F462664
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 551 | 287 | 515 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0023864|Ga0501034_0023864_4381_4920 |
| Length | 179 |
| Sequence | VSRVLTGREDPSDMLPTMSRIAVVPGSFDPVTLGHLDVIGRAAGIFDELHVLVVHNPDKSALLPIAQRVSLIQDSIAEAKLPGNILVTSWSVGLLVDYCTDVGASVLVKGIRSQVDVAYETPMAIVNRNLAGVETIFMLPDPGHAHVSSSLVRQVAALGGDVAPYVPKAVAAFLQKDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 3 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 4 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 5 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 6 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 7 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 8 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 9 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 10 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 11 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 12 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 13 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 14 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 15 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 16 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 17 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 18 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 19 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 20 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 21 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 22 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 23 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 24 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 25 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 26 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 27 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 28 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 29 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 30 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 31 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 32 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 37 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 148 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 166 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 174 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 175 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 179 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 180 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 261 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 262 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 264 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 265 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 266 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 267 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 269 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 270 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 271 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 272 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 273 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 276 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 280 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 285 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 286 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 287 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.56 |
| Metatranscriptomes | 0.91 |
| Isolates | 6.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.97 |
| Nodule | 0 |
| Rhizoplane | 5.99 |
| Rhizosphere | 66.42 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 11.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10018564 | 3300001979 | Bacteria | 2463 |
| 2 | JGI24739J22299_10046037 | 3300001989 | Bacteria | 1429 |
| 3 | JGI24737J22298_10009502 | 3300001990 | Bacteria | 3230 |
| 4 | JGI24735J21928_10002269 | 3300002067 | Bacteria | 6708 |
| 5 | JGI25164J39214_1000778 | 3300002772 | Bacteria | 11545 |
| 6 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 7 | Ga0006562J51391_1061877 | 3300003578 | Bacteria | 6163 |
| 8 | Ga0055539_1000111 | 3300003752 | Bacteria | 90530 |
| 9 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 10 | Ga0055525_1000317 | 3300003759 | Bacteria | 38691 |
| 11 | Ga0055527_1000012 | 3300003760 | Bacteria | 348744 |
| 12 | Ga0055542_1000017 | 3300003762 | Bacteria | 348744 |
| 13 | Ga0055529_1000023 | 3300003763 | Bacteria | 314383 |
| 14 | Ga0055541_1008364 | 3300003841 | Bacteria | 1651 |
| 15 | Ga0065714_10078159 | 3300005288 | Bacteria | 2623 |
| 16 | Ga0065714_10214281 | 3300005288 | Bacteria | 858 |
| 17 | Ga0065714_10216972 | 3300005288 | Bacteria | 822 |
| 18 | Ga0070658_10000245 | 3300005327 | Bacteria | 48267 |
| 19 | Ga0070658_10010448 | 3300005327 | Bacteria | 7445 |
| 20 | Ga0070658_10039615 | 3300005327 | Bacteria | 3801 |
| 21 | Ga0070658_10397069 | 3300005327 | Bacteria | 1184 |
| 22 | Ga0070682_101701465 | 3300005337 | Bacteria | 548 |
| 23 | Ga0068868_100737982 | 3300005338 | Bacteria | 884 |
| 24 | Ga0070660_100002036 | 3300005339 | Bacteria | 13937 |
| 25 | Ga0070675_100071846 | 3300005354 | Bacteria | 2872 |
| 26 | Ga0070688_100288751 | 3300005365 | Bacteria | 1181 |
| 27 | Ga0070659_100008194 | 3300005366 | Bacteria | 7628 |
| 28 | Ga0070667_100002813 | 3300005367 | Bacteria | 15009 |
| 29 | Ga0070667_100129848 | 3300005367 | Bacteria | 2198 |
| 30 | Ga0070710_10002030 | 3300005437 | Bacteria | 9580 |
| 31 | Ga0070710_10025336 | 3300005437 | Bacteria | 3141 |
| 32 | Ga0070663_100652484 | 3300005455 | Bacteria | 890 |
| 33 | Ga0070663_101286662 | 3300005455 | Bacteria | 645 |
| 34 | Ga0070685_10056644 | 3300005466 | Bacteria | 2279 |
| 35 | Ga0068853_100207767 | 3300005539 | Bacteria | 1784 |
| 36 | Ga0070672_100932244 | 3300005543 | Bacteria | 768 |
| 37 | Ga0070665_101285814 | 3300005548 | Bacteria | 742 |
| 38 | Ga0068855_100013037 | 3300005563 | Bacteria | 10027 |
| 39 | Ga0068855_100098007 | 3300005563 | Bacteria | 3377 |
| 40 | Ga0068855_100105876 | 3300005563 | Bacteria | 3233 |
| 41 | Ga0068856_100032649 | 3300005614 | Bacteria | 5097 |
| 42 | Ga0068856_100049854 | 3300005614 | Bacteria | 4127 |
| 43 | Ga0068856_100560126 | 3300005614 | Bacteria | 1164 |
| 44 | Ga0068852_100005756 | 3300005616 | Bacteria | 8897 |
| 45 | Ga0068852_100011467 | 3300005616 | Bacteria | 6674 |
| 46 | Ga0068852_100408071 | 3300005616 | Bacteria | 1338 |
| 47 | Ga0068859_100324331 | 3300005617 | Bacteria | 1634 |
| 48 | Ga0068864_100526124 | 3300005618 | Bacteria | 1141 |
| 49 | Ga0068864_102329704 | 3300005618 | Bacteria | 542 |
| 50 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 51 | Ga0068870_10754974 | 3300005840 | Bacteria | 676 |
| 52 | Ga0068863_100216423 | 3300005841 | Bacteria | 1845 |
| 53 | Ga0068858_100001161 | 3300005842 | Bacteria | 27293 |
| 54 | Ga0068862_100164726 | 3300005844 | Bacteria | 1981 |
| 55 | Ga0075365_10311926 | 3300006038 | Bacteria | 1107 |
| 56 | Ga0075365_10387525 | 3300006038 | Bacteria | 986 |
| 57 | Ga0075365_10402523 | 3300006038 | Bacteria | 966 |
| 58 | Ga0075364_10014177 | 3300006051 | Bacteria | 4920 |
| 59 | Ga0075364_10294758 | 3300006051 | Bacteria | 1104 |
| 60 | Ga0075364_10348097 | 3300006051 | Bacteria | 1010 |
| 61 | Ga0075432_10152027 | 3300006058 | Bacteria | 890 |
| 62 | Ga0070716_100627468 | 3300006173 | Bacteria | 812 |
| 63 | Ga0075369_10064506 | 3300006186 | Bacteria | 1604 |
| 64 | Ga0075369_10095075 | 3300006186 | Bacteria | 1332 |
| 65 | Ga0097620_100324363 | 3300006931 | Bacteria | 1634 |
| 66 | Ga0105240_10007382 | 3300009093 | Bacteria | 15989 |
| 67 | Ga0111539_10721725 | 3300009094 | Bacteria | 1160 |
| 68 | Ga0105245_10005854 | 3300009098 | Bacteria | 10797 |
| 69 | Ga0105245_10050848 | 3300009098 | Bacteria | 3715 |
| 70 | Ga0105247_11614194 | 3300009101 | Bacteria | 533 |
| 71 | Ga0105241_10001149 | 3300009174 | Bacteria | 20137 |
| 72 | Ga0105248_10000326 | 3300009177 | Bacteria | 56477 |
| 73 | Ga0105248_10056797 | 3300009177 | Bacteria | 4392 |
| 74 | Ga0105248_10544300 | 3300009177 | Bacteria | 1309 |
| 75 | Ga0105237_10000341 | 3300009545 | Bacteria | 65672 |
| 76 | Ga0105237_10642474 | 3300009545 | Bacteria | 1068 |
| 77 | Ga0105237_11848899 | 3300009545 | Bacteria | 612 |
| 78 | Ga0105238_10030753 | 3300009551 | Bacteria | 5466 |
| 79 | Ga0105249_11247153 | 3300009553 | Bacteria | 815 |
| 80 | Ga0105246_10122121 | 3300011119 | Bacteria | 1932 |
| 81 | Ga0105246_10242245 | 3300011119 | Bacteria | 1426 |
| 82 | Ga0105246_10703476 | 3300011119 | Bacteria | 886 |
| 83 | Ga0157371_10059068 | 3300013102 | Bacteria | 2720 |
| 84 | Ga0157370_10006075 | 3300013104 | Bacteria | 13405 |
| 85 | Ga0157369_10000573 | 3300013105 | Bacteria | 48456 |
| 86 | Ga0157369_10062997 | 3300013105 | Bacteria | 3995 |
| 87 | Ga0157369_10067577 | 3300013105 | Bacteria | 3842 |
| 88 | Ga0157369_10079951 | 3300013105 | Bacteria | 3501 |
| 89 | Ga0157369_10130247 | 3300013105 | Bacteria | 2666 |
| 90 | Ga0157369_10690976 | 3300013105 | Bacteria | 1051 |
| 91 | Ga0157369_10695124 | 3300013105 | Bacteria | 1047 |
| 92 | Ga0157369_12223077 | 3300013105 | Bacteria | 556 |
| 93 | Ga0157374_10091482 | 3300013296 | Bacteria | 2901 |
| 94 | Ga0157374_10308926 | 3300013296 | Bacteria | 1565 |
| 95 | Ga0157374_11239791 | 3300013296 | Bacteria | 767 |
| 96 | Ga0163162_10195609 | 3300013306 | Bacteria | 2151 |
| 97 | Ga0163162_11754651 | 3300013306 | Bacteria | 709 |
