727 Ga0501048_0564727_164_649 160
468 3300049583 Ga0501067_0363822 Ga0501067_0363822_96_581 160
469 3300049584 Ga0501068_0442830 Ga0501068_0442830_99_584 160
470 3300049585 Ga0501069_0010568 Ga0501069_0010568_436_918 160
471 3300049585 Ga0501069_0100167 Ga0501069_0100167_141_623 160
472 3300049586 Ga0501070_0000133 Ga0501070_0000133_5573_6055 160
473 3300049586 Ga0501070_0001501 Ga0501070_0001501_16091_16630 160
474 3300049586 Ga0501070_0055855 Ga0501070_0055855_611_1099 160
475 3300049586 Ga0501070_0134749 Ga0501070_0134749_1007_1489 160
476 3300049586 Ga0501070_0141798 Ga0501070_0141798_1004_1492 160
477 3300049587 Ga0501071_0000105 Ga0501071_0000105_14684_15166 160
478 3300049587 Ga0501071_0255113 Ga0501071_0255113_595_1080 160
479 3300049587 Ga0501071_0368364 Ga0501071_0368364_192_683 160
480 3300049587 Ga0501071_1144071 Ga0501071_1144071_18_500 160
481 3300049588 Ga0501072_0160424 Ga0501072_0160424_240_722 160
482 3300049588 Ga0501072_0692834 Ga0501072_0692834_64_564 160
483 3300049589 Ga0501073_0000028 Ga0501073_0000028_86162_86647 160
484 3300049589 Ga0501073_0051043 Ga0501073_0051043_2221_2703 160
485 3300049589 Ga0501073_0100396 Ga0501073_0100396_1378_1866 160
486 3300049589 Ga0501073_0747485 Ga0501073_0747485_157_639 160
487 3300049592 Ga0501076_1044927 Ga0501076_1044927_60_542 160
488 3300049741 Ga0501079_1089376 Ga0501079_1089376_63_545 160
489 3300049742 Ga0501080_0000152 Ga0501080_0000152_33996_34535 160
490 3300049742 Ga0501080_0084253 Ga0501080_0084253_1738_2220 160
491 3300049744 Ga0501083_0121717 Ga0501083_0121717_27_509 160
492 3300049744 Ga0501083_0316019 Ga0501083_0316019_267_749 160
493 3300049822 Ga0501035_0000582 Ga0501035_0000582_27681_28169 160
494 3300049822 Ga0501035_0058013 Ga0501035_0058013_2038_2520 160
495 3300049823 Ga0501044_0009817 Ga0501044_0009817_781_1269 160
496 3300049823 Ga0501044_0285470 Ga0501044_0285470_810_1295 160
497 3300049823 Ga0501044_0301638 Ga0501044_0301638_859_1341 160
498 3300049823 Ga0501044_0442898 Ga0501044_0442898_268_750 160
499 3300049823 Ga0501044_0750410 Ga0501044_0750410_60_545 160
500 3300050491 nmdc:mga00v17_241180_c1 nmdc:mga00v17_241180_c1_59_556 160
501 3300050491 nmdc:mga00v17_353343_c1 nmdc:mga00v17_353343_c1_316_798 160
502 3300050491 nmdc:mga00v17_358526_c1 nmdc:mga00v17_358526_c1_395_889 160
503 3300050492 nmdc:mga0yw44_4594_c1 nmdc:mga0yw44_4594_c1_5372_5860 160
504 3300050492 nmdc:mga0yw44_497739_c1 nmdc:mga0yw44_497739_c1_224_706 160
505 3300050516 nmdc:mga0sz30_189161_c1 nmdc:mga0sz30_189161_c1_241_723 160
506 3300050516 nmdc:mga0sz30_314406_c1 nmdc:mga0sz30_314406_c1_77_568 160
507 3300050516 nmdc:mga0sz30_3315_c2 nmdc:mga0sz30_3315_c2_383_871 160
508 3300053079 Ga0500610_0402460 Ga0500610_0402460_24_512 160
509 3300053080 Ga0500635_0000023 Ga0500635_0000023_5617_6099 160
510 3300053080 Ga0500635_0009463 Ga0500635_0009463_1539_2027 160
511 3300053087 Ga0500643_000913 Ga0500643_000913_7890_8381 160
512 3300053093 Ga0500651_0000170 Ga0500651_0000170_17315_17803 160
513 3300053102 Ga0500554_040596 Ga0500554_040596_103_591 160
514 3300053104 Ga0500556_0000001 Ga0500556_0000001_820277_820768 160
515 3300053104 Ga0500556_0000064 Ga0500556_0000064_67048_67536 160
516 3300053108 Ga0500562_000411 Ga0500562_000411_1808_2296 160
517 3300053117 Ga0500593_000556 Ga0500593_000556_3415_3903 160
518 3300053126 Ga0500621_155032 Ga0500621_155032_279_770 160
519 3300053133 Ga0500655_001460 Ga0500655_001460_3897_4385 160
520 3300053136 Ga0500559_0000043 Ga0500559_0000043_34953_35435 160
521 3300053136 Ga0500559_0000281 Ga0500559_0000281_29185_29667 160