| 98 | Ga0157372_10032991 | 3300013307 | Bacteria | 5684 |
| 99 | Ga0157372_10122694 | 3300013307 | Bacteria | 2986 |
| 100 | Ga0157372_10795638 | 3300013307 | Bacteria | 1099 |
| 101 | Ga0157372_12838596 | 3300013307 | Bacteria | 555 |
| 102 | Ga0163163_12519584 | 3300014325 | Bacteria | 572 |
| 103 | Ga0157380_10009645 | 3300014326 | Bacteria | 6924 |
| 104 | Ga0157379_10028386 | 3300014968 | Bacteria | 4977 |
| 105 | Ga0157376_11010598 | 3300014969 | Bacteria | 854 |
| 106 | Ga0197907_10185693 | 3300020069 | Bacteria | 2744 |
| 107 | Ga0206354_11348532 | 3300020081 | Bacteria | 4580 |
| 108 | Ga0206353_11560231 | 3300020082 | Bacteria | 22870 |
| 109 | Ga0224712_10073010 | 3300022467 | Bacteria | 1398 |
| 110 | Ga0209566_100026 | 3300025225 | Bacteria | 367457 |
| 111 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 112 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 113 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 114 | Ga0209563_100388 | 3300025230 | Bacteria | 15838 |
| 115 | Ga0207427_100034 | 3300025231 | Bacteria | 320342 |
| 116 | Ga0209437_101001 | 3300025233 | Bacteria | 9888 |
| 117 | Ga0209258_101714 | 3300025242 | Bacteria | 6842 |
| 118 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 119 | Ga0209677_105819 | 3300025253 | Bacteria | 3103 |
| 120 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 121 | Ga0209148_1000608 | 3300025254 | Bacteria | 32066 |
| 122 | Ga0209129_1027869 | 3300025258 | Bacteria | 964 |
| 123 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 124 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 125 | Ga0209455_1002188 | 3300025272 | Bacteria | 7741 |
| 126 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 127 | Ga0207692_10019944 | 3300025898 | Bacteria | 3041 |
| 128 | Ga0207692_10280390 | 3300025898 | Bacteria | 1008 |
| 129 | Ga0207688_10205861 | 3300025901 | Bacteria | 1181 |
| 130 | Ga0207647_10056822 | 3300025904 | Bacteria | 2400 |
| 131 | Ga0207647_10345721 | 3300025904 | Bacteria | 842 |
| 132 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 133 | Ga0207705_10042798 | 3300025909 | Bacteria | 3252 |
| 134 | Ga0207705_10071930 | 3300025909 | Bacteria | 2507 |
| 135 | Ga0207705_10203229 | 3300025909 | Bacteria | 1501 |
| 136 | Ga0207705_10569399 | 3300025909 | Bacteria | 880 |
| 137 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 138 | Ga0207695_10003239 | 3300025913 | Bacteria | 23182 |
| 139 | Ga0207695_10003445 | 3300025913 | Bacteria | 22306 |
| 140 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 141 | Ga0207671_10425694 | 3300025914 | Bacteria | 1056 |
| 142 | Ga0207657_10013598 | 3300025919 | Bacteria | 7983 |
| 143 | Ga0207649_10382338 | 3300025920 | Bacteria | 1049 |
| 144 | Ga0207694_10000395 | 3300025924 | Bacteria | 40665 |
| 145 | Ga0207694_11192184 | 3300025924 | Bacteria | 644 |
| 146 | Ga0207659_10032770 | 3300025926 | Bacteria | 3570 |
| 147 | Ga0207687_10017562 | 3300025927 | Bacteria | 4712 |
| 148 | Ga0207644_10644662 | 3300025931 | Bacteria | 881 |
| 149 | Ga0207690_10000874 | 3300025932 | Bacteria | 19271 |
| 150 | Ga0207665_10901332 | 3300025939 | Bacteria | 701 |
| 151 | Ga0207691_10744063 | 3300025940 | Bacteria | 826 |
| 152 | Ga0207711_10004685 | 3300025941 | Bacteria | 11617 |
| 153 | Ga0207711_10035190 | 3300025941 | Bacteria | 4244 |
| 154 | Ga0207711_11505805 | 3300025941 | Bacteria | 616 |
| 155 | Ga0207667_10000384 | 3300025949 | Bacteria | 59816 |
| 156 | Ga0207667_10153455 | 3300025949 | Bacteria | 2370 |
| 157 | Ga0207667_10175212 | 3300025949 | Bacteria | 2204 |
| 158 | Ga0207667_10244337 | 3300025949 | Bacteria | 1837 |
| 159 | Ga0207668_10008087 | 3300025972 | Bacteria | 6262 |
| 160 | Ga0207640_10040713 | 3300025981 | Bacteria | 2950 |
| 161 | Ga0207658_10173795 | 3300025986 | Bacteria | 1777 |
| 162 | Ga0207658_10846635 | 3300025986 | Bacteria | 831 |
| 163 | Ga0207677_10229688 | 3300026023 | Bacteria | 1494 |
| 164 | Ga0207677_10232554 | 3300026023 | Bacteria | 1486 |
| 165 | Ga0207703_10000982 | 3300026035 | Bacteria | 27446 |
| 166 | Ga0207639_10070713 | 3300026041 | Bacteria | 2727 |
| 167 | Ga0207639_10188305 | 3300026041 | Bacteria | 1761 |
| 168 | Ga0207678_10132755 | 3300026067 | Bacteria | 2124 |
| 169 | Ga0207678_10263191 | 3300026067 | Bacteria | 1478 |
| 170 | Ga0207678_10812624 | 3300026067 | Bacteria | 826 |
| 171 | Ga0207702_10114288 | 3300026078 | Bacteria | 2405 |
| 172 | Ga0207702_10263157 | 3300026078 | Bacteria | 1625 |
| 173 | Ga0207702_10411178 | 3300026078 | Bacteria | 1306 |
| 174 | Ga0207676_10036367 | 3300026095 | Bacteria | 3745 |
| 175 | Ga0207674_10589775 | 3300026116 | Bacteria | 1074 |
| 176 | Ga0207675_100798387 | 3300026118 | Bacteria | 957 |
| 177 | Ga0207698_10000372 | 3300026142 | Bacteria | 26230 |
| 178 | Ga0207698_10003382 | 3300026142 | Bacteria | 9606 |
| 179 | Ga0268266_10907709 | 3300028379 | Bacteria | 852 |
| 180 | Ga0268265_10140994 | 3300028380 | Bacteria | 2018 |
| 181 | Ga0268265_12320578 | 3300028380 | Bacteria | 543 |
| 182 | Ga0307515_10051415 | 3300028794 | Bacteria | 6144 |
| 183 | Ga0307515_10100177 | 3300028794 | Bacteria | 3510 |
| 184 | Ga0307511_10245362 | 3300030521 | Bacteria | 868 |
| 185 | Ga0307509_10299566 | 3300031507 | Bacteria | 1357 |
| 186 | Ga0307408_100212909 | 3300031548 | Bacteria | 1572 |
| 187 | Ga0307514_10016353 | 3300031649 | Bacteria | 6112 |
| 188 | Ga0307514_10035564 | 3300031649 | Bacteria | 3964 |
| 189 | Ga0307405_10150700 | 3300031731 | Bacteria | 1635 |
| 190 | Ga0307410_10166536 | 3300031852 | Bacteria | 1657 |
| 191 | Ga0307410_10471563 | 3300031852 | Bacteria | 1028 |
| 192 | Ga0307410_10609585 | 3300031852 | Bacteria | 911 |
| 193 | Ga0307406_10047788 | 3300031901 | Bacteria | 2699 |
| 194 | Ga0307406_11134624 | 3300031901 | Bacteria | 676 |
| 195 | Ga0307412_10421503 | 3300031911 | Bacteria | 1092 |
| 196 | Ga0307412_10672911 | 3300031911 | Bacteria | 885 |
| 197 | Ga0307412_10829929 | 3300031911 | Bacteria | 805 |
| 198 | Ga0307409_100535330 | 3300031995 | Bacteria | 1147 |
| 199 | Ga0307409_101277402 | 3300031995 | Bacteria | 759 |
| 200 | Ga0307409_102097032 | 3300031995 | Bacteria | 595 |
| 201 | Ga0307416_100696358 | 3300032002 | Bacteria | 1105 |
| 202 | Ga0307416_100928744 | 3300032002 | Bacteria | 971 |
| 203 | Ga0307416_102154137 | 3300032002 | Bacteria | 659 |
| 204 | Ga0307414_10643913 | 3300032004 | Bacteria | 955 |
| 205 | Ga0307411_10373906 | 3300032005 | Bacteria | 1170 |
| 206 | Ga0307411_11280731 | 3300032005 | Bacteria | 667 |
| 207 | Ga0307415_100233855 | 3300032126 | Bacteria | 1482 |
| 208 | Ga0395899_0020523 | 3300037312 | Bacteria | 5008 |
| 209 | Ga0395899_0080831 | 3300037312 | Bacteria | 2365 |
| 210 | Ga0395900_0001562 | 3300037418 | Bacteria | 27187 |
| 211 | Ga0395900_0354773 | 3300037418 | Bacteria | 1439 |
| 212 | Ga0395898_0002083 | 3300037466 | Bacteria | 24880 |
| 213 | Ga0395898_0264622 | 3300037466 | Bacteria | 1640 |
| 214 | Ga0395901_0304743 | 3300038443 | Bacteria | 1651 |
| 215 | Ga0439465_0095419 | 3300041413 | Bacteria | 1022 |
| 216 | Ga0451789_0809815 | 3300041443 | Bacteria | 578 |
| 217 | Ga0451789_1302198 | 3300041443 | Bacteria | 701 |
| 218 | Ga0451791_0085663 | 3300041451 | Bacteria | 723 |
| 219 | Ga0451791_0294488 | 3300041451 | Bacteria | 2964 |
| 220 | Ga0451791_1133574 | 3300041451 | Bacteria | 885 |
| 221 | Ga0451793_1534553 | 3300041452 | Bacteria | 1567 |
| 222 | Ga0451793_1709792 | 3300041452 | Bacteria | 1576 |
| 223 | Ga0451797_1126810 | 3300041453 | Bacteria | 901 |
| 224 | Ga0451797_1381397 | 3300041453 | Bacteria | 1425 |
| 225 | Ga0451795_0629196 | 3300041456 | Bacteria | 796 |
| 226 | Ga0451798_1094680 | 3300041458 | Bacteria | 787 |
| 227 | Ga0451802_1933098 | 3300041460 | Bacteria | 702 |
| 228 | Ga0451802_2007612 | 3300041460 | Bacteria | 761 |
| 229 | Ga0451841_0025360 | 3300041498 | Bacteria | 1984 |
| 230 | Ga0451843_0143344 | 3300041509 | Bacteria | 1315 |
| 231 | Ga0451843_0998735 | 3300041509 | Bacteria | 987 |
| 232 | Ga0451855_1722690 | 3300041511 | Bacteria | 1352 |
| 233 | Ga0451853_2133845 | 3300041512 | Bacteria | 1150 |
| 234 | Ga0439431_0171236 | 3300041997 | Bacteria | 624 |
| 235 | Ga0450912_017946 | 3300042116 | Bacteria | 665 |
| 236 | Ga0439446_0159049 | 3300042156 | Bacteria | 746 |
| 237 | Ga0439459_0206899 | 3300042438 | Bacteria | 538 |
| 238 | Ga0466972_0027508 | 3300044658 | Bacteria | 2812 |
| 239 | Ga0466972_0028357 | 3300044658 | Bacteria | 2762 |
| 240 | Ga0466972_0049075 | 3300044658 | Bacteria | 2039 |
| 241 | Ga0466972_0084668 | 3300044658 | Bacteria | 1507 |
| 242 | Ga0466965_0000016 | 3300044683 | Bacteria | 81402 |
| 243 | Ga0466965_0096611 | 3300044683 | Bacteria | 1507 |
| 244 | Ga0466966_0117863 | 3300044684 | Bacteria | 1633 |
| 245 | Ga0466966_0204141 | 3300044684 | Bacteria | 1195 |
| 246 | Ga0466961_0078879 | 3300044693 | Bacteria | 2085 |
| 247 | Ga0466961_0090006 | 3300044693 | Bacteria | 1938 |
| 248 | Ga0466961_0220761 | 3300044693 | Bacteria | 1168 |
| 249 | Ga0466961_0505571 | 3300044693 | Bacteria | 729 |
| 250 | Ga0466964_0191676 | 3300044706 | Bacteria | 976 |
| 251 | Ga0466971_0040044 | 3300044719 | Bacteria | 2104 |
| 252 | Ga0466971_0132837 | 3300044719 | Bacteria | 1156 |
| 253 | Ga0466968_0025044 | 3300044735 | Bacteria | 2442 |
| 254 | Ga0466970_0008550 | 3300044765 | Bacteria | 5154 |
| 255 | Ga0466970_0034454 | 3300044765 | Bacteria | 2680 |
| 256 | Ga0466970_0084779 | 3300044765 | Bacteria | 1715 |
| 257 | Ga0466970_0425268 | 3300044765 | Bacteria | 760 |
| 258 | Ga0466957_0025480 | 3300044842 | Bacteria | 3506 |
| 259 | Ga0466957_0150632 | 3300044842 | Bacteria | 1504 |
| 260 | Ga0466957_0161044 | 3300044842 | Bacteria | 1457 |
| 261 | Ga0466960_0023062 | 3300044901 | Bacteria | 2790 |
| 262 | Ga0466960_0101444 | 3300044901 | Bacteria | 1482 |
| 263 | Ga0466960_0128974 | 3300044901 | Bacteria | 1333 |
| 264 | Ga0466959_0005711 | 3300045049 | Bacteria | 8560 |
| 265 | Ga0466959_0036468 | 3300045049 | Bacteria | 3633 |
| 266 | Ga0466959_0240515 | 3300045049 | Bacteria | 1250 |
| 267 | Ga0466958_0043586 | 3300045836 | Bacteria | 2702 |
| 268 | Ga0466958_0406981 | 3300045836 | Bacteria | 879 |
| 269 | Ga0466967_0894078 | 3300045976 | Bacteria | 883 |
| 270 | Ga0495590_0000331 | 3300046457 | Bacteria | 24551 |
| 271 | Ga0495638_0203731 | 3300046460 | Bacteria | 1115 |
| 272 | Ga0495650_0000989 | 3300046471 | Bacteria | 32345 |
| 273 | Ga0495652_0211376 | 3300046529 | Bacteria | 1464 |
| 274 | Ga0495654_0265631 | 3300046530 | Bacteria | 710 |
| 275 | Ga0495611_0357069 | 3300046648 | Bacteria | 670 |
| 276 | Ga0495625_0284502 | 3300046660 | Bacteria | 1063 |
| 277 | Ga0495581_0310308 | 3300047315 | Bacteria | 922 |
| 278 | Ga0495672_0010044 | 3300047320 | Bacteria | 6779 |
| 279 | Ga0495672_0020872 | 3300047320 | Bacteria | 4283 |
| 280 | Ga0495686_0231894 | 3300047472 | Bacteria | 1045 |
| 281 | Ga0496100_0163134 | 3300048903 | Bacteria | 1599 |
| 282 | Ga0496101_0046669 | 3300048904 | Bacteria | 3107 |
| 283 | Ga0496101_0358455 | 3300048904 | Bacteria | 1146 |
| 284 | Ga0496102_0100558 | 3300048905 | Bacteria | 2686 |
| 285 | Ga0496102_0300740 | 3300048905 | Bacteria | 1512 |
| 286 | Ga0496102_0315529 | 3300048905 | Bacteria | 1473 |
| 287 | Ga0496102_0410431 | 3300048905 | Bacteria | 1272 |
| 288 | Ga0496102_0812866 | 3300048905 | Bacteria | 857 |
| 289 | Ga0496103_0208076 | 3300048906 | Bacteria | 1258 |
| 290 | Ga0496103_0438132 | 3300048906 | Bacteria | 838 |
| 291 | Ga0496104_0111725 | 3300048907 | Bacteria | 2620 |
| 292 | Ga0496104_0861210 | 3300048907 | Bacteria | 811 |
| 293 | Ga0496105_0029524 | 3300048908 | Bacteria | 4488 |
| 294 | Ga0496105_0216894 | 3300048908 | Bacteria | 1558 |
| 295 | Ga0496105_0388114 | 3300048908 | Bacteria | 1110 |
| 296 | Ga0496107_0064555 | 3300048910 | Bacteria | 2654 |
| 297 | Ga0496107_0126931 | 3300048910 | Bacteria | 1882 |
| 298 | Ga0496113_0057504 | 3300048916 | Bacteria | 2923 |
| 299 | Ga0496114_0099333 | 3300048917 | Bacteria | 2482 |
| 300 | Ga0496115_0011036 | 3300048918 | Bacteria | 6766 |
| 301 | Ga0496116_0162477 | 3300048919 | Bacteria | 1223 |
| 302 | Ga0496117_0000620 | 3300048920 | Bacteria | 57459 |
| 303 | Ga0496117_0006271 | 3300048920 | Bacteria | 12116 |
| 304 | Ga0496117_0084197 | 3300048920 | Bacteria | 2076 |
| 305 | Ga0496117_0097560 | 3300048920 | Bacteria | 1871 |
| 306 | Ga0496117_0281197 | 3300048920 | Bacteria | 891 |
| 307 | Ga0496118_0027091 | 3300048921 | Bacteria | 4859 |
| 308 | Ga0496118_0045946 | 3300048921 | Bacteria | 3402 |
| 309 | Ga0496118_0055056 | 3300048921 | Bacteria | 3006 |
| 310 | Ga0496118_0101044 | 3300048921 | Bacteria | 1949 |
| 311 | Ga0496119_0000462 | 3300048922 | Bacteria | 55546 |
| 312 | Ga0496119_0001409 | 3300048922 | Bacteria | 29104 |
| 313 | Ga0496119_0060789 | 3300048922 | Bacteria | 2260 |
| 314 | Ga0496119_0080595 | 3300048922 | Bacteria | 1877 |
| 315 | Ga0496119_0245520 | 3300048922 | Bacteria | 905 |
| 316 | Ga0496119_0412158 | 3300048922 | Bacteria | 643 |
| 317 | Ga0496120_0000882 | 3300048923 | Bacteria | 42252 |
| 318 | Ga0496120_0156719 | 3300048923 | Bacteria | 1139 |
| 319 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 320 | Ga0496121_0104638 | 3300048924 | Bacteria | 2174 |
| 321 | Ga0496121_0165411 | 3300048924 | Bacteria | 1613 |
| 322 | Ga0496122_0002058 | 3300048925 | Bacteria | 29852 |
| 323 | Ga0496122_0005357 | 3300048925 | Bacteria | 15325 |
| 324 | Ga0496122_0336890 | 3300048925 | Bacteria | 794 |
| 325 | Ga0496122_0508200 | 3300048925 | Bacteria | 584 |
| 326 | Ga0496123_0003992 | 3300048926 | Bacteria | 15973 |
| 327 | Ga0496123_0025110 | 3300048926 | Bacteria | 4502 |
| 328 | Ga0496125_0274580 | 3300048928 | Bacteria | 1048 |
| 329 | Ga0496125_0505720 | 3300048928 | Bacteria | 679 |
| 330 | Ga0496126_0005351 | 3300048929 | Bacteria | 14670 |
| 331 | Ga0496126_0082034 | 3300048929 | Bacteria | 2850 |
| 332 | Ga0496126_0110196 | 3300048929 | Bacteria | 2398 |
| 333 | Ga0496126_0158735 | 3300048929 | Bacteria | 1934 |
| 334 | Ga0496126_0163323 | 3300048929 | Bacteria | 1902 |
| 335 | Ga0496126_0547391 | 3300048929 | Bacteria | 919 |
| 336 | Ga0496126_1062025 | 3300048929 | Bacteria | 604 |
| 337 | Ga0501031_0016602 | 3300049568 | Bacteria | 4780 |
| 338 | Ga0501031_0093172 | 3300049568 | Bacteria | 1966 |
| 339 | Ga0501031_0104937 | 3300049568 | Bacteria | 1844 |
| 340 | Ga0501031_0363057 | 3300049568 | Bacteria | 937 |
| 341 | Ga0501032_0014588 | 3300049569 | Bacteria | 5566 |
| 342 | Ga0501032_0027787 | 3300049569 | Bacteria | 3887 |
| 343 | Ga0501032_0031313 | 3300049569 | Bacteria | 3647 |
| 344 | Ga0501032_0043987 | 3300049569 | Bacteria | 3023 |
| 345 | Ga0501032_0062436 | 3300049569 | Bacteria | 2497 |
| 346 | Ga0501032_0709216 | 3300049569 | Bacteria | 637 |
| 347 | Ga0501033_0002059 | 3300049570 | Bacteria | 17483 |
| 348 | Ga0501033_0011913 | 3300049570 | Bacteria | 6643 |
| 349 | Ga0501033_0038554 | 3300049570 | Bacteria | 3572 |
| 350 | Ga0501033_0157154 | 3300049570 | Bacteria | 1638 |
| 351 | Ga0501033_0924037 | 3300049570 | Bacteria | 586 |
| 352 | Ga0501034_0023864 | 3300049571 | Bacteria | 6227 |
| 353 | Ga0501034_0041781 | 3300049571 | Bacteria | 4639 |
| 354 | Ga0501034_0053217 | 3300049571 | Bacteria | 4078 |
| 355 | Ga0501034_0053994 | 3300049571 | Bacteria | 4045 |
| 356 | Ga0501034_0094477 | 3300049571 | Bacteria | 2986 |
| 357 | Ga0501034_0180235 | 3300049571 | Bacteria | 2077 |
| 358 | Ga0501034_0220423 | 3300049571 | Bacteria | 1849 |
| 359 | Ga0501034_0265502 | 3300049571 | Bacteria | 1658 |
| 360 | Ga0501034_0271026 | 3300049571 | Bacteria | 1638 |
| 361 | Ga0501034_0623536 | 3300049571 | Bacteria | 982 |
| 362 | Ga0501036_0002187 | 3300049572 | Bacteria | 15263 |
| 363 | Ga0501036_0003312 | 3300049572 | Bacteria | 12859 |
| 364 | Ga0501036_0078757 | 3300049572 | Bacteria | 2787 |
| 365 | Ga0501036_0390429 | 3300049572 | Bacteria | 1161 |
| 366 | Ga0501036_0627239 | 3300049572 | Bacteria | 891 |
| 367 | Ga0501036_0635583 | 3300049572 | Bacteria | 884 |
| 368 | Ga0501037_0010008 | 3300049573 | Bacteria | 6956 |
| 369 | Ga0501037_0017808 | 3300049573 | Bacteria | 5230 |
| 370 | Ga0501037_0018671 | 3300049573 | Bacteria | 5111 |
| 371 | Ga0501037_0075266 | 3300049573 | Bacteria | 2452 |
| 372 | Ga0501037_0108605 | 3300049573 | Bacteria | 1999 |
| 373 | Ga0501037_0599318 | 3300049573 | Bacteria | 740 |
| 374 | Ga0501037_0788145 | 3300049573 | Bacteria | 628 |
| 375 | Ga0501038_0019458 | 3300049574 | Bacteria | 6119 |
| 376 | Ga0501038_0029954 | 3300049574 | Bacteria | 4818 |
| 377 | Ga0501038_0041434 | 3300049574 | Bacteria | 4016 |
| 378 | Ga0501038_0077019 | 3300049574 | Bacteria | 2816 |
| 379 | Ga0501038_0236738 | 3300049574 | Bacteria | 1451 |
| 380 | Ga0501039_0009905 | 3300049575 | Bacteria | 7266 |
| 381 | Ga0501039_0148724 | 3300049575 | Bacteria | 1840 |
| 382 | Ga0501039_0647307 | 3300049575 | Bacteria | 827 |
| 383 | Ga0501040_0028238 | 3300049576 | Bacteria | 3781 |
| 384 | Ga0501040_0781166 | 3300049576 | Bacteria | 691 |
| 385 | Ga0501041_0026756 | 3300049577 | Bacteria | 3472 |
| 386 | Ga0501041_0620550 | 3300049577 | Bacteria | 690 |
| 387 | Ga0501042_0000189 | 3300049578 | Bacteria | 28855 |
| 388 | Ga0501042_0122980 | 3300049578 | Bacteria | 1868 |
| 389 | Ga0501043_0002868 | 3300049579 | Bacteria | 14395 |
| 390 | Ga0501043_0072950 | 3300049579 | Bacteria | 2696 |
| 391 | Ga0501043_0144179 | 3300049579 | Bacteria | 1865 |
| 392 | Ga0501043_0171583 | 3300049579 | Bacteria | 1692 |
| 393 | Ga0501043_0408749 | 3300049579 | Bacteria | 1025 |
| 394 | Ga0501046_0004032 | 3300049580 | Bacteria | 13399 |
| 395 | Ga0501046_0073716 | 3300049580 | Bacteria | 2649 |
| 396 | Ga0501046_0099169 | 3300049580 | Bacteria | 2236 |
| 397 | Ga0501046_0188775 | 3300049580 | Bacteria | 1538 |
| 398 | Ga0501047_0041524 | 3300049581 | Bacteria | 4444 |
| 399 | Ga0501047_0061647 | 3300049581 | Bacteria | 3618 |
| 400 | Ga0501047_0066995 | 3300049581 | Bacteria | 3460 |
| 401 | Ga0501047_0147272 | 3300049581 | Bacteria | 2231 |
| 402 | Ga0501047_0293176 | 3300049581 | Bacteria | 1470 |
| 403 | Ga0501048_0003937 | 3300049582 | Bacteria | 11286 |
| 404 | Ga0501048_0027985 | 3300049582 | Bacteria | 4094 |
| 405 | Ga0501048_0502253 | 3300049582 | Bacteria | 869 |
| 406 | Ga0501048_0564727 | 3300049582 | Bacteria | 817 |
| 407 | Ga0501067_0363822 | 3300049583 | Bacteria | 806 |
| 408 | Ga0501068_0442830 | 3300049584 | Bacteria | 840 |
| 409 | Ga0501069_0010568 | 3300049585 | Bacteria | 4890 |
| 410 | Ga0501069_0100167 | 3300049585 | Bacteria | 1644 |
| 411 | Ga0501070_0000133 | 3300049586 | Bacteria | 67036 |
| 412 | Ga0501070_0001501 | 3300049586 | Bacteria | 20837 |
| 413 | Ga0501070_0021716 | 3300049586 | Bacteria | 5382 |
| 414 | Ga0501070_0055855 | 3300049586 | Bacteria | 3273 |
| 415 | Ga0501070_0134749 | 3300049586 | Bacteria | 2039 |
| 416 | Ga0501070_0141798 | 3300049586 | Bacteria | 1984 |
| 417 | Ga0501070_0895194 | 3300049586 | Bacteria | 693 |
| 418 | Ga0501071_0000105 | 3300049587 | Bacteria | 32519 |
| 419 | Ga0501071_0001973 | 3300049587 | Bacteria | 12253 |