522 3300053136 Ga0500559_0000373 Ga0500559_0000373_28334_28822 160
523 3300053136 Ga0500559_0005479 Ga0500559_0005479_2867_3349 160
524 3300053136 Ga0500559_0058088 Ga0500559_0058088_107_592 160
525 3300053136 Ga0500559_0072502 Ga0500559_0072502_407_892 160
526 3300053139 Ga0500568_0000003 Ga0500568_0000003_803159_803650 160
527 3300053139 Ga0500568_0000028 Ga0500568_0000028_151243_151737 160
528 3300053139 Ga0500568_0003633 Ga0500568_0003633_1278_1766 160
529 3300053139 Ga0500568_0004245 Ga0500568_0004245_1085_1570 160
530 3300053139 Ga0500568_0010277 Ga0500568_0010277_1511_1999 160
531 3300053140 Ga0500573_0000001 Ga0500573_0000001_258534_259016 160
532 3300053140 Ga0500573_0000487 Ga0500573_0000487_6283_6768 160
533 3300053140 Ga0500573_0008949 Ga0500573_0008949_2389_2877 160
534 3300053140 Ga0500573_0015167 Ga0500573_0015167_1341_1829 160
535 3300053140 Ga0500573_0018519 Ga0500573_0018519_2711_3199 160
536 3300053140 Ga0500573_0026061 Ga0500573_0026061_2723_3205 160
537 3300053140 Ga0500573_0033706 Ga0500573_0033706_518_1000 160
538 3300053140 Ga0500573_0126716 Ga0500573_0126716_297_779 160
539 3300053140 Ga0500573_0129840 Ga0500573_0129840_376_858 160
540 3300053140 Ga0500573_0155243 Ga0500573_0155243_88_576 160
541 3300053142 Ga0500577_0010400 Ga0500577_0010400_1637_2125 160
542 3300053148 Ga0500590_024944 Ga0500590_024944_2167_2655 160
543 3300053153 Ga0500616_0000864 Ga0500616_0000864_25636_26124 160
544 3300053153 Ga0500616_0001099 Ga0500616_0001099_24727_25218 160
545 3300053153 Ga0500616_0086989 Ga0500616_0086989_686_1174 160
546 3300053155 Ga0500620_000292 Ga0500620_000292_3436_3924 160
547 3300053730 Ga0500645_083275 Ga0500645_083275_206_694 160
548 3300060353 Ga0501082_0315077 Ga0501082_0315077_54_539 160
549 3300060353 Ga0501082_0831150 Ga0501082_0831150_228_710 160
550 3300061719 Ga0466962_0135722 Ga0466962_0135722_533_1015 160
551 3300061719 Ga0466962_0233998 Ga0466962_0233998_329_811 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

23

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9719 3 159
5o08-assembly1.cif.gz_A crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with dephospho-coenzyme a 0.9653 3 159
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9639 3 159
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9626 3 159
7yy0-assembly1.cif.gz_C crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with 4'-phosphopantetheine 0.9596 3 159
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9639 3 159 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9509 1 159 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9338 1 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9317 3 159 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9298 1 159 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A519H686-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9966 2 159 GO:0003677
GO:0003689
GO:0004595
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0015937
GO:0016887
GO:0036121
GO:0061749
GO:0061775
GO:0140584
GO:0140665
GO:0140849
GO:1990518
AF-A0A506XR89-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9961 1 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A348NUL0-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9961 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A1R4FDL9-F1-model_v4 deleted 0.9955 1 160
AF-A0A543HRT3-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.995 1 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
93.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map