| 420 | Ga0501071_0255113 | 3300049587 | Bacteria | 1324 |
| 421 | Ga0501071_0368364 | 3300049587 | Bacteria | 1095 |
| 422 | Ga0501071_1144071 | 3300049587 | Bacteria | 601 |
| 423 | Ga0501072_0160424 | 3300049588 | Bacteria | 1794 |
| 424 | Ga0501072_0692834 | 3300049588 | Bacteria | 801 |
| 425 | Ga0501073_0000028 | 3300049589 | Bacteria | 118187 |
| 426 | Ga0501073_0051043 | 3300049589 | Bacteria | 2897 |
| 427 | Ga0501073_0100396 | 3300049589 | Bacteria | 2009 |
| 428 | Ga0501073_0131765 | 3300049589 | Bacteria | 1733 |
| 429 | Ga0501073_0747485 | 3300049589 | Bacteria | 674 |
| 430 | Ga0501074_0024221 | 3300049590 | Bacteria | 4411 |
| 431 | Ga0501075_0007696 | 3300049591 | Bacteria | 7480 |
| 432 | Ga0501076_0003620 | 3300049592 | Bacteria | 10848 |
| 433 | Ga0501076_1044927 | 3300049592 | Bacteria | 673 |
| 434 | Ga0501077_0129708 | 3300049593 | Bacteria | 1598 |
| 435 | Ga0501079_0013151 | 3300049741 | Bacteria | 6308 |
| 436 | Ga0501079_0490145 | 3300049741 | Bacteria | 966 |
| 437 | Ga0501079_1089376 | 3300049741 | Bacteria | 629 |
| 438 | Ga0501080_0000152 | 3300049742 | Bacteria | 49340 |
| 439 | Ga0501080_0018954 | 3300049742 | Bacteria | 6375 |
| 440 | Ga0501080_0084253 | 3300049742 | Bacteria | 2953 |
| 441 | Ga0501083_0121717 | 3300049744 | Bacteria | 1711 |
| 442 | Ga0501083_0316019 | 3300049744 | Bacteria | 1016 |
| 443 | Ga0501035_0000582 | 3300049822 | Bacteria | 40291 |
| 444 | Ga0501035_0058013 | 3300049822 | Bacteria | 3450 |
| 445 | Ga0501035_0094245 | 3300049822 | Bacteria | 2633 |
| 446 | Ga0501044_0009817 | 3300049823 | Bacteria | 10408 |
| 447 | Ga0501044_0235304 | 3300049823 | Bacteria | 1778 |
| 448 | Ga0501044_0285470 | 3300049823 | Bacteria | 1583 |
| 449 | Ga0501044_0301638 | 3300049823 | Bacteria | 1530 |
| 450 | Ga0501044_0442898 | 3300049823 | Bacteria | 1206 |
| 451 | Ga0501044_0750410 | 3300049823 | Bacteria | 858 |
| 452 | Ga0501045_0009089 | 3300049824 | Bacteria | 6943 |
| 453 | nmdc:mga00v17_11932_c1 | 3300050491 | Bacteria | 4784 |
| 454 | nmdc:mga00v17_241180_c1 | 3300050491 | Bacteria | 1172 |
| 455 | nmdc:mga00v17_353343_c1 | 3300050491 | Bacteria | 955 |
| 456 | nmdc:mga00v17_358526_c1 | 3300050491 | Bacteria | 948 |
| 457 | nmdc:mga0yw44_4594_c1 | 3300050492 | Bacteria | 6365 |
| 458 | nmdc:mga0yw44_497739_c1 | 3300050492 | Bacteria | 827 |
| 459 | nmdc:mga0sz30_189161_c1 | 3300050516 | Bacteria | 914 |
| 460 | nmdc:mga0sz30_314406_c1 | 3300050516 | Bacteria | 699 |
| 461 | nmdc:mga0sz30_3315_c2 | 3300050516 | Bacteria | 1119 |
| 462 | Ga0495601_0080048 | 3300053077 | Bacteria | 2096 |
| 463 | Ga0500610_0402460 | 3300053079 | Bacteria | 556 |
| 464 | Ga0500635_0000023 | 3300053080 | Bacteria | 108024 |
| 465 | Ga0500635_0009463 | 3300053080 | Bacteria | 2705 |
| 466 | Ga0495619_0106380 | 3300053085 | Bacteria | 1913 |
| 467 | Ga0500643_000913 | 3300053087 | Bacteria | 18624 |
| 468 | Ga0500651_0000170 | 3300053093 | Bacteria | 42448 |
| 469 | Ga0500650_0039463 | 3300053098 | Bacteria | 2176 |
| 470 | Ga0500554_040596 | 3300053102 | Bacteria | 1426 |
| 471 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 472 | Ga0500556_0000064 | 3300053104 | Bacteria | 109213 |
| 473 | Ga0500562_000411 | 3300053108 | Bacteria | 10396 |
| 474 | Ga0500593_000556 | 3300053117 | Bacteria | 14451 |
| 475 | Ga0500621_155032 | 3300053126 | Bacteria | 855 |
| 476 | Ga0500652_200759 | 3300053131 | Bacteria | 809 |
| 477 | Ga0500655_001460 | 3300053133 | Bacteria | 4484 |
| 478 | Ga0500559_0000043 | 3300053136 | Bacteria | 100617 |
| 479 | Ga0500559_0000281 | 3300053136 | Bacteria | 39297 |
| 480 | Ga0500559_0000373 | 3300053136 | Bacteria | 33009 |
| 481 | Ga0500559_0005479 | 3300053136 | Bacteria | 5835 |
| 482 | Ga0500559_0058088 | 3300053136 | Bacteria | 1720 |
| 483 | Ga0500559_0072502 | 3300053136 | Bacteria | 1552 |
| 484 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 485 | Ga0500568_0000028 | 3300053139 | Bacteria | 161589 |
| 486 | Ga0500568_0003633 | 3300053139 | Bacteria | 8503 |
| 487 | Ga0500568_0004245 | 3300053139 | Bacteria | 7702 |
| 488 | Ga0500568_0010277 | 3300053139 | Bacteria | 4392 |
| 489 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 490 | Ga0500573_0000487 | 3300053140 | Bacteria | 17122 |
| 491 | Ga0500573_0008949 | 3300053140 | Bacteria | 5533 |
| 492 | Ga0500573_0015167 | 3300053140 | Bacteria | 4366 |
| 493 | Ga0500573_0018519 | 3300053140 | Bacteria | 3970 |
| 494 | Ga0500573_0026061 | 3300053140 | Bacteria | 3361 |
| 495 | Ga0500573_0033706 | 3300053140 | Bacteria | 2954 |
| 496 | Ga0500573_0066004 | 3300053140 | Bacteria | 2069 |
| 497 | Ga0500573_0126716 | 3300053140 | Bacteria | 1417 |
| 498 | Ga0500573_0129840 | 3300053140 | Bacteria | 1396 |
| 499 | Ga0500573_0155243 | 3300053140 | Bacteria | 1250 |
| 500 | Ga0500573_0215662 | 3300053140 | Bacteria | 1010 |
| 501 | Ga0500573_0459321 | 3300053140 | Bacteria | 586 |
| 502 | Ga0500577_0010400 | 3300053142 | Bacteria | 2738 |
| 503 | Ga0500577_0039727 | 3300053142 | Bacteria | 1707 |
| 504 | Ga0500590_024944 | 3300053148 | Bacteria | 3105 |
| 505 | Ga0500616_0000864 | 3300053153 | Bacteria | 33621 |
| 506 | Ga0500616_0001099 | 3300053153 | Bacteria | 28063 |
| 507 | Ga0500616_0086989 | 3300053153 | Bacteria | 1557 |
| 508 | Ga0500620_000292 | 3300053155 | Bacteria | 9632 |
| 509 | Ga0500645_083275 | 3300053730 | Bacteria | 912 |
| 510 | Ga0501084_0042282 | 3300054114 | Bacteria | 3812 |
| 511 | Ga0501082_0044414 | 3300060353 | Bacteria | 3833 |
| 512 | Ga0501082_0315077 | 3300060353 | Bacteria | 1363 |
| 513 | Ga0501082_0831150 | 3300060353 | Bacteria | 808 |
| 514 | Ga0466962_0135722 | 3300061719 | Bacteria | 1190 |
| 515 | Ga0466962_0233998 | 3300061719 | Bacteria | 901 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100798387 | Ga0207675_1007983871 | 128 |
| 2 | 3300041451 | Ga0451791_0294488 | Ga0451791_0294488_1874_2362 | 143 |
| 3 | 3300041452 | Ga0451793_1709792 | Ga0451793_1709792_738_1226 | 143 |
| 4 | 3300041453 | Ga0451797_1381397 | Ga0451797_1381397_577_1065 | 143 |
| 5 | 3300041498 | Ga0451841_0025360 | Ga0451841_0025360_218_706 | 143 |
| 6 | 3300041511 | Ga0451855_1722690 | Ga0451855_1722690_789_1277 | 143 |
| 7 | 3300041512 | Ga0451853_2133845 | Ga0451853_2133845_278_766 | 143 |
| 8 | 3300049568 | Ga0501031_0016602 | Ga0501031_0016602_2339_2794 | 143 |
| 9 | 3300049572 | Ga0501036_0003312 | Ga0501036_0003312_5347_5802 | 143 |
| 10 | 3300049573 | Ga0501037_0010008 | Ga0501037_0010008_4518_4973 | 143 |
| 11 | 3300049574 | Ga0501038_0041434 | Ga0501038_0041434_3022_3477 | 143 |
| 12 | 3300049575 | Ga0501039_0009905 | Ga0501039_0009905_4741_5196 | 143 |
| 13 | 3300049576 | Ga0501040_0028238 | Ga0501040_0028238_1895_2350 | 143 |
| 14 | 3300049577 | Ga0501041_0026756 | Ga0501041_0026756_345_800 | 143 |
| 15 | 3300049578 | Ga0501042_0000189 | Ga0501042_0000189_4898_5353 | 143 |
| 16 | 3300049582 | Ga0501048_0027985 | Ga0501048_0027985_2955_3410 | 143 |
| 17 | 3300049586 | Ga0501070_0021716 | Ga0501070_0021716_959_1414 | 143 |
| 18 | 3300049587 | Ga0501071_0001973 | Ga0501071_0001973_7454_7909 | 143 |
| 19 | 3300049589 | Ga0501073_0131765 | Ga0501073_0131765_321_776 | 143 |
| 20 | 3300049590 | Ga0501074_0024221 | Ga0501074_0024221_2371_2826 | 143 |
| 21 | 3300049591 | Ga0501075_0007696 | Ga0501075_0007696_2172_2627 | 143 |
| 22 | 3300049593 | Ga0501077_0129708 | Ga0501077_0129708_794_1249 | 143 |
| 23 | 3300049741 | Ga0501079_0013151 | Ga0501079_0013151_1320_1775 | 143 |
| 24 | 3300049742 | Ga0501080_0018954 | Ga0501080_0018954_1419_1874 | 143 |
| 25 | 3300049822 | Ga0501035_0094245 | Ga0501035_0094245_56_511 | 143 |
| 26 | 3300049824 | Ga0501045_0009089 | Ga0501045_0009089_3196_3651 | 143 |
| 27 | 3300054114 | Ga0501084_0042282 | Ga0501084_0042282_3212_3667 | 143 |
| 28 | 3300060353 | Ga0501082_0044414 | Ga0501082_0044414_947_1402 | 143 |
| 29 | 3300042438 | Ga0439459_0206899 | Ga0439459_0206899_22_471 | 147 |
| 30 | 3300044765 | Ga0466970_0425268 | Ga0466970_0425268_10_465 | 147 |
| 31 | 3300050491 | nmdc:mga00v17_11932_c1 | nmdc:mga00v17_11932_c1_1126_1575 | 147 |
| 32 | 3300048926 | Ga0496123_0025110 | Ga0496123_0025110_72_560 | 151 |
| 33 | 3300005367 | Ga0070667_100129848 | Ga0070667_1001298482 | 154 |
| 34 | 3300005563 | Ga0068855_100098007 | Ga0068855_1000980074 | 154 |
| 35 | 3300005614 | Ga0068856_100032649 | Ga0068856_1000326493 | 154 |
| 36 | 3300005617 | Ga0068859_100324331 | Ga0068859_1003243312 | 154 |
| 37 | 3300005841 | Ga0068863_100216423 | Ga0068863_1002164231 | 154 |
| 38 | 3300005842 | Ga0068858_100001161 | Ga0068858_10000116110 | 154 |
| 39 | 3300006173 | Ga0070716_100627468 | Ga0070716_1006274682 | 154 |
| 40 | 3300006931 | Ga0097620_100324363 | Ga0097620_1003243632 | 154 |
| 41 | 3300025909 | Ga0207705_10042798 | Ga0207705_100427983 | 154 |
| 42 | 3300025919 | Ga0207657_10013598 | Ga0207657_1001359810 | 154 |
| 43 | 3300025920 | Ga0207649_10382338 | Ga0207649_103823382 | 154 |
| 44 | 3300025927 | Ga0207687_10017562 | Ga0207687_100175622 | 154 |
| 45 | 3300025949 | Ga0207667_10000384 | Ga0207667_1000038422 | 154 |
| 46 | 3300025949 | Ga0207667_10175212 | Ga0207667_101752122 | 154 |
| 47 | 3300025981 | Ga0207640_10040713 | Ga0207640_100407134 | 154 |
| 48 | 3300025986 | Ga0207658_10846635 | Ga0207658_108466351 | 154 |
| 49 | 3300026035 | Ga0207703_10000982 | Ga0207703_1000098221 | 154 |
| 50 | 3300026078 | Ga0207702_10411178 | Ga0207702_104111782 | 154 |
| 51 | 3300041509 | Ga0451843_0143344 | Ga0451843_0143344_680_1165 | 154 |
| 52 | 3300005437 | Ga0070710_10025336 | Ga0070710_100253362 | 155 |
| 53 | 3300025898 | Ga0207692_10280390 | Ga0207692_102803902 | 155 |
| 54 | 3300046529 | Ga0495652_0211376 | Ga0495652_0211376_720_1229 | 155 |
| 55 | 3300049579 | Ga0501043_0408749 | Ga0501043_0408749_54_545 | 155 |
| 56 | 3300049580 | Ga0501046_0073716 | Ga0501046_0073716_1772_2263 | 155 |
| 57 | 3300049592 | Ga0501076_0003620 | Ga0501076_0003620_5027_5518 | 155 |
| 58 | 3300049741 | Ga0501079_0490145 | Ga0501079_0490145_405_887 | 155 |
| 59 | 3300049823 | Ga0501044_0235304 | Ga0501044_0235304_1210_1701 | 155 |
| 60 | 3300053077 | Ga0495601_0080048 | Ga0495601_0080048_254_763 | 155 |
| 61 | 3300053085 | Ga0495619_0106380 | Ga0495619_0106380_1265_1774 | 155 |
| 62 | 3300005327 | Ga0070658_10397069 | Ga0070658_103970692 | 156 |
| 63 | 3300047315 | Ga0495581_0310308 | Ga0495581_0310308_148_660 | 156 |
| 64 | iso_pu_bacteria | 2585428094 | 2587863267 | 156 |
| 65 | iso_pu_bacteria | 2643221549 | 2643768038 | 156 |
| 66 | iso_pu_bacteria | 2643221572 | 2643875624 | 156 |
| 67 | iso_pu_bacteria | 2643221616 | 2644095707 | 156 |
| 68 | iso_pu_bacteria | 2643221619 | 2644111425 | 156 |
| 69 | iso_pu_bacteria | 2643221632 | 2644183023 | 156 |
| 70 | iso_pu_bacteria | 2643221635 | 2644198730 | 156 |
| 71 | iso_pu_bacteria | 2643221649 | 2644277147 | 156 |
| 72 | iso_pu_bacteria | 2643221669 | 2644382679 | 156 |
| 73 | iso_pu_bacteria | 2721755702 | 2723641735 | 156 |
| 74 | iso_pu_bacteria | 2808606372 | 2808901727 | 156 |
| 75 | iso_pu_bacteria | 2844841374 | 2844842090 | 156 |
| 76 | iso_pu_bacteria | 2852643534 | 2852646049 | 156 |
| 77 | iso_pu_bacteria | 2852677369 | 2852680106 | 156 |
| 78 | iso_pu_bacteria | 2857729791 | 2857730173 | 156 |
| 79 | iso_pu_bacteria | 2857733635 | 2857734007 | 156 |
| 80 | iso_pu_bacteria | 2857737099 | 2857739766 | 156 |
| 81 | iso_pu_bacteria | 2862993130 | 2862995010 | 156 |
| 82 | iso_pu_bacteria | 2870622029 | 2870624301 | 156 |
| 83 | iso_pu_bacteria | 2884763398 | 2884765079 | 156 |
| 84 | iso_pu_bacteria | 2895660088 | 2895661682 | 156 |
| 85 | iso_pu_bacteria | 2919055335 | 2919057730 | 156 |
| 86 | iso_pu_bacteria | 2919443155 | 2919446519 | 156 |
| 87 | iso_pu_bacteria | 2919523602 | 2919524134 | 156 |
| 88 | iso_pu_bacteria | 2928121344 | 2928123396 | 156 |
| 89 | iso_pu_bacteria | 2928153084 | 2928155697 | 156 |
| 90 | iso_pu_bacteria | 2935409751 | 2935411144 | 156 |
| 91 | iso_pu_bacteria | 2939657138 | 2939658783 | 156 |
| 92 | iso_pu_bacteria | 2939660829 | 2939662552 | 156 |
| 93 | iso_pu_bacteria | 2964326757 | 2964327224 | 156 |
| 94 | iso_pu_bacteria | 2966924647 | 2966926313 | 156 |
| 95 | iso_pu_bacteria | 2995726249 | 2995727818 | 156 |
| 96 | iso_pu_bacteria | 8046352972 | 8046353161 | 156 |
| 97 | iso_pu_bacteria | 8055034563 | 8055036212 | 156 |
| 98 | iso_pu_bacteria | 8055037949 | 8055038307 | 156 |
| 99 | iso_pu_bacteria | 8057345674 | 8057348136 | 156 |
| 100 | 3300049586 | Ga0501070_0895194 | Ga0501070_0895194_122_607 | 157 |
| 101 | 3300046660 | Ga0495625_0284502 | Ga0495625_0284502_447_923 | 158 |
| 102 | 3300053140 | Ga0500573_0066004 | Ga0500573_0066004_852_1328 | 158 |
| 103 | 3300005618 | Ga0068864_102329704 | Ga0068864_1023297041 | 159 |
| 104 | 3300006038 | Ga0075365_10402523 | Ga0075365_104025232 | 159 |
| 105 | 3300013306 | Ga0163162_11754651 | Ga0163162_117546512 | 159 |
| 106 | 3300046530 | Ga0495654_0265631 | Ga0495654_0265631_173_655 | 159 |
| 107 | 3300053098 | Ga0500650_0039463 | Ga0500650_0039463_1271_1750 | 159 |
| 108 | 3300053131 | Ga0500652_200759 | Ga0500652_200759_288_773 | 159 |
| 109 | 3300053140 | Ga0500573_0215662 | Ga0500573_0215662_380_862 | 159 |
| 110 | 3300053140 | Ga0500573_0459321 | Ga0500573_0459321_79_564 | 159 |
| 111 | 3300053142 | Ga0500577_0039727 | Ga0500577_0039727_521_1000 | 159 |
| 112 | 3300001979 | JGI24740J21852_10018564 | JGI24740J21852_100185643 | 160 |
| 113 | 3300001989 | JGI24739J22299_10046037 | JGI24739J22299_100460372 | 160 |
| 114 | 3300001990 | JGI24737J22298_10009502 | JGI24737J22298_100095022 | 160 |
| 115 | 3300002067 | JGI24735J21928_10002269 | JGI24735J21928_100022697 | 160 |
| 116 | 3300002772 | JGI25164J39214_1000778 | JGI25164J39214_100077810 | 160 |
| 117 | 3300003214 | JGI25165J46597_1000002 | JGI25165J46597_1000002364 | 160 |
| 118 | 3300003578 | Ga0006562J51391_1061877 | Ga0006562J51391_10618774 | 160 |
| 119 | 3300003752 | Ga0055539_1000111 | Ga0055539_10001115 | 160 |
| 120 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001426 | 160 |
| 121 | 3300003759 | Ga0055525_1000317 | Ga0055525_100031725 | 160 |
| 122 | 3300003760 | Ga0055527_1000012 | Ga0055527_1000012238 | 160 |
| 123 | 3300003762 | Ga0055542_1000017 | Ga0055542_1000017238 | 160 |
| 124 | 3300003763 | Ga0055529_1000023 | Ga0055529_1000023205 | 160 |
| 125 | 3300003841 | Ga0055541_1008364 | Ga0055541_10083643 | 160 |
| 126 | 3300005288 | Ga0065714_10078159 | Ga0065714_100781592 | 160 |
| 127 | 3300005288 | Ga0065714_10214281 | Ga0065714_102142811 | 160 |
| 128 | 3300005288 | Ga0065714_10216972 | Ga0065714_102169721 | 160 |
| 129 | 3300005327 | Ga0070658_10000245 | Ga0070658_1000024510 | 160 |
| 130 | 3300005327 | Ga0070658_10010448 | Ga0070658_100104482 | 160 |
| 131 | 3300005327 | Ga0070658_10039615 | Ga0070658_100396152 | 160 |
| 132 | 3300005337 | Ga0070682_101701465 | Ga0070682_1017014651 | 160 |
| 133 | 3300005338 | Ga0068868_100737982 | Ga0068868_1007379821 | 160 |
| 134 | 3300005339 | Ga0070660_100002036 | Ga0070660_10000203610 | 160 |
| 135 | 3300005354 | Ga0070675_100071846 | Ga0070675_1000718462 | 160 |
| 136 | 3300005365 | Ga0070688_100288751 | Ga0070688_1002887512 | 160 |
| 137 | 3300005366 | Ga0070659_100008194 | Ga0070659_1000081943 | 160 |
| 138 | 3300005367 | Ga0070667_100002813 | Ga0070667_1000028132 | 160 |
| 139 | 3300005437 | Ga0070710_10002030 | Ga0070710_1000203011 | 160 |
| 140 | 3300005455 | Ga0070663_100652484 | Ga0070663_1006524842 | 160 |
| 141 | 3300005455 | Ga0070663_101286662 | Ga0070663_1012866621 | 160 |
| 142 | 3300005466 | Ga0070685_10056644 | Ga0070685_100566441 | 160 |
| 143 | 3300005539 | Ga0068853_100207767 | Ga0068853_1002077673 | 160 |
| 144 | 3300005543 | Ga0070672_100932244 | Ga0070672_1009322442 | 160 |
| 145 | 3300005548 | Ga0070665_101285814 | Ga0070665_1012858141 | 160 |
| 146 | 3300005563 | Ga0068855_100013037 | Ga0068855_10001303710 | 160 |
| 147 | 3300005563 | Ga0068855_100105876 | Ga0068855_1001058762 | 160 |
| 148 | 3300005614 | Ga0068856_100049854 | Ga0068856_1000498542 | 160 |
| 149 | 3300005614 | Ga0068856_100560126 | Ga0068856_1005601262 | 160 |
| 150 | 3300005616 | Ga0068852_100005756 | Ga0068852_1000057568 | 160 |
| 151 | 3300005616 | Ga0068852_100011467 | Ga0068852_1000114672 | 160 |
| 152 | 3300005616 | Ga0068852_100408071 | Ga0068852_1004080712 | 160 |
| 153 | 3300005618 | Ga0068864_100526124 | Ga0068864_1005261242 | 160 |
| 154 | 3300005834 | Ga0068851_10000001 | Ga0068851_10000001428 | 160 |
| 155 | 3300005840 | Ga0068870_10754974 | Ga0068870_107549741 | 160 |
| 156 | 3300005844 | Ga0068862_100164726 | Ga0068862_1001647262 | 160 |
| 157 | 3300006038 | Ga0075365_10311926 | Ga0075365_103119263 | 160 |
| 158 | 3300006038 | Ga0075365_10387525 | Ga0075365_103875252 | 160 |
| 159 | 3300006051 | Ga0075364_10014177 | Ga0075364_100141774 | 160 |
| 160 | 3300006051 | Ga0075364_10294758 | Ga0075364_102947582 | 160 |
| 161 | 3300006051 | Ga0075364_10348097 | Ga0075364_103480972 | 160 |
| 162 | 3300006058 | Ga0075432_10152027 | Ga0075432_101520272 | 160 |
| 163 | 3300006186 | Ga0075369_10064506 | Ga0075369_100645062 | 160 |
| 164 | 3300006186 | Ga0075369_10095075 | Ga0075369_100950752 | 160 |
| 165 | 3300009093 | Ga0105240_10007382 | Ga0105240_100073829 | 160 |
| 166 | 3300009094 | Ga0111539_10721725 | Ga0111539_107217252 | 160 |
| 167 | 3300009098 | Ga0105245_10005854 | Ga0105245_100058549 | 160 |
| 168 | 3300009098 | Ga0105245_10050848 | Ga0105245_100508483 | 160 |
| 169 | 3300009101 | Ga0105247_11614194 | Ga0105247_116141941 | 160 |
| 170 | 3300009174 | Ga0105241_10001149 | Ga0105241_100011493 | 160 |
| 171 | 3300009177 | Ga0105248_10000326 | Ga0105248_1000032624 | 160 |
| 172 | 3300009177 | Ga0105248_10056797 | Ga0105248_100567972 | 160 |
| 173 | 3300009177 | Ga0105248_10544300 | Ga0105248_105443001 | 160 |
| 174 | 3300009545 | Ga0105237_10000341 | Ga0105237_1000034122 | 160 |
| 175 | 3300009545 | Ga0105237_10642474 | Ga0105237_106424743 | 160 |
| 176 | 3300009545 | Ga0105237_11848899 | Ga0105237_118488991 | 160 |
| 177 | 3300009551 | Ga0105238_10030753 | Ga0105238_100307532 | 160 |
| 178 | 3300009553 | Ga0105249_11247153 | Ga0105249_112471532 | 160 |
| 179 | 3300011119 | Ga0105246_10122121 | Ga0105246_101221212 | 160 |
| 180 | 3300011119 | Ga0105246_10242245 | Ga0105246_102422452 | 160 |
| 181 | 3300011119 | Ga0105246_10703476 | Ga0105246_107034761 | 160 |
| 182 | 3300013102 | Ga0157371_10059068 | Ga0157371_100590682 | 160 |
| 183 | 3300013104 | Ga0157370_10006075 | Ga0157370_100060752 | 160 |
| 184 | 3300013105 | Ga0157369_10000573 | Ga0157369_1000057343 | 160 |
| 185 | 3300013105 | Ga0157369_10062997 | Ga0157369_100629972 | 160 |
| 186 | 3300013105 | Ga0157369_10067577 | Ga0157369_100675773 | 160 |
| 187 | 3300013105 | Ga0157369_10079951 | Ga0157369_100799513 | 160 |
| 188 | 3300013105 | Ga0157369_10130247 | Ga0157369_101302472 | 160 |
| 189 | 3300013105 | Ga0157369_10690976 | Ga0157369_106909761 | 160 |
| 190 | 3300013105 | Ga0157369_10695124 | Ga0157369_106951242 | 160 |
| 191 | 3300013105 | Ga0157369_12223077 | Ga0157369_122230771 | 160 |
| 192 | 3300013296 | Ga0157374_10091482 | Ga0157374_100914823 | 160 |
| 193 | 3300013296 | Ga0157374_10308926 | Ga0157374_103089262 | 160 |
| 194 | 3300013296 | Ga0157374_11239791 | Ga0157374_112397912 | 160 |
| 195 | 3300013306 | Ga0163162_10195609 | Ga0163162_101956092 | 160 |
| 196 | 3300013307 | Ga0157372_10032991 | Ga0157372_100329912 | 160 |
| 197 | 3300013307 | Ga0157372_10122694 | Ga0157372_101226943 | 160 |
| 198 | 3300013307 | Ga0157372_10795638 | Ga0157372_107956381 | 160 |
| 199 | 3300013307 | Ga0157372_12838596 | Ga0157372_128385961 | 160 |
| 200 | 3300014325 | Ga0163163_12519584 | Ga0163163_125195841 | 160 |
| 201 | 3300014326 | Ga0157380_10009645 | Ga0157380_100096452 | 160 |
| 202 | 3300014968 | Ga0157379_10028386 | Ga0157379_100283862 | 160 |
| 203 | 3300014969 | Ga0157376_11010598 | Ga0157376_110105982 | 160 |
| 204 | 3300020069 | Ga0197907_10185693 | Ga0197907_101856931 | 160 |
| 205 | 3300020081 | Ga0206354_11348532 | Ga0206354_113485322 | 160 |
| 206 | 3300020082 | Ga0206353_11560231 | Ga0206353_1156023114 | 160 |
| 207 | 3300022467 | Ga0224712_10073010 | Ga0224712_100730102 | 160 |
| 208 | 3300025225 | Ga0209566_100026 | Ga0209566_100026297 | 160 |
| 209 | 3300025226 | Ga0209674_100001 | Ga0209674_100001427 | 160 |
| 210 | 3300025228 | Ga0209672_100003 | Ga0209672_100003108 | 160 |
| 211 | 3300025230 | Ga0209563_100001 | Ga0209563_100001427 | 160 |
| 212 | 3300025230 | Ga0209563_100388 | Ga0209563_10038816 | 160 |
| 213 | 3300025231 | Ga0207427_100034 | Ga0207427_100034292 | 160 |
| 214 | 3300025233 | Ga0209437_101001 | Ga0209437_1010018 | 160 |
| 215 | 3300025242 | Ga0209258_101714 | Ga0209258_1017143 | 160 |
| 216 | 3300025253 | Ga0209677_100001 | Ga0209677_100001427 | 160 |
| 217 | 3300025253 | Ga0209677_105819 | Ga0209677_1058193 | 160 |
| 218 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004403 | 160 |
| 219 | 3300025254 | Ga0209148_1000608 | Ga0209148_100060831 | 160 |
| 220 | 3300025258 | Ga0209129_1027869 | Ga0209129_10278692 | 160 |
| 221 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000012441 | 160 |
| 222 | 3300025272 | Ga0209455_1000022 | Ga0209455_1000022581 | 160 |
| 223 | 3300025272 | Ga0209455_1002188 | Ga0209455_10021885 | 160 |
| 224 | 3300025321 | Ga0207656_10000002 | Ga0207656_10000002501 | 160 |
| 225 | 3300025898 | Ga0207692_10019944 | Ga0207692_100199443 | 160 |
| 226 | 3300025901 | Ga0207688_10205861 | Ga0207688_102058612 | 160 |
| 227 | 3300025904 | Ga0207647_10056822 | Ga0207647_100568221 | 160 |
| 228 | 3300025904 | Ga0207647_10345721 | Ga0207647_103457211 | 160 |
| 229 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011665 | 160 |
| 230 | 3300025909 | Ga0207705_10071930 | Ga0207705_100719301 | 160 |
| 231 | 3300025909 | Ga0207705_10203229 | Ga0207705_102032292 | 160 |
| 232 | 3300025909 | Ga0207705_10569399 | Ga0207705_105693992 | 160 |
| 233 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011361 | 160 |
| 234 | 3300025913 | Ga0207695_10003239 | Ga0207695_1000323911 | 160 |
| 235 | 3300025913 | Ga0207695_10003445 | Ga0207695_1000344511 | 160 |
| 236 | 3300025914 | Ga0207671_10000002 | Ga0207671_10000002795 | 160 |
| 237 | 3300025914 | Ga0207671_10425694 | Ga0207671_104256943 | 160 |
| 238 | 3300025924 | Ga0207694_10000395 | Ga0207694_1000039514 | 160 |
| 239 | 3300025924 | Ga0207694_11192184 | Ga0207694_111921841 | 160 |
| 240 | 3300025926 | Ga0207659_10032770 | Ga0207659_100327702 | 160 |
| 241 | 3300025931 | Ga0207644_10644662 | Ga0207644_106446622 | 160 |
| 242 | 3300025932 | Ga0207690_10000874 | Ga0207690_1000087416 | 160 |
| 243 | 3300025939 | Ga0207665_10901332 | Ga0207665_109013321 | 160 |
| 244 | 3300025940 | Ga0207691_10744063 | Ga0207691_107440631 | 160 |
| 245 | 3300025941 | Ga0207711_10004685 | Ga0207711_1000468511 | 160 |
| 246 | 3300025941 | Ga0207711_10035190 | Ga0207711_100351906 | 160 |
| 247 | 3300025941 | Ga0207711_11505805 | Ga0207711_115058051 | 160 |
| 248 | 3300025949 | Ga0207667_10153455 | Ga0207667_101534553 | 160 |
| 249 | 3300025949 | Ga0207667_10244337 | Ga0207667_102443372 | 160 |
| 250 | 3300025972 | Ga0207668_10008087 | Ga0207668_100080872 | 160 |
| 251 | 3300025986 | Ga0207658_10173795 | Ga0207658_101737952 | 160 |
| 252 | 3300026023 | Ga0207677_10229688 | Ga0207677_102296882 | 160 |
| 253 | 3300026023 | Ga0207677_10232554 | Ga0207677_102325542 | 160 |
| 254 | 3300026041 | Ga0207639_10070713 | Ga0207639_100707132 | 160 |
| 255 | 3300026041 | Ga0207639_10188305 | Ga0207639_101883051 | 160 |
| 256 | 3300026067 | Ga0207678_10132755 | Ga0207678_101327553 | 160 |
| 257 | 3300026067 | Ga0207678_10263191 | Ga0207678_102631912 | 160 |
| 258 | 3300026067 | Ga0207678_10812624 | Ga0207678_108126241 | 160 |
| 259 | 3300026078 | Ga0207702_10114288 | Ga0207702_101142881 | 160 |
| 260 | 3300026078 | Ga0207702_10263157 | Ga0207702_102631572 | 160 |
| 261 | 3300026095 | Ga0207676_10036367 | Ga0207676_100363672 | 160 |
| 262 | 3300026116 | Ga0207674_10589775 | Ga0207674_105897752 | 160 |
| 263 | 3300026142 | Ga0207698_10000372 | Ga0207698_1000037219 | 160 |
| 264 | 3300026142 | Ga0207698_10003382 | Ga0207698_100033827 | 160 |
| 265 | 3300028379 | Ga0268266_10907709 | Ga0268266_109077091 | 160 |
| 266 | 3300028380 | Ga0268265_10140994 | Ga0268265_101409942 | 160 |
| 267 | 3300028380 | Ga0268265_12320578 | Ga0268265_123205781 | 160 |
| 268 | 3300028794 | Ga0307515_10051415 | Ga0307515_100514156 | 160 |
| 269 | 3300028794 | Ga0307515_10100177 | Ga0307515_101001773 | 160 |
| 270 | 3300030521 | Ga0307511_10245362 | Ga0307511_102453622 | 160 |
| 271 | 3300031507 | Ga0307509_10299566 | Ga0307509_102995662 | 160 |
| 272 | 3300031548 | Ga0307408_100212909 | Ga0307408_1002129092 | 160 |
| 273 | 3300031649 | Ga0307514_10016353 | Ga0307514_100163532 | 160 |
| 274 | 3300031649 | Ga0307514_10035564 | Ga0307514_100355642 | 160 |
| 275 | 3300031731 | Ga0307405_10150700 | Ga0307405_101507002 | 160 |
| 276 | 3300031852 | Ga0307410_10166536 | Ga0307410_101665361 | 160 |
| 277 | 3300031852 | Ga0307410_10471563 | Ga0307410_104715632 | 160 |
| 278 | 3300031852 | Ga0307410_10609585 | Ga0307410_106095852 | 160 |
| 279 | 3300031901 | Ga0307406_10047788 | Ga0307406_100477882 | 160 |
| 280 | 3300031901 | Ga0307406_11134624 | Ga0307406_111346241 | 160 |
| 281 | 3300031911 | Ga0307412_10421503 | Ga0307412_104215032 | 160 |
| 282 | 3300031911 | Ga0307412_10672911 | Ga0307412_106729111 | 160 |
| 283 | 3300031911 | Ga0307412_10829929 | Ga0307412_108299291 | 160 |
| 284 | 3300031995 | Ga0307409_100535330 | Ga0307409_1005353302 | 160 |
| 285 | 3300031995 | Ga0307409_101277402 | Ga0307409_1012774021 | 160 |
| 286 | 3300031995 | Ga0307409_102097032 | Ga0307409_1020970321 | 160 |
| 287 | 3300032002 | Ga0307416_100696358 | Ga0307416_1006963582 | 160 |
| 288 | 3300032002 | Ga0307416_100928744 | Ga0307416_1009287442 | 160 |
| 289 | 3300032002 | Ga0307416_102154137 | Ga0307416_1021541371 | 160 |
| 290 | 3300032004 | Ga0307414_10643913 | Ga0307414_106439132 | 160 |
| 291 | 3300032005 | Ga0307411_10373906 | Ga0307411_103739062 | 160 |
| 292 | 3300032005 | Ga0307411_11280731 | Ga0307411_112807311 | 160 |
| 293 | 3300032126 | Ga0307415_100233855 | Ga0307415_1002338551 | 160 |
| 294 | 3300037312 | Ga0395899_0020523 | Ga0395899_0020523_4358_4840 | 160 |
| 295 | 3300037312 | Ga0395899_0080831 | Ga0395899_0080831_1367_1849 | 160 |
| 296 | 3300037418 | Ga0395900_0001562 | Ga0395900_0001562_4248_4730 | 160 |
| 297 | 3300037418 | Ga0395900_0354773 | Ga0395900_0354773_625_1107 | 160 |
| 298 | 3300037466 | Ga0395898_0002083 | Ga0395898_0002083_16734_17216 | 160 |
| 299 | 3300037466 | Ga0395898_0264622 | Ga0395898_0264622_982_1464 | 160 |
| 300 | 3300038443 | Ga0395901_0304743 | Ga0395901_0304743_972_1454 | 160 |
| 301 | 3300041413 | Ga0439465_0095419 | Ga0439465_0095419_170_661 | 160 |
| 302 | 3300041443 | Ga0451789_0809815 | Ga0451789_0809815_73_564 | 160 |
| 303 | 3300041443 | Ga0451789_1302198 | Ga0451789_1302198_70_561 | 160 |
| 304 | 3300041451 | Ga0451791_0085663 | Ga0451791_0085663_136_618 | 160 |
| 305 | 3300041451 | Ga0451791_1133574 | Ga0451791_1133574_381_872 | 160 |
| 306 | 3300041452 | Ga0451793_1534553 | Ga0451793_1534553_568_1056 | 160 |
| 307 | 3300041453 | Ga0451797_1126810 | Ga0451797_1126810_240_722 | 160 |
| 308 | 3300041456 | Ga0451795_0629196 | Ga0451795_0629196_145_633 | 160 |
| 309 | 3300041458 | Ga0451798_1094680 | Ga0451798_1094680_281_769 | 160 |
| 310 | 3300041460 | Ga0451802_1933098 | Ga0451802_1933098_117_605 | 160 |
| 311 | 3300041460 | Ga0451802_2007612 | Ga0451802_2007612_173_661 | 160 |
| 312 | 3300041509 | Ga0451843_0998735 | Ga0451843_0998735_175_663 | 160 |
| 313 | 3300041997 | Ga0439431_0171236 | Ga0439431_0171236_100_591 | 160 |
| 314 | 3300042116 | Ga0450912_017946 | Ga0450912_017946_129_614 | 160 |
| 315 | 3300042156 | Ga0439446_0159049 | Ga0439446_0159049_192_683 | 160 |
| 316 | 3300044658 | Ga0466972_0027508 | Ga0466972_0027508_857_1339 | 160 |
| 317 | 3300044658 | Ga0466972_0028357 | Ga0466972_0028357_1479_1961 | 160 |
| 318 | 3300044658 | Ga0466972_0049075 | Ga0466972_0049075_1403_1885 | 160 |
| 319 | 3300044658 | Ga0466972_0084668 | Ga0466972_0084668_958_1440 | 160 |
| 320 | 3300044683 | Ga0466965_0000016 | Ga0466965_0000016_15204_15689 | 160 |
| 321 | 3300044683 | Ga0466965_0096611 | Ga0466965_0096611_807_1289 | 160 |
| 322 | 3300044684 | Ga0466966_0117863 | Ga0466966_0117863_955_1437 | 160 |
| 323 | 3300044684 | Ga0466966_0204141 | Ga0466966_0204141_345_827 | 160 |
| 324 | 3300044693 | Ga0466961_0078879 | Ga0466961_0078879_1001_1483 | 160 |
| 325 | 3300044693 | Ga0466961_0090006 | Ga0466961_0090006_74_556 | 160 |
| 326 | 3300044693 | Ga0466961_0220761 | Ga0466961_0220761_218_700 | 160 |
| 327 | 3300044693 | Ga0466961_0505571 | Ga0466961_0505571_62_544 | 160 |
| 328 | 3300044706 | Ga0466964_0191676 | Ga0466964_0191676_255_737 | 160 |
| 329 | 3300044719 | Ga0466971_0040044 | Ga0466971_0040044_1153_1635 | 160 |
| 330 | 3300044719 | Ga0466971_0132837 | Ga0466971_0132837_553_1035 | 160 |
| 331 | 3300044735 | Ga0466968_0025044 | Ga0466968_0025044_1833_2315 | 160 |
| 332 | 3300044765 | Ga0466970_0008550 | Ga0466970_0008550_1625_2107 | 160 |
| 333 | 3300044765 | Ga0466970_0034454 | Ga0466970_0034454_1901_2383 | 160 |
| 334 | 3300044765 | Ga0466970_0084779 | Ga0466970_0084779_169_651 | 160 |
| 335 | 3300044842 | Ga0466957_0025480 | Ga0466957_0025480_2388_2870 | 160 |
| 336 | 3300044842 | Ga0466957_0150632 | Ga0466957_0150632_916_1398 | 160 |
| 337 | 3300044842 | Ga0466957_0161044 | Ga0466957_0161044_61_543 | 160 |
| 338 | 3300044901 | Ga0466960_0023062 | Ga0466960_0023062_756_1238 | 160 |
| 339 | 3300044901 | Ga0466960_0101444 | Ga0466960_0101444_175_657 | 160 |
| 340 | 3300044901 | Ga0466960_0128974 | Ga0466960_0128974_143_637 | 160 |
| 341 | 3300045049 | Ga0466959_0005711 | Ga0466959_0005711_40_522 | 160 |
| 342 | 3300045049 | Ga0466959_0036468 | Ga0466959_0036468_637_1119 | 160 |
| 343 | 3300045049 | Ga0466959_0240515 | Ga0466959_0240515_37_519 | 160 |
| 344 | 3300045836 | Ga0466958_0043586 | Ga0466958_0043586_1248_1730 | 160 |
| 345 | 3300045836 | Ga0466958_0406981 | Ga0466958_0406981_321_803 | 160 |
| 346 | 3300045976 | Ga0466967_0894078 | Ga0466967_0894078_352_834 | 160 |
| 347 | 3300046457 | Ga0495590_0000331 | Ga0495590_0000331_17459_17959 | 160 |
| 348 | 3300046460 | Ga0495638_0203731 | Ga0495638_0203731_206_697 | 160 |
| 349 | 3300046471 | Ga0495650_0000989 | Ga0495650_0000989_29879_30367 | 160 |
| 350 | 3300046648 | Ga0495611_0357069 | Ga0495611_0357069_139_630 | 160 |
| 351 | 3300047320 | Ga0495672_0010044 | Ga0495672_0010044_2155_2643 | 160 |
| 352 | 3300047320 | Ga0495672_0020872 | Ga0495672_0020872_1615_2130 | 160 |
| 353 | 3300047472 | Ga0495686_0231894 | Ga0495686_0231894_446_937 | 160 |
| 354 | 3300048903 | Ga0496100_0163134 | Ga0496100_0163134_628_1110 | 160 |
| 355 | 3300048904 | Ga0496101_0046669 | Ga0496101_0046669_600_1082 | 160 |
| 356 | 3300048904 | Ga0496101_0358455 | Ga0496101_0358455_411_893 | 160 |
| 357 | 3300048905 | Ga0496102_0100558 | Ga0496102_0100558_1806_2288 | 160 |
| 358 | 3300048905 | Ga0496102_0300740 | Ga0496102_0300740_561_1052 | 160 |
| 359 | 3300048905 | Ga0496102_0315529 | Ga0496102_0315529_923_1405 | 160 |
| 360 | 3300048905 | Ga0496102_0410431 | Ga0496102_0410431_59_541 | 160 |
| 361 | 3300048905 | Ga0496102_0812866 | Ga0496102_0812866_232_732 | 160 |
| 362 | 3300048906 | Ga0496103_0208076 | Ga0496103_0208076_523_1005 | 160 |
| 363 | 3300048906 | Ga0496103_0438132 | Ga0496103_0438132_118_609 | 160 |
| 364 | 3300048907 | Ga0496104_0111725 | Ga0496104_0111725_2110_2592 | 160 |
| 365 | 3300048907 | Ga0496104_0861210 | Ga0496104_0861210_119_601 | 160 |
| 366 | 3300048908 | Ga0496105_0029524 | Ga0496105_0029524_1554_2036 | 160 |
| 367 | 3300048908 | Ga0496105_0216894 | Ga0496105_0216894_277_759 | 160 |
| 368 | 3300048908 | Ga0496105_0388114 | Ga0496105_0388114_491_973 | 160 |
| 369 | 3300048910 | Ga0496107_0064555 | Ga0496107_0064555_564_1046 | 160 |
| 370 | 3300048910 | Ga0496107_0126931 | Ga0496107_0126931_1169_1651 | 160 |
| 371 | 3300048916 | Ga0496113_0057504 | Ga0496113_0057504_989_1480 | 160 |
| 372 | 3300048917 | Ga0496114_0099333 | Ga0496114_0099333_1225_1707 | 160 |
| 373 | 3300048918 | Ga0496115_0011036 | Ga0496115_0011036_2524_3006 | 160 |
| 374 | 3300048919 | Ga0496116_0162477 | Ga0496116_0162477_689_1171 | 160 |
| 375 | 3300048920 | Ga0496117_0000620 | Ga0496117_0000620_12178_12669 | 160 |
| 376 | 3300048920 | Ga0496117_0006271 | Ga0496117_0006271_5539_6021 | 160 |
| 377 | 3300048920 | Ga0496117_0084197 | Ga0496117_0084197_723_1211 | 160 |
| 378 | 3300048920 | Ga0496117_0097560 | Ga0496117_0097560_1271_1753 | 160 |
| 379 | 3300048920 | Ga0496117_0281197 | Ga0496117_0281197_317_799 | 160 |
| 380 | 3300048921 | Ga0496118_0027091 | Ga0496118_0027091_1991_2473 | 160 |
| 381 | 3300048921 | Ga0496118_0045946 | Ga0496118_0045946_2289_2777 | 160 |
| 382 | 3300048921 | Ga0496118_0055056 | Ga0496118_0055056_1569_2051 | 160 |
| 383 | 3300048921 | Ga0496118_0101044 | Ga0496118_0101044_364_846 | 160 |
| 384 | 3300048922 | Ga0496119_0000462 | Ga0496119_0000462_17598_18086 | 160 |
| 385 | 3300048922 | Ga0496119_0001409 | Ga0496119_0001409_21525_22013 | 160 |
| 386 | 3300048922 | Ga0496119_0060789 | Ga0496119_0060789_341_823 | 160 |
| 387 | 3300048922 | Ga0496119_0080595 | Ga0496119_0080595_1329_1817 | 160 |
| 388 | 3300048922 | Ga0496119_0245520 | Ga0496119_0245520_221_715 | 160 |
| 389 | 3300048922 | Ga0496119_0412158 | Ga0496119_0412158_41_529 | 160 |
| 390 | 3300048923 | Ga0496120_0000882 | Ga0496120_0000882_27053_27541 | 160 |
| 391 | 3300048923 | Ga0496120_0156719 | Ga0496120_0156719_95_577 | 160 |
| 392 | 3300048924 | Ga0496121_0000025 | Ga0496121_0000025_37487_37975 | 160 |
| 393 | 3300048924 | Ga0496121_0104638 | Ga0496121_0104638_1224_1712 | 160 |
| 394 | 3300048924 | Ga0496121_0165411 | Ga0496121_0165411_1011_1499 | 160 |
| 395 | 3300048925 | Ga0496122_0002058 | Ga0496122_0002058_18224_18724 | 160 |
| 396 | 3300048925 | Ga0496122_0005357 | Ga0496122_0005357_11486_11977 | 160 |
| 397 | 3300048925 | Ga0496122_0336890 | Ga0496122_0336890_288_770 | 160 |
| 398 | 3300048925 | Ga0496122_0508200 | Ga0496122_0508200_83_571 | 160 |
| 399 | 3300048926 | Ga0496123_0003992 | Ga0496123_0003992_1520_2020 | 160 |
| 400 | 3300048928 | Ga0496125_0274580 | Ga0496125_0274580_281_772 | 160 |
| 401 | 3300048928 | Ga0496125_0505720 | Ga0496125_0505720_172_660 | 160 |
| 402 | 3300048929 | Ga0496126_0005351 | Ga0496126_0005351_471_953 | 160 |
| 403 | 3300048929 | Ga0496126_0082034 | Ga0496126_0082034_2229_2717 | 160 |
| 404 | 3300048929 | Ga0496126_0110196 | Ga0496126_0110196_1085_1567 | 160 |
| 405 | 3300048929 | Ga0496126_0158735 | Ga0496126_0158735_1349_1834 | 160 |
| 406 | 3300048929 | Ga0496126_0163323 | Ga0496126_0163323_1245_1727 | 160 |
| 407 | 3300048929 | Ga0496126_0547391 | Ga0496126_0547391_20_508 | 160 |
| 408 | 3300048929 | Ga0496126_1062025 | Ga0496126_1062025_22_516 | 160 |
| 409 | 3300049568 | Ga0501031_0093172 | Ga0501031_0093172_526_1014 | 160 |
| 410 | 3300049568 | Ga0501031_0104937 | Ga0501031_0104937_856_1341 | 160 |
| 411 | 3300049568 | Ga0501031_0363057 | Ga0501031_0363057_400_885 | 160 |
| 412 | 3300049569 | Ga0501032_0014588 | Ga0501032_0014588_3837_4322 | 160 |
| 413 | 3300049569 | Ga0501032_0027787 | Ga0501032_0027787_2013_2495 | 160 |
| 414 | 3300049569 | Ga0501032_0031313 | Ga0501032_0031313_209_694 | 160 |
| 415 | 3300049569 | Ga0501032_0043987 | Ga0501032_0043987_1762_2250 | 160 |
| 416 | 3300049569 | Ga0501032_0062436 | Ga0501032_0062436_319_804 | 160 |
| 417 | 3300049569 | Ga0501032_0709216 | Ga0501032_0709216_49_534 | 160 |
| 418 | 3300049570 | Ga0501033_0002059 | Ga0501033_0002059_13204_13686 | 160 |
| 419 | 3300049570 | Ga0501033_0011913 | Ga0501033_0011913_5676_6158 | 160 |
| 420 | 3300049570 | Ga0501033_0038554 | Ga0501033_0038554_944_1429 | 160 |
| 421 | 3300049570 | Ga0501033_0157154 | Ga0501033_0157154_861_1349 | 160 |
| 422 | 3300049570 | Ga0501033_0924037 | Ga0501033_0924037_19_501 | 160 |
| 423 | 3300049571 | Ga0501034_0023864 | Ga0501034_0023864_4381_4920 | 160 |
| 424 | 3300049571 | Ga0501034_0041781 | Ga0501034_0041781_248_730 | 160 |
| 425 | 3300049571 | Ga0501034_0053217 | Ga0501034_0053217_3117_3599 | 160 |
| 426 | 3300049571 | Ga0501034_0053994 | Ga0501034_0053994_1009_1509 | 160 |
| 427 | 3300049571 | Ga0501034_0094477 | Ga0501034_0094477_1602_2090 | 160 |
| 428 | 3300049571 | Ga0501034_0180235 | Ga0501034_0180235_433_933 | 160 |
| 429 | 3300049571 | Ga0501034_0220423 | Ga0501034_0220423_911_1393 | 160 |
| 430 | 3300049571 | Ga0501034_0265502 | Ga0501034_0265502_1000_1488 | 160 |
| 431 | 3300049571 | Ga0501034_0271026 | Ga0501034_0271026_590_1075 | 160 |
| 432 | 3300049571 | Ga0501034_0623536 | Ga0501034_0623536_127_615 | 160 |
| 433 | 3300049572 | Ga0501036_0002187 | Ga0501036_0002187_2559_3041 | 160 |
| 434 | 3300049572 | Ga0501036_0078757 | Ga0501036_0078757_1737_2219 | 160 |
| 435 | 3300049572 | Ga0501036_0390429 | Ga0501036_0390429_50_535 | 160 |
| 436 | 3300049572 | Ga0501036_0627239 | Ga0501036_0627239_21_509 | 160 |
| 437 | 3300049572 | Ga0501036_0635583 | Ga0501036_0635583_374_859 | 160 |
| 438 | 3300049573 | Ga0501037_0017808 | Ga0501037_0017808_3287_3772 | 160 |
| 439 | 3300049573 | Ga0501037_0018671 | Ga0501037_0018671_2632_3117 | 160 |
| 440 | 3300049573 | Ga0501037_0075266 | Ga0501037_0075266_1324_1863 | 160 |
| 441 | 3300049573 | Ga0501037_0108605 | Ga0501037_0108605_893_1381 | 160 |
| 442 | 3300049573 | Ga0501037_0599318 | Ga0501037_0599318_61_561 | 160 |
| 443 | 3300049573 | Ga0501037_0788145 | Ga0501037_0788145_21_512 | 160 |
| 444 | 3300049574 | Ga0501038_0019458 | Ga0501038_0019458_3207_3692 | 160 |
| 445 | 3300049574 | Ga0501038_0029954 | Ga0501038_0029954_1382_1864 | 160 |
| 446 | 3300049574 | Ga0501038_0077019 | Ga0501038_0077019_222_707 | 160 |
| 447 | 3300049574 | Ga0501038_0236738 | Ga0501038_0236738_209_691 | 160 |
| 448 | 3300049575 | Ga0501039_0148724 | Ga0501039_0148724_343_825 | 160 |
| 449 | 3300049575 | Ga0501039_0647307 | Ga0501039_0647307_28_513 | 160 |
| 450 | 3300049576 | Ga0501040_0781166 | Ga0501040_0781166_156_638 | 160 |
| 451 | 3300049577 | Ga0501041_0620550 | Ga0501041_0620550_15_506 | 160 |
| 452 | 3300049578 | Ga0501042_0122980 | Ga0501042_0122980_931_1413 | 160 |
| 453 | 3300049579 | Ga0501043_0002868 | Ga0501043_0002868_6638_7177 | 160 |
| 454 | 3300049579 | Ga0501043_0072950 | Ga0501043_0072950_1308_1793 | 160 |
| 455 | 3300049579 | Ga0501043_0144179 | Ga0501043_0144179_1218_1703 | 160 |
| 456 | 3300049579 | Ga0501043_0171583 | Ga0501043_0171583_1167_1649 | 160 |
| 457 | 3300049580 | Ga0501046_0004032 | Ga0501046_0004032_12826_13308 | 160 |
| 458 | 3300049580 | Ga0501046_0099169 | Ga0501046_0099169_551_1033 | 160 |
| 459 | 3300049580 | Ga0501046_0188775 | Ga0501046_0188775_366_854 | 160 |
| 460 | 3300049581 | Ga0501047_0041524 | Ga0501047_0041524_1108_1596 | 160 |
| 461 | 3300049581 | Ga0501047_0061647 | Ga0501047_0061647_1298_1780 | 160 |
| 462 | 3300049581 | Ga0501047_0066995 | Ga0501047_0066995_2014_2496 | 160 |
| 463 | 3300049581 | Ga0501047_0147272 | Ga0501047_0147272_875_1414 | 160 |
| 464 | 3300049581 | Ga0501047_0293176 | Ga0501047_0293176_95_580 | 160 |
| 465 | 3300049582 | Ga0501048_0003937 | Ga0501048_0003937_5464_5946 | 160 |
| 466 | 3300049582 | Ga0501048_0502253 | Ga0501048_0502253_360_842 | 160 |
| 467 | 3300049582 | Ga0501048_0564727 | Ga0501048_0564727_164_649 | 160 |
| 468 | 3300049583 | Ga0501067_0363822 | Ga0501067_0363822_96_581 | 160 |
| 469 | 3300049584 | Ga0501068_0442830 | Ga0501068_0442830_99_584 | 160 |
| 470 | 3300049585 | Ga0501069_0010568 | Ga0501069_0010568_436_918 | 160 |
| 471 | 3300049585 | Ga0501069_0100167 | Ga0501069_0100167_141_623 | 160 |
| 472 | 3300049586 | Ga0501070_0000133 | Ga0501070_0000133_5573_6055 | 160 |
| 473 | 3300049586 | Ga0501070_0001501 | Ga0501070_0001501_16091_16630 | 160 |
| 474 | 3300049586 | Ga0501070_0055855 | Ga0501070_0055855_611_1099 | 160 |
| 475 | 3300049586 | Ga0501070_0134749 | Ga0501070_0134749_1007_1489 | 160 |
| 476 | 3300049586 | Ga0501070_0141798 | Ga0501070_0141798_1004_1492 | 160 |
| 477 | 3300049587 | Ga0501071_0000105 | Ga0501071_0000105_14684_15166 | 160 |
| 478 | 3300049587 | Ga0501071_0255113 | Ga0501071_0255113_595_1080 | 160 |
| 479 | 3300049587 | Ga0501071_0368364 | Ga0501071_0368364_192_683 | 160 |
| 480 | 3300049587 | Ga0501071_1144071 | Ga0501071_1144071_18_500 | 160 |
| 481 | 3300049588 | Ga0501072_0160424 | Ga0501072_0160424_240_722 | 160 |
| 482 | 3300049588 | Ga0501072_0692834 | Ga0501072_0692834_64_564 | 160 |
| 483 | 3300049589 | Ga0501073_0000028 | Ga0501073_0000028_86162_86647 | 160 |
| 484 | 3300049589 | Ga0501073_0051043 | Ga0501073_0051043_2221_2703 | 160 |
| 485 | 3300049589 | Ga0501073_0100396 | Ga0501073_0100396_1378_1866 | 160 |
| 486 | 3300049589 | Ga0501073_0747485 | Ga0501073_0747485_157_639 | 160 |
| 487 | 3300049592 | Ga0501076_1044927 | Ga0501076_1044927_60_542 | 160 |
| 488 | 3300049741 | Ga0501079_1089376 | Ga0501079_1089376_63_545 | 160 |
| 489 | 3300049742 | Ga0501080_0000152 | Ga0501080_0000152_33996_34535 | 160 |
| 490 | 3300049742 | Ga0501080_0084253 | Ga0501080_0084253_1738_2220 | 160 |
| 491 | 3300049744 | Ga0501083_0121717 | Ga0501083_0121717_27_509 | 160 |
| 492 | 3300049744 | Ga0501083_0316019 | Ga0501083_0316019_267_749 | 160 |
| 493 | 3300049822 | Ga0501035_0000582 | Ga0501035_0000582_27681_28169 | 160 |
| 494 | 3300049822 | Ga0501035_0058013 | Ga0501035_0058013_2038_2520 | 160 |
| 495 | 3300049823 | Ga0501044_0009817 | Ga0501044_0009817_781_1269 | 160 |
| 496 | 3300049823 | Ga0501044_0285470 | Ga0501044_0285470_810_1295 | 160 |
| 497 | 3300049823 | Ga0501044_0301638 | Ga0501044_0301638_859_1341 | 160 |
| 498 | 3300049823 | Ga0501044_0442898 | Ga0501044_0442898_268_750 | 160 |
| 499 | 3300049823 | Ga0501044_0750410 | Ga0501044_0750410_60_545 | 160 |
| 500 | 3300050491 | nmdc:mga00v17_241180_c1 | nmdc:mga00v17_241180_c1_59_556 | 160 |
| 501 | 3300050491 | nmdc:mga00v17_353343_c1 | nmdc:mga00v17_353343_c1_316_798 | 160 |
| 502 | 3300050491 | nmdc:mga00v17_358526_c1 | nmdc:mga00v17_358526_c1_395_889 | 160 |
| 503 | 3300050492 | nmdc:mga0yw44_4594_c1 | nmdc:mga0yw44_4594_c1_5372_5860 | 160 |
| 504 | 3300050492 | nmdc:mga0yw44_497739_c1 | nmdc:mga0yw44_497739_c1_224_706 | 160 |
| 505 | 3300050516 | nmdc:mga0sz30_189161_c1 | nmdc:mga0sz30_189161_c1_241_723 | 160 |
| 506 | 3300050516 | nmdc:mga0sz30_314406_c1 | nmdc:mga0sz30_314406_c1_77_568 | 160 |
| 507 | 3300050516 | nmdc:mga0sz30_3315_c2 | nmdc:mga0sz30_3315_c2_383_871 | 160 |
| 508 | 3300053079 | Ga0500610_0402460 | Ga0500610_0402460_24_512 | 160 |
| 509 | 3300053080 | Ga0500635_0000023 | Ga0500635_0000023_5617_6099 | 160 |
| 510 | 3300053080 | Ga0500635_0009463 | Ga0500635_0009463_1539_2027 | 160 |
| 511 | 3300053087 | Ga0500643_000913 | Ga0500643_000913_7890_8381 | 160 |
| 512 | 3300053093 | Ga0500651_0000170 | Ga0500651_0000170_17315_17803 | 160 |
| 513 | 3300053102 | Ga0500554_040596 | Ga0500554_040596_103_591 | 160 |
| 514 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_820277_820768 | 160 |
| 515 | 3300053104 | Ga0500556_0000064 | Ga0500556_0000064_67048_67536 | 160 |
| 516 | 3300053108 | Ga0500562_000411 | Ga0500562_000411_1808_2296 | 160 |
| 517 | 3300053117 | Ga0500593_000556 | Ga0500593_000556_3415_3903 | 160 |
| 518 | 3300053126 | Ga0500621_155032 | Ga0500621_155032_279_770 | 160 |
| 519 | 3300053133 | Ga0500655_001460 | Ga0500655_001460_3897_4385 | 160 |
| 520 | 3300053136 | Ga0500559_0000043 | Ga0500559_0000043_34953_35435 | 160 |
| 521 | 3300053136 | Ga0500559_0000281 | Ga0500559_0000281_29185_29667 | 160 |
| 522 | 3300053136 | Ga0500559_0000373 | Ga0500559_0000373_28334_28822 | 160 |
| 523 | 3300053136 | Ga0500559_0005479 | Ga0500559_0005479_2867_3349 | 160 |
| 524 | 3300053136 | Ga0500559_0058088 | Ga0500559_0058088_107_592 | 160 |
| 525 | 3300053136 | Ga0500559_0072502 | Ga0500559_0072502_407_892 | 160 |
| 526 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_803159_803650 | 160 |
| 527 | 3300053139 | Ga0500568_0000028 | Ga0500568_0000028_151243_151737 | 160 |
| 528 | 3300053139 | Ga0500568_0003633 | Ga0500568_0003633_1278_1766 | 160 |
| 529 | 3300053139 | Ga0500568_0004245 | Ga0500568_0004245_1085_1570 | 160 |
| 530 | 3300053139 | Ga0500568_0010277 | Ga0500568_0010277_1511_1999 | 160 |
| 531 | 3300053140 | Ga0500573_0000001 | Ga0500573_0000001_258534_259016 | 160 |
| 532 | 3300053140 | Ga0500573_0000487 | Ga0500573_0000487_6283_6768 | 160 |
| 533 | 3300053140 | Ga0500573_0008949 | Ga0500573_0008949_2389_2877 | 160 |
| 534 | 3300053140 | Ga0500573_0015167 | Ga0500573_0015167_1341_1829 | 160 |
| 535 | 3300053140 | Ga0500573_0018519 | Ga0500573_0018519_2711_3199 | 160 |
| 536 | 3300053140 | Ga0500573_0026061 | Ga0500573_0026061_2723_3205 | 160 |
| 537 | 3300053140 | Ga0500573_0033706 | Ga0500573_0033706_518_1000 | 160 |
| 538 | 3300053140 | Ga0500573_0126716 | Ga0500573_0126716_297_779 | 160 |
| 539 | 3300053140 | Ga0500573_0129840 | Ga0500573_0129840_376_858 | 160 |
| 540 | 3300053140 | Ga0500573_0155243 | Ga0500573_0155243_88_576 | 160 |
| 541 | 3300053142 | Ga0500577_0010400 | Ga0500577_0010400_1637_2125 | 160 |
| 542 | 3300053148 | Ga0500590_024944 | Ga0500590_024944_2167_2655 | 160 |
| 543 | 3300053153 | Ga0500616_0000864 | Ga0500616_0000864_25636_26124 | 160 |
| 544 | 3300053153 | Ga0500616_0001099 | Ga0500616_0001099_24727_25218 | 160 |
| 545 | 3300053153 | Ga0500616_0086989 | Ga0500616_0086989_686_1174 | 160 |
| 546 | 3300053155 | Ga0500620_000292 | Ga0500620_000292_3436_3924 | 160 |
| 547 | 3300053730 | Ga0500645_083275 | Ga0500645_083275_206_694 | 160 |
| 548 | 3300060353 | Ga0501082_0315077 | Ga0501082_0315077_54_539 | 160 |
| 549 | 3300060353 | Ga0501082_0831150 | Ga0501082_0831150_228_710 | 160 |
| 550 | 3300061719 | Ga0466962_0135722 | Ga0466962_0135722_533_1015 | 160 |
| 551 | 3300061719 | Ga0466962_0233998 | Ga0466962_0233998_329_811 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9719 | 3 | 159 |
| 5o08-assembly1.cif.gz_A | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with dephospho-coenzyme a | 0.9653 | 3 | 159 |
| 6qmi-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. | 0.9639 | 3 | 159 |
| 5o0a-assembly1.cif.gz_B | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) | 0.9626 | 3 | 159 |
| 7yy0-assembly1.cif.gz_C | crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with 4'-phosphopantetheine | 0.9596 | 3 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9639 | 3 | 159 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9509 | 1 | 159 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9338 | 1 | 159 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9317 | 3 | 159 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9298 | 1 | 159 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519H686-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9966 | 2 | 159 |
GO:0003677
GO:0003689 GO:0004595 GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 GO:0015937 GO:0016887 GO:0036121 GO:0061749 GO:0061775 GO:0140584 GO:0140665 GO:0140849 GO:1990518 |
| AF-A0A506XR89-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9961 | 1 | 160 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A348NUL0-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9961 | 1 | 159 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A1R4FDL9-F1-model_v4 | deleted | 0.9955 | 1 | 160 |
|
| AF-A0A543HRT3-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.995 | 1 | 160 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar