F462652

General Info

Members Datasets Scaffolds Average Seq Length
551 191 551 113

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0393283|Ga0495668_0393283_282_662
Length 126
Sequence MALPAADRRFETGAAMFSGAHVMIFTKDEAADRAFLRDVLEVPCIDTGGGWLIYKLPPTELGVHSGENDFHQLYFMCDDLDAFVAKMAERNVAIDEIRQQSWGRSTGVQLPGGGKLGVYEPRHARP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 0.54
Rhizosphere 97.46
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002618 3300001979 Bacteria 8104
2 JGI24739J22299_10005894 3300001989 Bacteria 4639
3 JGI24739J22299_10153475 3300001989 Unclassified 680
4 JGI24737J22298_10000982 3300001990 Bacteria 10131
5 JGI24737J22298_10002302 3300001990 Bacteria 6792
6 JGI24735J21928_10027166 3300002067 Bacteria 1716
7 JGI24738J21930_10000225 3300002075 Bacteria 15325
8 JGI24749J21850_1005496 3300002076 Bacteria 1774
9 JGI24034J26672_10038436 3300002239 Unclassified 798
10 JGI24034J26672_10083633 3300002239 Bacteria 585
11 Ga0065707_10396434 3300005295 Bacteria 856
12 Ga0070658_10308073 3300005327 Bacteria 1351
13 Ga0070658_10358515 3300005327 Bacteria 1249
14 Ga0070676_10004165 3300005328 Bacteria 7596
15 Ga0070676_10011595 3300005328 Bacteria 4794
16 Ga0070676_10012447 3300005328 Bacteria 4645
17 Ga0070676_10016131 3300005328 Bacteria 4127
18 Ga0070676_11054098 3300005328 Bacteria 612
19 Ga0070670_100006825 3300005331 Bacteria 9669
20 Ga0070670_100071703 3300005331 Bacteria 2974
21 Ga0070670_100080645 3300005331 Bacteria 2796
22 Ga0070670_100182001 3300005331 Unclassified 1825
23 Ga0070670_100255840 3300005331 Bacteria 1526
24 Ga0070670_100278395 3300005331 Bacteria 1461
25 Ga0070670_100315190 3300005331 Bacteria 1370
26 Ga0070670_100505442 3300005331 Bacteria 1075
27 Ga0070670_100791446 3300005331 Bacteria 856
28 Ga0070670_100959042 3300005331 Bacteria 777
29 Ga0070677_10000409 3300005333 Bacteria 14927
30 Ga0070677_10116832 3300005333 Bacteria 1199
31 Ga0068869_100000883 3300005334 Bacteria 17260
32 Ga0070666_10008626 3300005335 Bacteria 6337
33 Ga0070666_10181711 3300005335 Bacteria 1476
34 Ga0070680_100004667 3300005336 Bacteria 10308
35 Ga0070680_100551121 3300005336 Bacteria 988
36 Ga0070680_101180336 3300005336 Bacteria 662
37 Ga0070682_100228187 3300005337 Bacteria 1330
38 Ga0070682_100347097 3300005337 Bacteria 1105
39 Ga0070682_100381145 3300005337 Bacteria 1061
40 Ga0070682_100655913 3300005337 Bacteria 836
41 Ga0068868_100002544 3300005338 Bacteria 12667
42 Ga0068868_100157295 3300005338 Bacteria 1875
43 Ga0068868_100176088 3300005338 Bacteria 1773
44 Ga0068868_100203355 3300005338 Bacteria 1652
45 Ga0068868_101287313 3300005338 Bacteria 679
46 Ga0070660_100005685 3300005339 Bacteria 8639
47 Ga0070660_100110043 3300005339 Bacteria 2191
48 Ga0070660_101019908 3300005339 Bacteria 699
49 Ga0070691_10551209 3300005341 Bacteria 674
50 Ga0070661_100000272 3300005344 Bacteria 41918
51 Ga0070661_100030233 3300005344 Bacteria 3912
52 Ga0070661_100046697 3300005344 Bacteria 3169
53 Ga0070661_101249344 3300005344 Unclassified 622
54 Ga0070692_10335723 3300005345 Bacteria 934
55 Ga0070668_100001172 3300005347 Bacteria 18548
56 Ga0070668_100294714 3300005347 Bacteria 1359
57 Ga0070669_100000209 3300005353 Bacteria 48982
58 Ga0070669_100001698 3300005353 Bacteria 15939
59 Ga0070669_100172557 3300005353 Bacteria 1687
60 Ga0070669_100277501 3300005353 Bacteria 1342
61 Ga0070669_101784459 3300005353 Unclassified 537
62 Ga0070675_100010717 3300005354 Bacteria 7170
63 Ga0070675_100032530 3300005354 Bacteria 4222
64 Ga0070675_100062900 3300005354 Bacteria 3067
65 Ga0070675_101585389 3300005354 Bacteria 604
66 Ga0070671_100021416 3300005355 Bacteria 5279
67 Ga0070671_100029290 3300005355 Bacteria 4539
68 Ga0070671_100121491 3300005355 Bacteria 2198
69 Ga0070671_100137634 3300005355 Bacteria 2059
70 Ga0070671_101759452 3300005355 Bacteria 550
71 Ga0070674_100022057 3300005356 Bacteria 4102
72 Ga0070674_100037679 3300005356 Bacteria 3254
73 Ga0070674_100038936 3300005356 Bacteria 3208
74 Ga0070674_100232324 3300005356 Bacteria 1440
75 Ga0070674_100617953 3300005356 Unclassified 918
76 Ga0070674_100740029 3300005356 Bacteria 844
77 Ga0070674_101089653 3300005356 Bacteria 705
78 Ga0070673_100000352 3300005364 Bacteria 24204
79 Ga0070673_100019068 3300005364 Bacteria 4920
80 Ga0070673_100020913 3300005364 Bacteria 4730
81 Ga0070673_100106647 3300005364 Bacteria 2316
82 Ga0070673_100236669 3300005364 Bacteria 1586
83 Ga0070673_100572246 3300005364 Bacteria 1028
84 Ga0070688_100371308 3300005365 Bacteria 1052
85 Ga0070659_100006335 3300005366 Bacteria 8546
86 Ga0070659_100046376 3300005366 Bacteria 3407
87 Ga0070659_100049582 3300005366 Bacteria 3302
88 Ga0070659_100130790 3300005366 Bacteria 2038
89 Ga0070667_100005469 3300005367 Bacteria 10605
90 Ga0070667_100007891 3300005367 Bacteria 8831
91 Ga0070667_100023633 3300005367 Bacteria 5101
92 Ga0070667_100071468 3300005367 Bacteria 2955
93 Ga0070667_100690921 3300005367 Unclassified 944
94 Ga0070701_10062185 3300005438 Bacteria 1971
95 Ga0070701_10302834 3300005438 Bacteria 983
96 Ga0070700_101630227 3300005441 Bacteria 552
97 Ga0070663_100165933 3300005455 Bacteria 1703
98 Ga0070663_100696817 3300005455 Unclassified 863
99 Ga0070678_100117715 3300005456 Bacteria 2090
100 Ga0070678_100149564 3300005456 Bacteria 1879
101 Ga0070662_100000872 3300005457 Bacteria 18447
102 Ga0070662_100021934 3300005457 Bacteria 4365
103 Ga0070662_100030559 3300005457 Bacteria 3771
104 Ga0070662_100048157 3300005457 Bacteria 3070
105 Ga0070662_100178602 3300005457 Bacteria 1672
106 Ga0070662_100613466 3300005457 Bacteria 916
107 Ga0070662_100664342 3300005457 Bacteria 880
108 Ga0070662_100747099 3300005457 Bacteria 829
109 Ga0070681_10108684 3300005458 Bacteria 2714
110 Ga0070681_10712174 3300005458 Bacteria 920
111 Ga0068867_100001039 3300005459 Bacteria 18955
112 Ga0068867_100003944 3300005459 Bacteria 10437
113 Ga0068867_100049553 3300005459 Bacteria 3092
114 Ga0068867_100581663 3300005459 Unclassified 974
115 Ga0070679_100000007 3300005530 Bacteria 195373
116 Ga0068853_100001894 3300005539 Bacteria 15424
117 Ga0068853_100123391 3300005539 Bacteria 2313
118 Ga0068853_100243601 3300005539 Bacteria 1648
119 Ga0068853_100314044 3300005539 Bacteria 1452
120 Ga0068853_100451849 3300005539 Bacteria 1209
121 Ga0068853_100466532 3300005539 Bacteria 1189
122 Ga0070672_100001346 3300005543 Bacteria 15146
123 Ga0070672_100010251 3300005543 Bacteria 6493
124 Ga0070672_100106935 3300005543 Bacteria 2276
125 Ga0070672_100176258 3300005543 Bacteria 1780
126 Ga0070672_100531865 3300005543 Bacteria 1019
127 Ga0070672_100629781 3300005543 Bacteria 936
128 Ga0070672_101105927 3300005543 Unclassified 704
129 Ga0070686_100663391 3300005544 Bacteria 828
130 Ga0070696_100020263 3300005546 Bacteria 4508
131 Ga0070693_100021588 3300005547 Bacteria 3411
132 Ga0070693_100364689 3300005547 Bacteria 992
133 Ga0070665_100022459 3300005548 Bacteria 6350
134 Ga0070665_100162909 3300005548 Bacteria 2232
135 Ga0070665_100322652 3300005548 Unclassified 1548
136 Ga0070665_100745284 3300005548 Bacteria 993
137 Ga0070665_100869750 3300005548 Bacteria 914
138 Ga0070665_101574190 3300005548 Unclassified 665
139 Ga0070704_100560966 3300005549 Bacteria 999
140 Ga0068855_100277549 3300005563 Bacteria 1862
141 Ga0068855_101501799 3300005563 Bacteria 692
142 Ga0070664_100122115 3300005564 Bacteria 2282
143 Ga0070664_100297348 3300005564 Bacteria 1458
144 Ga0070664_100433547 3300005564 Bacteria 1205
145 Ga0070664_100532597 3300005564 Bacteria 1085
146 Ga0070664_100597702 3300005564 Unclassified 1023
147 Ga0070664_100799569 3300005564 Bacteria 882
148 Ga0068857_100002254 3300005577 Bacteria 15681
149 Ga0068857_100010923 3300005577 Bacteria 7904
150 Ga0068857_100162485 3300005577 Bacteria 2027
151 Ga0068857_100378490 3300005577 Bacteria 1314
152 Ga0068857_100398677 3300005577 Unclassified 1280
153 Ga0068854_100001334 3300005578 Bacteria 14875
154 Ga0068854_100047373 3300005578 Bacteria 3063
155 Ga0068854_100089731 3300005578 Bacteria 2285
156 Ga0068854_100273611 3300005578 Bacteria 1357
157 Ga0068854_100554164 3300005578 Bacteria 975
158 Ga0068854_100837674 3300005578 Bacteria 804
159 Ga0070702_100063607 3300005615 Bacteria 2155
160 Ga0068852_100000562 3300005616 Bacteria 24464
161 Ga0068852_100013117 3300005616 Bacteria 6331
162 Ga0068852_100395807 3300005616 Bacteria 1358
163 Ga0068852_100633251 3300005616 Bacteria 1076
164 Ga0068852_101601572 3300005616 Unclassified 674
165 Ga0068859_100000934 3300005617 Bacteria 29961
166 Ga0068859_100001413 3300005617 Bacteria 24348
167 Ga0068859_100006555 3300005617 Bacteria 11817
168 Ga0068859_100090424 3300005617 Bacteria 3112
169 Ga0068859_100272495 3300005617 Bacteria 1785
170 Ga0068859_100843356 3300005617 Unclassified 1003
171 Ga0068864_100000557 3300005618 Bacteria 31825
172 Ga0068864_100004852 3300005618 Bacteria 11012
173 Ga0068864_100326890 3300005618 Unclassified 1441
174 Ga0068864_100725020 3300005618 Bacteria 973
175 Ga0068864_102409962 3300005618 Bacteria 532
176 Ga0068866_10010606 3300005718 Bacteria 3956
177 Ga0068866_10051499 3300005718 Bacteria 2096
178 Ga0068866_10609981 3300005718 Bacteria 738
179 Ga0068861_100033598 3300005719 Bacteria 3786
180 Ga0068861_100036059 3300005719 Bacteria 3668
181 Ga0068861_100503179 3300005719 Bacteria 1096
182 Ga0068861_101963076 3300005719 Bacteria 583
183 Ga0068851_10052968 3300005834 Bacteria 2065
184 Ga0068851_10435989 3300005834 Bacteria 776
185 Ga0068870_10163151 3300005840 Bacteria 1323
186 Ga0068863_100000569 3300005841 Bacteria 37520
187 Ga0068863_100002262 3300005841 Bacteria 19131
188 Ga0068863_100055894 3300005841 Bacteria 3737
189 Ga0068863_100085182 3300005841 Bacteria 2995
190 Ga0068858_100000604 3300005842 Bacteria 37527
191 Ga0068858_100036747 3300005842 Bacteria 4542
192 Ga0068858_100156506 3300005842 Bacteria 2144
193 Ga0068858_100577129 3300005842 Bacteria 1090
194 Ga0068858_100993751 3300005842 Bacteria 822
195 Ga0068860_100004166 3300005843 Bacteria 14825
196 Ga0068860_100006108 3300005843 Bacteria 12113
197 Ga0068860_100012161 3300005843 Bacteria 8478
198 Ga0068860_100076494 3300005843 Bacteria 3183
199 Ga0068860_100213214 3300005843 Bacteria 1873
200 Ga0068860_101015806 3300005843 Bacteria 847
201 Ga0068862_100003883 3300005844 Bacteria 12712
202 Ga0068862_100007390 3300005844 Bacteria 9110
203 Ga0068862_100015095 3300005844 Bacteria 6418
204 Ga0068862_100018824 3300005844 Bacteria 5754
205 Ga0068862_100074895 3300005844 Bacteria 2927
206 Ga0068862_100131992 3300005844 Bacteria 2210
207 Ga0068862_100212495 3300005844 Bacteria 1748
208 Ga0068862_100379093 3300005844 Bacteria 1319
209 Ga0068862_100454922 3300005844 Bacteria 1207
210 Ga0068862_101563514 3300005844 Unclassified 666
211 Ga0097621_100066788 3300006237 Bacteria 2963
212 Ga0097621_100556028 3300006237 Bacteria 1045
213 Ga0075370_10852680 3300006353 Bacteria 556
214 Ga0068871_100249552 3300006358 Bacteria 1545
215 Ga0068871_100594725 3300006358 Bacteria 1006
216 Ga0068871_101363084 3300006358 Bacteria 668
217 Ga0075428_100087385 3300006844 Bacteria 3401
218 Ga0075428_100557811 3300006844 Bacteria 1224
219 Ga0068865_100001568 3300006881 Bacteria 13367
220 Ga0068865_100997079 3300006881 Bacteria 733
221 Ga0097620_100000934 3300006931 Bacteria 29961
222 Ga0097620_100001413 3300006931 Bacteria 24348
223 Ga0097620_100006555 3300006931 Bacteria 11817
224 Ga0097620_100090415 3300006931 Bacteria 3112
225 Ga0097620_100272478 3300006931 Bacteria 1785
226 Ga0097620_100843318 3300006931 Unclassified 1003
227 Ga0105251_10131863 3300009011 Bacteria 1132
228 Ga0105250_10002090 3300009092 Bacteria 10241
229 Ga0105240_11684078 3300009093 Bacteria 662
230 Ga0111539_10272843 3300009094 Bacteria 1969
231 Ga0111539_10527498 3300009094 Bacteria 1376
232 Ga0111539_11545786 3300009094 Bacteria 769
233 Ga0111539_11653951 3300009094 Bacteria 742
234 Ga0105245_10000120 3300009098 Bacteria 75923
235 Ga0105247_11820958 3300009101 Unclassified 507
236 Ga0114129_10406806 3300009147 Bacteria 1793
237 Ga0105243_10006820 3300009148 Bacteria 8803
238 Ga0105243_10042672 3300009148 Bacteria 3552
239 Ga0105243_10152717 3300009148 Bacteria 1982
240 Ga0105243_10179346 3300009148 Bacteria 1841
241 Ga0105243_10749884 3300009148 Bacteria 957
242 Ga0105241_10526958 3300009174 Bacteria 1057
243 Ga0105248_10000070 3300009177 Bacteria 119985
244 Ga0105248_10000256 3300009177 Bacteria 62138
245 Ga0105248_10020775 3300009177 Bacteria 7274
246 Ga0105248_10146181 3300009177 Bacteria 2668
247 Ga0105248_10300967 3300009177 Bacteria 1806
248 Ga0105248_12422094 3300009177 Bacteria 598
249 Ga0105238_10060199 3300009551 Bacteria 3802
250 Ga0105238_10499493 3300009551 Unclassified 1217
251 Ga0105249_10009816 3300009553 Bacteria 8388
252 Ga0105249_10050539 3300009553 Bacteria 3790
253 Ga0105249_10189713 3300009553 Bacteria 2005
254 Ga0105249_10199692 3300009553 Bacteria 1956
255 Ga0105239_10212011 3300010375 Bacteria 2171
256 Ga0105246_10005610 3300011119 Bacteria 7653
257 Ga0157316_1071842 3300012510 Bacteria 524
258 Ga0157373_10005063 3300013100 Bacteria 9903
259 Ga0157373_10009328 3300013100 Bacteria 7252
260 Ga0157373_10132767 3300013100 Bacteria 1751
261 Ga0157371_10002887 3300013102 Bacteria 16074
262 Ga0157371_11299603 3300013102 Bacteria 563
263 Ga0157374_10171806 3300013296 Bacteria 2115
264 Ga0157378_10002232 3300013297 Bacteria 17178
265 Ga0163162_10104977 3300013306 Bacteria 2920
266 Ga0163162_10158104 3300013306 Bacteria 2387
267 Ga0163162_10504511 3300013306 Bacteria 1340
268 Ga0163162_12157599 3300013306 Bacteria 639
269 Ga0157372_10205539 3300013307 Bacteria 2282
270 Ga0157372_10272427 3300013307 Bacteria 1967
271 Ga0157375_10047139 3300013308 Bacteria 4207
272 Ga0157375_10513023 3300013308 Bacteria 1362
273 Ga0163163_10000135 3300014325 Bacteria 75904
274 Ga0163163_10644238 3300014325 Bacteria 1123
275 Ga0157380_10001109 3300014326 Bacteria 17364
276 Ga0157380_10041906 3300014326 Bacteria 3575
277 Ga0157380_10083517 3300014326 Bacteria 2617
278 Ga0157380_10588109 3300014326 Bacteria 1099
279 Ga0157377_10103439 3300014745 Bacteria 1701
280 Ga0157379_10010929 3300014968 Bacteria 7914
281 Ga0157379_10429283 3300014968 Bacteria 1218
282 Ga0157379_10758336 3300014968 Bacteria 914
283 Ga0163161_10124013 3300017792 Bacteria 1943
284 Ga0163161_10310840 3300017792 Bacteria 1243
285 Ga0163161_11017179 3300017792 Bacteria 708
286 Ga0213873_10000006 3300021358 Bacteria 408723
287 Ga0213876_10000004 3300021384 Bacteria 943822
288 Ga0207673_1033113 3300025290 Bacteria 719
289 Ga0207697_10000260 3300025315 Bacteria 29097
290 Ga0207697_10019957 3300025315 Bacteria 2746
291 Ga0207656_10144517 3300025321 Bacteria 1123
292 Ga0207696_1068461 3300025711 Bacteria 990
293 Ga0207713_1117251 3300025735 Bacteria 897
294 Ga0207682_10000745 3300025893 Bacteria 15070
295 Ga0207682_10036711 3300025893 Bacteria 1984
296 Ga0207642_10008911 3300025899 Bacteria 3467
297 Ga0207642_10166430 3300025899 Bacteria 1189
298 Ga0207642_11044865 3300025899 Bacteria 527
299 Ga0207688_10002688 3300025901 Bacteria 9624
300 Ga0207688_10011260 3300025901 Bacteria 4868
301 Ga0207688_10072460 3300025901 Bacteria 1957
302 Ga0207688_10221917 3300025901 Bacteria 1139
303 Ga0207680_10404372 3300025903 Bacteria 965
304 Ga0207647_10000052 3300025904 Bacteria 87651
305 Ga0207647_10010454 3300025904 Bacteria 6556
306 Ga0207645_10003687 3300025907 Bacteria 11554
307 Ga0207645_10008043 3300025907 Bacteria 7397
308 Ga0207645_10021229 3300025907 Bacteria 4237
309 Ga0207645_10241221 3300025907 Bacteria 1194
310 Ga0207643_10812135 3300025908 Bacteria 606
311 Ga0207705_10081987 3300025909 Bacteria 2352
312 Ga0207705_10153664 3300025909 Bacteria 1725
313 Ga0207654_10326771 3300025911 Bacteria 1050
314 Ga0207707_10392866 3300025912 Bacteria 1191
315 Ga0207660_10003431 3300025917 Bacteria 10339
316 Ga0207657_10008714 3300025919 Bacteria 10266
317 Ga0207657_10064342 3300025919 Bacteria 3130
318 Ga0207657_11367569 3300025919 Unclassified 533
319 Ga0207649_10000074 3300025920 Bacteria 85018
320 Ga0207649_10012068 3300025920 Bacteria 4780
321 Ga0207649_10100543 3300025920 Bacteria 1913
322 Ga0207649_10301332 3300025920 Bacteria 1172
323 Ga0207649_10974118 3300025920 Unclassified 667
324 Ga0207652_10000001 3300025921 Bacteria 1006643
325 Ga0207652_10000002 3300025921 Bacteria 878035
326 Ga0207681_10001010 3300025923 Bacteria 18360
327 Ga0207681_10004465 3300025923 Bacteria 8608
328 Ga0207681_10065507 3300025923 Bacteria 2512
329 Ga0207681_10498734 3300025923 Bacteria 996
330 Ga0207681_11461624 3300025923 Bacteria 573
331 Ga0207694_10024119 3300025924 Bacteria 4619
332 Ga0207650_10002289 3300025925 Bacteria 13345
333 Ga0207650_10027941 3300025925 Bacteria 4041
334 Ga0207650_10060200 3300025925 Bacteria 2833
335 Ga0207650_10289016 3300025925 Bacteria 1336
336 Ga0207650_10383060 3300025925 Bacteria 1162
337 Ga0207650_10539079 3300025925 Bacteria 978
338 Ga0207650_10824043 3300025925 Bacteria 787
339 Ga0207659_10001032 3300025926 Bacteria 16497
340 Ga0207659_10024359 3300025926 Bacteria 4054
341 Ga0207659_10197466 3300025926 Bacteria 1604
342 Ga0207644_10025135 3300025931 Bacteria 4093
343 Ga0207644_10025528 3300025931 Bacteria 4063
344 Ga0207690_10029733 3300025932 Bacteria 3477
345 Ga0207690_10032858 3300025932 Bacteria 3332
346 Ga0207690_10402063 3300025932 Bacteria 1092
347 Ga0207690_11177136 3300025932 Unclassified 640
348 Ga0207706_10001178 3300025933 Bacteria 26405
349 Ga0207706_10002470 3300025933 Bacteria 18018
350 Ga0207706_10140935 3300025933 Bacteria 2121
351 Ga0207706_10149546 3300025933 Bacteria 2054
352 Ga0207706_10332364 3300025933 Bacteria 1322
353 Ga0207706_10345046 3300025933 Bacteria 1295
354 Ga0207709_10014236 3300025935 Bacteria 4389
355 Ga0207709_10132412 3300025935 Bacteria 1701
356 Ga0207709_10152680 3300025935 Bacteria 1601
357 Ga0207709_11152835 3300025935 Bacteria 638
358 Ga0207669_10030861 3300025937 Bacteria 2985
359 Ga0207669_10070582 3300025937 Bacteria 2191
360 Ga0207669_10461951 3300025937 Bacteria 1008
361 Ga0207669_11131367 3300025937 Bacteria 662
362 Ga0207704_10003302 3300025938 Bacteria 7327
363 Ga0207704_10720226 3300025938 Bacteria 828
364 Ga0207704_11309909 3300025938 Bacteria 619
365 Ga0207704_11866174 3300025938 Bacteria 517
366 Ga0207691_10000114 3300025940 Bacteria 72745
367 Ga0207691_10002177 3300025940 Bacteria 19162
368 Ga0207691_10192010 3300025940 Bacteria 1781
369 Ga0207691_10354545 3300025940 Bacteria 1255
370 Ga0207691_10441937 3300025940 Bacteria 1107
371 Ga0207691_11488766 3300025940 Bacteria 554
372 Ga0207711_10000051 3300025941 Bacteria 140854
373 Ga0207711_10005174 3300025941 Bacteria 11052
374 Ga0207711_10013598 3300025941 Bacteria 6761
375 Ga0207711_10055386 3300025941 Bacteria 3405
376 Ga0207711_10332622 3300025941 Bacteria 1405
377 Ga0207711_11317018 3300025941 Bacteria 664
378 Ga0207689_10000014 3300025942 Bacteria 122534
379 Ga0207689_10184188 3300025942 Unclassified 1722
380 Ga0207689_11209748 3300025942 Bacteria 636
381 Ga0207679_10136454 3300025945 Bacteria 1976
382 Ga0207679_10145787 3300025945 Bacteria 1920
383 Ga0207679_10225916 3300025945 Bacteria 1577
384 Ga0207679_10562112 3300025945 Unclassified 1025
385 Ga0207679_10737308 3300025945 Bacteria 895
386 Ga0207667_10472778 3300025949 Bacteria 1273
387 Ga0207651_10000066 3300025960 Bacteria 47049
388 Ga0207651_10012422 3300025960 Bacteria 4820
389 Ga0207651_10019330 3300025960 Bacteria 4079
390 Ga0207651_10039866 3300025960 Bacteria 3101
391 Ga0207651_10627182 3300025960 Bacteria 942
392 Ga0207712_10021099 3300025961 Bacteria 4272
393 Ga0207712_10242686 3300025961 Bacteria 1452
394 Ga0207712_10346220 3300025961 Bacteria 1234
395 Ga0207712_10844020 3300025961 Bacteria 807
396 Ga0207668_10000720 3300025972 Bacteria 20252
397 Ga0207668_10134481 3300025972 Bacteria 1893
398 Ga0207668_10167236 3300025972 Bacteria 1721
399 Ga0207668_10379531 3300025972 Bacteria 1189
400 Ga0207668_10639458 3300025972 Bacteria 930
401 Ga0207640_10005977 3300025981 Bacteria 6648
402 Ga0207640_10013873 3300025981 Bacteria 4626
403 Ga0207640_10745527 3300025981 Bacteria 844
404 Ga0207640_10881896 3300025981 Bacteria 780
405 Ga0207658_10003422 3300025986 Bacteria 11234
406 Ga0207658_10052096 3300025986 Bacteria 3019
407 Ga0207658_10055361 3300025986 Bacteria 2939
408 Ga0207658_10166201 3300025986 Bacteria 1813
409 Ga0207658_10224832 3300025986 Bacteria 1581
410 Ga0207658_11333033 3300025986 Bacteria 656
411 Ga0207658_11416926 3300025986 Bacteria 636
412 Ga0207677_10033710 3300026023 Bacteria 3307
413 Ga0207677_10391617 3300026023 Bacteria 1176
414 Ga0207703_10003761 3300026035 Bacteria 12623
415 Ga0207703_10032547 3300026035 Bacteria 4127
416 Ga0207703_10109588 3300026035 Bacteria 2354
417 Ga0207703_11073871 3300026035 Bacteria 773
418 Ga0207639_10208812 3300026041 Bacteria 1679
419 Ga0207639_10327992 3300026041 Bacteria 1361
420 Ga0207639_10407725 3300026041 Bacteria 1226
421 Ga0207639_10611447 3300026041 Bacteria 1006
422 Ga0207639_10657046 3300026041 Bacteria 970
423 Ga0207678_10009335 3300026067 Bacteria 8634
424 Ga0207678_10140323 3300026067 Unclassified 2062
425 Ga0207678_10384462 3300026067 Bacteria 1214
426 Ga0207678_10695294 3300026067 Unclassified 895
427 Ga0207678_10849549 3300026067 Bacteria 806
428 Ga0207641_10000190 3300026088 Bacteria 84715
429 Ga0207641_10019664 3300026088 Bacteria 5545
430 Ga0207641_10070975 3300026088 Bacteria 2994
431 Ga0207641_10629555 3300026088 Unclassified 1052
432 Ga0207648_10001420 3300026089 Bacteria 26422
433 Ga0207648_10013151 3300026089 Bacteria 7713
434 Ga0207648_10029482 3300026089 Bacteria 4866
435 Ga0207676_10000139 3300026095 Bacteria 63189
436 Ga0207676_10000259 3300026095 Bacteria 45927
437 Ga0207676_10030447 3300026095 Bacteria 4052
438 Ga0207676_10198726 3300026095 Bacteria 1770
439 Ga0207676_11364243 3300026095 Bacteria 704
440 Ga0207674_10000244 3300026116 Bacteria 67590
441 Ga0207674_10014008 3300026116 Bacteria 8864
442 Ga0207674_10104516 3300026116 Bacteria 2810
443 Ga0207675_100016300 3300026118 Bacteria 6937
444 Ga0207675_100026968 3300026118 Bacteria 5348
445 Ga0207675_100038995 3300026118 Bacteria 4434
446 Ga0207675_100047074 3300026118 Bacteria 4028
447 Ga0207675_100376256 3300026118 Bacteria 1396
448 Ga0207675_100478420 3300026118 Bacteria 1237
449 Ga0207675_102477928 3300026118 Bacteria 530
450 Ga0207683_10183275 3300026121 Bacteria 1899
451 Ga0207683_10188762 3300026121 Bacteria 1870
452 Ga0207698_10008286 3300026142 Bacteria 6564
453 Ga0207698_10092373 3300026142 Bacteria 2481
454 Ga0207428_10139110 3300027907 Bacteria 1854
455 Ga0207428_10215502 3300027907 Bacteria 1441
456 Ga0268266_10075981 3300028379 Bacteria 2918
457 Ga0268266_10211577 3300028379 Bacteria 1778
458 Ga0268266_10227574 3300028379 Bacteria 1716
459 Ga0268266_11027703 3300028379 Unclassified 797
460 Ga0268265_10004697 3300028380 Bacteria 9430
461 Ga0268265_10010196 3300028380 Bacteria 6342
462 Ga0268265_10010468 3300028380 Bacteria 6264
463 Ga0268265_10014260 3300028380 Bacteria 5415
464 Ga0268265_10052394 3300028380 Bacteria 3086
465 Ga0268265_10069307 3300028380 Bacteria 2738
466 Ga0268265_10154011 3300028380 Bacteria 1942
467 Ga0268265_10366955 3300028380 Bacteria 1320
468 Ga0268265_10597177 3300028380 Bacteria 1054
469 Ga0268265_10714676 3300028380 Bacteria 969
470 Ga0268264_10001693 3300028381 Bacteria 20308
471 Ga0268264_10307555 3300028381 Bacteria 1494
472 Ga0268264_11498602 3300028381 Bacteria 685
473 Ga0307513_10082836 3300031456 Bacteria 3301
474 Ga0307513_10691603 3300031456 Bacteria 726
475 Ga0307408_100307872 3300031548 Bacteria 1330
476 Ga0307408_100526436 3300031548 Bacteria 1039
477 Ga0307413_11051068 3300031824 Bacteria 701
478 Ga0307410_10009738 3300031852 Bacteria 5404
479 Ga0307410_10394514 3300031852 Bacteria 1117
480 Ga0307410_10665097 3300031852 Bacteria 875
481 Ga0307406_10235821 3300031901 Bacteria 1369
482 Ga0307406_10741465 3300031901 Bacteria 824
483 Ga0307406_11271070 3300031901 Bacteria 641
484 Ga0307409_100258496 3300031995 Bacteria 1596
485 Ga0307409_100309978 3300031995 Bacteria 1472
486 Ga0307409_101541494 3300031995 Bacteria 692
487 Ga0307416_101034489 3300032002 Bacteria 925
488 Ga0307416_101091109 3300032002 Bacteria 903
489 Ga0307416_101289754 3300032002 Bacteria 836
490 Ga0307414_11234070 3300032004 Bacteria 693
491 Ga0307415_100003990 3300032126 Bacteria 7600
492 Ga0307415_100013623 3300032126 Bacteria 4753
493 Ga0307415_100179931 3300032126 Bacteria 1658
494 Ga0307415_100203815 3300032126 Bacteria 1572
495 Ga0395900_0034421 3300037418 Bacteria 5216
496 Ga0395900_0099886 3300037418 Bacteria 2981
497 Ga0395900_0268626 3300037418 Bacteria 1701
498 Ga0395900_1694136 3300037418 Unclassified 543
499 Ga0395905_0084976 3300037471 Bacteria 2965
500 Ga0395905_0789967 3300037471 Bacteria 852
501 Ga0395905_0907141 3300037471 Bacteria 784
502 Ga0395901_0118329 3300038443 Bacteria 2784
503 Ga0395901_0143581 3300038443 Bacteria 2509
504 Ga0395901_0154411 3300038443 Bacteria 2411
505 Ga0436365_0970858 3300039437 Bacteria 175279
506 Ga0436362_0554113 3300039453 Bacteria 162652
507 Ga0495596_0138845 3300046500 Bacteria 944
508 Ga0495663_0004724 3300046525 Bacteria 3812
509 Ga0495663_0020498 3300046525 Bacteria 1898
510 Ga0495663_0198703 3300046525 Bacteria 699
511 Ga0495598_0119111 3300046537 Bacteria 893
512 Ga0495621_0003057 3300046539 Bacteria 4567
513 Ga0495621_0010550 3300046539 Bacteria 2830
514 Ga0495621_0096819 3300046539 Bacteria 1118
515 Ga0495621_0283084 3300046539 Bacteria 683
516 Ga0495621_0500074 3300046539 Bacteria 524
517 Ga0495633_0042747 3300046558 Bacteria 2151
518 Ga0495633_0414674 3300046558 Unclassified 609
519 Ga0495668_0004232 3300046616 Bacteria 10326
520 Ga0495668_0393283 3300046616 Bacteria 761
521 Ga0495659_0032397 3300046664 Bacteria 1829
522 Ga0495659_0043015 3300046664 Bacteria 1619
523 Ga0495659_0091609 3300046664 Bacteria 1168
524 Ga0495669_0015892 3300046684 Bacteria 3223
525 Ga0495669_0023704 3300046684 Bacteria 2673
526 Ga0495669_0057886 3300046684 Bacteria 1749
527 Ga0495669_0101472 3300046684 Bacteria 1337
528 Ga0495670_0013239 3300046691 Bacteria 4057
529 Ga0495670_0022764 3300046691 Bacteria 3094
530 Ga0495670_0130331 3300046691 Bacteria 1310
531 Ga0495670_0187551 3300046691 Unclassified 1093
532 Ga0495670_0511414 3300046691 Bacteria 652
533 Ga0495636_0354513 3300047318 Bacteria 693
534 Ga0495681_0151139 3300047470 Bacteria 974
535 Ga0495615_0018556 3300048090 Bacteria 1533
536 Ga0496109_0497475 3300048912 Bacteria 1151
537 Ga0496111_0168166 3300048914 Bacteria 1629
538 Ga0496113_0642632 3300048916 Bacteria 849
539 Ga0495678_204492 3300049459 Bacteria 607
540 Ga0501067_0053918 3300049583 Bacteria 2228
541 Ga0501067_0296463 3300049583 Bacteria 900
542 Ga0501068_0102569 3300049584 Bacteria 1774
543 Ga0501069_0080570 3300049585 Bacteria 1834
544 nmdc:mga03683_649541_c1 3300050489 Bacteria 519
545 nmdc:mga08y16_697054_c1 3300050511 Bacteria 1016
546 Ga0500643_003137 3300053087 Bacteria 8092
547 Ga0500658_0000056 3300053134 Bacteria 57016
548 Ga0500568_0001526 3300053139 Bacteria 14737
549 Ga0500604_0000016 3300053151 Bacteria 91519
550 Ga0500616_0001532 3300053153 Bacteria 21748
551 Ga0530510_0301865 3300061734 Bacteria 1198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005438 Ga0070701_10302834 Ga0070701_103028341 104
2 3300026067 Ga0207678_10849549 Ga0207678_108495492 104
3 3300009551 Ga0105238_10499493 Ga0105238_104994932 105
4 3300013102 Ga0157371_11299603 Ga0157371_112996031 105
5 3300037418 Ga0395900_0268626 Ga0395900_0268626_21_338 105
6 3300049583 Ga0501067_0053918 Ga0501067_0053918_1142_1459 105
7 3300049584 Ga0501068_0102569 Ga0501068_0102569_473_790 105
8 3300049585 Ga0501069_0080570 Ga0501069_0080570_194_511 105
9 3300050489 nmdc:mga03683_649541_c1 nmdc:mga03683_649541_c1_17_334 105
10 3300061734 Ga0530510_0301865 Ga0530510_0301865_685_1002 105
11 3300005331 Ga0070670_100255840 Ga0070670_1002558402 111
12 3300005333 Ga0070677_10000409 Ga0070677_1000040912 111
13 3300005338 Ga0068868_101287313 Ga0068868_1012873131 111
14 3300005345 Ga0070692_10335723 Ga0070692_103357231 111
15 3300005539 Ga0068853_100314044 Ga0068853_1003140442 111
16 3300005563 Ga0068855_101501799 Ga0068855_1015017992 111
17 3300009148 Ga0105243_10749884 Ga0105243_107498842 111
18 3300025893 Ga0207682_10000745 Ga0207682_1000074514 111
19 3300025925 Ga0207650_10383060 Ga0207650_103830602 111
20 3300025925 Ga0207650_10539079 Ga0207650_105390792 111
21 3300026041 Ga0207639_10611447 Ga0207639_106114472 111
22 3300031548 Ga0307408_100307872 Ga0307408_1003078722 111
23 3300032002 Ga0307416_101091109 Ga0307416_1010911092 111
24 3300046539 Ga0495621_0500074 Ga0495621_0500074_173_508 111
25 3300001989 JGI24739J22299_10153475 JGI24739J22299_101534751 112
26 3300001990 JGI24737J22298_10002302 JGI24737J22298_100023022 112
27 3300002076 JGI24749J21850_1005496 JGI24749J21850_10054963 112
28 3300002239 JGI24034J26672_10083633 JGI24034J26672_100836332 112
29 3300005295 Ga0065707_10396434 Ga0065707_103964341 112
30 3300005328 Ga0070676_10012447 Ga0070676_100124477 112
31 3300005328 Ga0070676_10016131 Ga0070676_100161318 112
32 3300005331 Ga0070670_100006825 Ga0070670_1000068254 112
33 3300005331 Ga0070670_100080645 Ga0070670_1000806451 112
34 3300005331 Ga0070670_100315190 Ga0070670_1003151902 112
35 3300005331 Ga0070670_100505442 Ga0070670_1005054422 112
36 3300005331 Ga0070670_100959042 Ga0070670_1009590422 112
37 3300005333 Ga0070677_10116832 Ga0070677_101168321 112
38 3300005335 Ga0070666_10181711 Ga0070666_101817111 112
39 3300005336 Ga0070680_100004667 Ga0070680_1000046677 112
40 3300005336 Ga0070680_100551121 Ga0070680_1005511211 112
41 3300005337 Ga0070682_100655913 Ga0070682_1006559132 112
42 3300005338 Ga0068868_100176088 Ga0068868_1001760882 112
43 3300005339 Ga0070660_100110043 Ga0070660_1001100432 112
44 3300005344 Ga0070661_100000272 Ga0070661_10000027224 112
45 3300005347 Ga0070668_100001172 Ga0070668_10000117215 112
46 3300005353 Ga0070669_100001698 Ga0070669_10000169816 112
47 3300005353 Ga0070669_100277501 Ga0070669_1002775011 112
48 3300005354 Ga0070675_100032530 Ga0070675_1000325301 112
49 3300005354 Ga0070675_100062900 Ga0070675_1000629001 112
50 3300005354 Ga0070675_101585389 Ga0070675_1015853892 112
51 3300005355 Ga0070671_100121491 Ga0070671_1001214914 112
52 3300005355 Ga0070671_100137634 Ga0070671_1001376343 112
53 3300005356 Ga0070674_100022057 Ga0070674_1000220573 112
54 3300005356 Ga0070674_100037679 Ga0070674_1000376795 112
55 3300005356 Ga0070674_100232324 Ga0070674_1002323242 112
56 3300005356 Ga0070674_100740029 Ga0070674_1007400292 112
57 3300005356 Ga0070674_101089653 Ga0070674_1010896532 112
58 3300005364 Ga0070673_100020913 Ga0070673_1000209133 112
59 3300005364 Ga0070673_100106647 Ga0070673_1001066473 112
60 3300005365 Ga0070688_100371308 Ga0070688_1003713082 112
61 3300005366 Ga0070659_100046376 Ga0070659_1000463763 112
62 3300005366 Ga0070659_100049582 Ga0070659_1000495823 112
63 3300005367 Ga0070667_100023633 Ga0070667_1000236334 112
64 3300005367 Ga0070667_100690921 Ga0070667_1006909212 112
65 3300005438 Ga0070701_10062185 Ga0070701_100621853 112
66 3300005441 Ga0070700_101630227 Ga0070700_1016302271 112
67 3300005456 Ga0070678_100117715 Ga0070678_1001177152 112
68 3300005456 Ga0070678_100149564 Ga0070678_1001495643 112
69 3300005457 Ga0070662_100000872 Ga0070662_10000087210 112
70 3300005457 Ga0070662_100613466 Ga0070662_1006134662 112
71 3300005457 Ga0070662_100664342 Ga0070662_1006643421 112
72 3300005458 Ga0070681_10712174 Ga0070681_107121742 112
73 3300005459 Ga0068867_100049553 Ga0068867_1000495535 112
74 3300005530 Ga0070679_100000007 Ga0070679_10000000768 112
75 3300005539 Ga0068853_100243601 Ga0068853_1002436012 112
76 3300005539 Ga0068853_100451849 Ga0068853_1004518492 112
77 3300005543 Ga0070672_100001346 Ga0070672_10000134615 112
78 3300005543 Ga0070672_100106935 Ga0070672_1001069352 112
79 3300005543 Ga0070672_100629781 Ga0070672_1006297812 112
80 3300005548 Ga0070665_100162909 Ga0070665_1001629093 112
81 3300005549 Ga0070704_100560966 Ga0070704_1005609662 112
82 3300005564 Ga0070664_100433547 Ga0070664_1004335472 112
83 3300005577 Ga0068857_100162485 Ga0068857_1001624852 112
84 3300005577 Ga0068857_100378490 Ga0068857_1003784902 112
85 3300005578 Ga0068854_100273611 Ga0068854_1002736112 112
86 3300005616 Ga0068852_100395807 Ga0068852_1003958072 112
87 3300005617 Ga0068859_100001413 Ga0068859_10000141310 112
88 3300005618 Ga0068864_100725020 Ga0068864_1007250201 112
89 3300005718 Ga0068866_10051499 Ga0068866_100514993 112
90 3300005719 Ga0068861_100033598 Ga0068861_1000335987 112
91 3300005719 Ga0068861_100036059 Ga0068861_1000360592 112
92 3300005719 Ga0068861_101963076 Ga0068861_1019630762 112
93 3300005842 Ga0068858_100577129 Ga0068858_1005771292 112
94 3300005842 Ga0068858_100993751 Ga0068858_1009937512 112
95 3300005844 Ga0068862_100003883 Ga0068862_10000388310 112
96 3300005844 Ga0068862_100015095 Ga0068862_1000150959 112
97 3300005844 Ga0068862_100131992 Ga0068862_1001319924 112
98 3300005844 Ga0068862_100454922 Ga0068862_1004549222 112
99 3300006237 Ga0097621_100556028 Ga0097621_1005560282 112
100 3300006353 Ga0075370_10852680 Ga0075370_108526801 112
101 3300006358 Ga0068871_100594725 Ga0068871_1005947252 112
102 3300006358 Ga0068871_101363084 Ga0068871_1013630842 112
103 3300006844 Ga0075428_100087385 Ga0075428_1000873853 112
104 3300006844 Ga0075428_100557811 Ga0075428_1005578111 112
105 3300006881 Ga0068865_100997079 Ga0068865_1009970791 112
106 3300006931 Ga0097620_100001413 Ga0097620_10000141310 112
107 3300009094 Ga0111539_10272843 Ga0111539_102728432 112
108 3300009094 Ga0111539_10527498 Ga0111539_105274982 112
109 3300009094 Ga0111539_11545786 Ga0111539_115457862 112
110 3300009094 Ga0111539_11653951 Ga0111539_116539512 112
111 3300009101 Ga0105247_11820958 Ga0105247_118209581 112
112 3300009147 Ga0114129_10406806 Ga0114129_104068062 112
113 3300009148 Ga0105243_10006820 Ga0105243_100068209 112
114 3300009148 Ga0105243_10179346 Ga0105243_101793461 112
115 3300009177 Ga0105248_10300967 Ga0105248_103009673 112
116 3300009177 Ga0105248_12422094 Ga0105248_124220942 112
117 3300009553 Ga0105249_10009816 Ga0105249_1000981610 112
118 3300009553 Ga0105249_10189713 Ga0105249_101897133 112
119 3300012510 Ga0157316_1071842 Ga0157316_10718422 112
120 3300013100 Ga0157373_10009328 Ga0157373_100093286 112
121 3300013306 Ga0163162_10504511 Ga0163162_105045112 112
122 3300013307 Ga0157372_10205539 Ga0157372_102055392 112
123 3300013308 Ga0157375_10513023 Ga0157375_105130232 112
124 3300014325 Ga0163163_10644238 Ga0163163_106442382 112
125 3300014326 Ga0157380_10001109 Ga0157380_1000110912 112
126 3300014326 Ga0157380_10041906 Ga0157380_100419062 112
127 3300014326 Ga0157380_10083517 Ga0157380_100835173 112
128 3300014326 Ga0157380_10588109 Ga0157380_105881092 112
129 3300017792 Ga0163161_10124013 Ga0163161_101240132 112
130 3300017792 Ga0163161_10310840 Ga0163161_103108402 112
131 3300017792 Ga0163161_11017179 Ga0163161_110171791 112
132 3300021358 Ga0213873_10000006 Ga0213873_1000000621 112
133 3300021384 Ga0213876_10000004 Ga0213876_10000004527 112
134 3300025290 Ga0207673_1033113 Ga0207673_10331132 112
135 3300025315 Ga0207697_10019957 Ga0207697_100199572 112
136 3300025321 Ga0207656_10144517 Ga0207656_101445172 112
137 3300025893 Ga0207682_10036711 Ga0207682_100367112 112
138 3300025899 Ga0207642_10166430 Ga0207642_101664302 112
139 3300025901 Ga0207688_10072460 Ga0207688_100724603 112
140 3300025903 Ga0207680_10404372 Ga0207680_104043722 112
141 3300025904 Ga0207647_10010454 Ga0207647_100104543 112
142 3300025907 Ga0207645_10008043 Ga0207645_100080432 112
143 3300025907 Ga0207645_10021229 Ga0207645_100212292 112
144 3300025917 Ga0207660_10003431 Ga0207660_100034318 112
145 3300025919 Ga0207657_10064342 Ga0207657_100643423 112
146 3300025920 Ga0207649_10000074 Ga0207649_1000007474 112
147 3300025921 Ga0207652_10000001 Ga0207652_10000001653 112
148 3300025921 Ga0207652_10000002 Ga0207652_1000000274 112
149 3300025923 Ga0207681_10001010 Ga0207681_1000101012 112
150 3300025923 Ga0207681_11461624 Ga0207681_114616241 112
151 3300025925 Ga0207650_10002289 Ga0207650_100022894 112
152 3300025925 Ga0207650_10027941 Ga0207650_100279414 112
153 3300025925 Ga0207650_10060200 Ga0207650_100602004 112
154 3300025925 Ga0207650_10824043 Ga0207650_108240432 112
155 3300025926 Ga0207659_10001032 Ga0207659_100010328 112
156 3300025926 Ga0207659_10197466 Ga0207659_101974663 112
157 3300025931 Ga0207644_10025135 Ga0207644_100251352 112
158 3300025932 Ga0207690_10029733 Ga0207690_100297333 112
159 3300025932 Ga0207690_10402063 Ga0207690_104020632 112
160 3300025933 Ga0207706_10002470 Ga0207706_100024709 112
161 3300025933 Ga0207706_10345046 Ga0207706_103450462 112
162 3300025935 Ga0207709_10014236 Ga0207709_100142363 112
163 3300025935 Ga0207709_10132412 Ga0207709_101324122 112
164 3300025937 Ga0207669_10070582 Ga0207669_100705822 112
165 3300025937 Ga0207669_10461951 Ga0207669_104619512 112
166 3300025938 Ga0207704_10720226 Ga0207704_107202262 112
167 3300025938 Ga0207704_11866174 Ga0207704_118661741 112
168 3300025940 Ga0207691_10002177 Ga0207691_1000217712 112
169 3300025940 Ga0207691_10192010 Ga0207691_101920102 112
170 3300025940 Ga0207691_10354545 Ga0207691_103545452 112
171 3300025940 Ga0207691_10441937 Ga0207691_104419372 112
172 3300025941 Ga0207711_10055386 Ga0207711_100553863 112
173 3300025941 Ga0207711_10332622 Ga0207711_103326222 112
174 3300025941 Ga0207711_11317018 Ga0207711_113170182 112
175 3300025942 Ga0207689_11209748 Ga0207689_112097482 112
176 3300025945 Ga0207679_10225916 Ga0207679_102259163 112
177 3300025960 Ga0207651_10019330 Ga0207651_100193304 112
178 3300025960 Ga0207651_10039866 Ga0207651_100398662 112
179 3300025961 Ga0207712_10021099 Ga0207712_100210993 112
180 3300025961 Ga0207712_10242686 Ga0207712_102426862 112
181 3300025961 Ga0207712_10844020 Ga0207712_108440202 112
182 3300025972 Ga0207668_10000720 Ga0207668_1000072010 112
183 3300025972 Ga0207668_10639458 Ga0207668_106394582 112
184 3300025981 Ga0207640_10881896 Ga0207640_108818961 112
185 3300025986 Ga0207658_10055361 Ga0207658_100553614 112
186 3300025986 Ga0207658_10166201 Ga0207658_101662012 112
187 3300025986 Ga0207658_10224832 Ga0207658_102248322 112
188 3300026035 Ga0207703_11073871 Ga0207703_110738712 112
189 3300026041 Ga0207639_10208812 Ga0207639_102088122 112
190 3300026041 Ga0207639_10407725 Ga0207639_104077252 112
191 3300026089 Ga0207648_10029482 Ga0207648_100294823 112
192 3300026095 Ga0207676_10030447 Ga0207676_100304477 112
193 3300026095 Ga0207676_10198726 Ga0207676_101987263 112
194 3300026116 Ga0207674_10104516 Ga0207674_101045162 112
195 3300026118 Ga0207675_100016300 Ga0207675_1000163006 112
196 3300026118 Ga0207675_100026968 Ga0207675_1000269687 112
197 3300026118 Ga0207675_102477928 Ga0207675_1024779281 112
198 3300026121 Ga0207683_10183275 Ga0207683_101832753 112
199 3300026121 Ga0207683_10188762 Ga0207683_101887623 112
200 3300027907 Ga0207428_10139110 Ga0207428_101391103 112
201 3300027907 Ga0207428_10215502 Ga0207428_102155022 112
202 3300028379 Ga0268266_10227574 Ga0268266_102275742 112
203 3300028380 Ga0268265_10010196 Ga0268265_100101965 112
204 3300028380 Ga0268265_10010468 Ga0268265_100104688 112
205 3300028380 Ga0268265_10597177 Ga0268265_105971772 112
206 3300028380 Ga0268265_10714676 Ga0268265_107146761 112
207 3300031824 Ga0307413_11051068 Ga0307413_110510682 112
208 3300031852 Ga0307410_10009738 Ga0307410_100097385 112
209 3300031852 Ga0307410_10394514 Ga0307410_103945142 112
210 3300031901 Ga0307406_10741465 Ga0307406_107414652 112
211 3300031901 Ga0307406_11271070 Ga0307406_112710702 112
212 3300031995 Ga0307409_100258496 Ga0307409_1002584962 112
213 3300031995 Ga0307409_100309978 Ga0307409_1003099782 112
214 3300031995 Ga0307409_101541494 Ga0307409_1015414942 112
215 3300032002 Ga0307416_101034489 Ga0307416_1010344891 112
216 3300032002 Ga0307416_101289754 Ga0307416_1012897541 112
217 3300032004 Ga0307414_11234070 Ga0307414_112340702 112
218 3300032126 Ga0307415_100003990 Ga0307415_1000039908 112
219 3300032126 Ga0307415_100013623 Ga0307415_1000136231 112
220 3300032126 Ga0307415_100179931 Ga0307415_1001799312 112
221 3300037418 Ga0395900_1694136 Ga0395900_1694136_46_384 112
222 3300037471 Ga0395905_0084976 Ga0395905_0084976_2390_2728 112
223 3300037471 Ga0395905_0907141 Ga0395905_0907141_223_561 112
224 3300038443 Ga0395901_0143581 Ga0395901_0143581_870_1208 112
225 3300039437 Ga0436365_0970858 Ga0436365_0970858_109207_109545 112
226 3300039453 Ga0436362_0554113 Ga0436362_0554113_140435_140773 112
227 3300046500 Ga0495596_0138845 Ga0495596_0138845_26_364 112
228 3300046525 Ga0495663_0004724 Ga0495663_0004724_653_991 112
229 3300046525 Ga0495663_0020498 Ga0495663_0020498_1085_1423 112
230 3300046525 Ga0495663_0198703 Ga0495663_0198703_167_505 112
231 3300046537 Ga0495598_0119111 Ga0495598_0119111_36_374 112
232 3300046539 Ga0495621_0003057 Ga0495621_0003057_591_929 112
233 3300046539 Ga0495621_0010550 Ga0495621_0010550_1542_1880 112
234 3300046539 Ga0495621_0096819 Ga0495621_0096819_16_354 112
235 3300046539 Ga0495621_0283084 Ga0495621_0283084_297_635 112
236 3300046558 Ga0495633_0042747 Ga0495633_0042747_1496_1834 112
237 3300046558 Ga0495633_0414674 Ga0495633_0414674_31_369 112
238 3300046664 Ga0495659_0032397 Ga0495659_0032397_1181_1519 112
239 3300046664 Ga0495659_0043015 Ga0495659_0043015_599_937 112
240 3300046664 Ga0495659_0091609 Ga0495659_0091609_132_470 112
241 3300046684 Ga0495669_0015892 Ga0495669_0015892_1549_1887 112
242 3300046684 Ga0495669_0057886 Ga0495669_0057886_296_634 112
243 3300046691 Ga0495670_0013239 Ga0495670_0013239_1875_2213 112
244 3300046691 Ga0495670_0022764 Ga0495670_0022764_2222_2560 112
245 3300046691 Ga0495670_0130331 Ga0495670_0130331_211_549 112
246 3300046691 Ga0495670_0187551 Ga0495670_0187551_335_673 112
247 3300046691 Ga0495670_0511414 Ga0495670_0511414_206_544 112
248 3300047318 Ga0495636_0354513 Ga0495636_0354513_300_638 112
249 3300047470 Ga0495681_0151139 Ga0495681_0151139_375_713 112
250 3300048090 Ga0495615_0018556 Ga0495615_0018556_1097_1435 112
251 3300048912 Ga0496109_0497475 Ga0496109_0497475_187_525 112
252 3300048914 Ga0496111_0168166 Ga0496111_0168166_454_792 112
253 3300050511 nmdc:mga08y16_697054_c1 nmdc:mga08y16_697054_c1_202_540 112
254 3300053087 Ga0500643_003137 Ga0500643_003137_6961_7299 112
255 3300053139 Ga0500568_0001526 Ga0500568_0001526_1185_1523 112
256 3300053151 Ga0500604_0000016 Ga0500604_0000016_83750_84088 112
257 3300053153 Ga0500616_0001532 Ga0500616_0001532_13157_13495 112
258 3300046616 Ga0495668_0393283 Ga0495668_0393283_282_662 113
259 3300001979 JGI24740J21852_10002618 JGI24740J21852_100026186 114
260 3300001989 JGI24739J22299_10005894 JGI24739J22299_100058941 114
261 3300001990 JGI24737J22298_10000982 JGI24737J22298_100009826 114
262 3300002067 JGI24735J21928_10027166 JGI24735J21928_100271664 114
263 3300002075 JGI24738J21930_10000225 JGI24738J21930_100002256 114
264 3300002239 JGI24034J26672_10038436 JGI24034J26672_100384363 114
265 3300005327 Ga0070658_10308073 Ga0070658_103080732 114
266 3300005327 Ga0070658_10358515 Ga0070658_103585152 114
267 3300005328 Ga0070676_10004165 Ga0070676_100041657 114
268 3300005328 Ga0070676_10011595 Ga0070676_100115953 114
269 3300005328 Ga0070676_11054098 Ga0070676_110540981 114
270 3300005331 Ga0070670_100071703 Ga0070670_1000717035 114
271 3300005331 Ga0070670_100182001 Ga0070670_1001820014 114
272 3300005331 Ga0070670_100278395 Ga0070670_1002783952 114
273 3300005331 Ga0070670_100791446 Ga0070670_1007914462 114
274 3300005334 Ga0068869_100000883 Ga0068869_1000008837 114
275 3300005335 Ga0070666_10008626 Ga0070666_100086266 114
276 3300005336 Ga0070680_101180336 Ga0070680_1011803361 114
277 3300005337 Ga0070682_100228187 Ga0070682_1002281872 114
278 3300005337 Ga0070682_100347097 Ga0070682_1003470972 114
279 3300005337 Ga0070682_100381145 Ga0070682_1003811452 114
280 3300005338 Ga0068868_100002544 Ga0068868_1000025449 114
281 3300005338 Ga0068868_100157295 Ga0068868_1001572953 114
282 3300005338 Ga0068868_100203355 Ga0068868_1002033553 114
283 3300005339 Ga0070660_100005685 Ga0070660_1000056859 114
284 3300005339 Ga0070660_101019908 Ga0070660_1010199081 114
285 3300005341 Ga0070691_10551209 Ga0070691_105512092 114
286 3300005344 Ga0070661_100030233 Ga0070661_1000302336 114
287 3300005344 Ga0070661_100046697 Ga0070661_1000466972 114
288 3300005344 Ga0070661_101249344 Ga0070661_1012493441 114
289 3300005347 Ga0070668_100294714 Ga0070668_1002947143 114
290 3300005353 Ga0070669_100000209 Ga0070669_10000020945 114
291 3300005353 Ga0070669_100172557 Ga0070669_1001725571 114
292 3300005353 Ga0070669_101784459 Ga0070669_1017844591 114
293 3300005354 Ga0070675_100010717 Ga0070675_1000107179 114
294 3300005355 Ga0070671_100021416 Ga0070671_1000214164 114
295 3300005355 Ga0070671_100029290 Ga0070671_1000292901 114
296 3300005355 Ga0070671_101759452 Ga0070671_1017594521 114
297 3300005356 Ga0070674_100038936 Ga0070674_1000389365 114
298 3300005356 Ga0070674_100617953 Ga0070674_1006179532 114
299 3300005364 Ga0070673_100000352 Ga0070673_10000035212 114
300 3300005364 Ga0070673_100019068 Ga0070673_1000190686 114
301 3300005364 Ga0070673_100236669 Ga0070673_1002366693 114
302 3300005364 Ga0070673_100572246 Ga0070673_1005722462 114
303 3300005366 Ga0070659_100006335 Ga0070659_1000063355 114
304 3300005366 Ga0070659_100130790 Ga0070659_1001307903 114
305 3300005367 Ga0070667_100005469 Ga0070667_1000054697 114
306 3300005367 Ga0070667_100007891 Ga0070667_10000789110 114
307 3300005367 Ga0070667_100071468 Ga0070667_1000714684 114
308 3300005455 Ga0070663_100165933 Ga0070663_1001659333 114
309 3300005455 Ga0070663_100696817 Ga0070663_1006968172 114
310 3300005457 Ga0070662_100021934 Ga0070662_1000219343 114
311 3300005457 Ga0070662_100030559 Ga0070662_1000305596 114
312 3300005457 Ga0070662_100048157 Ga0070662_1000481574 114
313 3300005457 Ga0070662_100178602 Ga0070662_1001786021 114
314 3300005457 Ga0070662_100747099 Ga0070662_1007470992 114
315 3300005458 Ga0070681_10108684 Ga0070681_101086843 114
316 3300005459 Ga0068867_100001039 Ga0068867_10000103912 114
317 3300005459 Ga0068867_100003944 Ga0068867_1000039448 114
318 3300005459 Ga0068867_100581663 Ga0068867_1005816632 114
319 3300005539 Ga0068853_100001894 Ga0068853_1000018948 114
320 3300005539 Ga0068853_100123391 Ga0068853_1001233912 114
321 3300005539 Ga0068853_100466532 Ga0068853_1004665322 114
322 3300005543 Ga0070672_100010251 Ga0070672_1000102515 114
323 3300005543 Ga0070672_100176258 Ga0070672_1001762582 114
324 3300005543 Ga0070672_100531865 Ga0070672_1005318652 114
325 3300005543 Ga0070672_101105927 Ga0070672_1011059272 114
326 3300005544 Ga0070686_100663391 Ga0070686_1006633912 114
327 3300005546 Ga0070696_100020263 Ga0070696_1000202633 114
328 3300005547 Ga0070693_100021588 Ga0070693_1000215883 114
329 3300005547 Ga0070693_100364689 Ga0070693_1003646892 114
330 3300005548 Ga0070665_100022459 Ga0070665_1000224593 114
331 3300005548 Ga0070665_100322652 Ga0070665_1003226523 114
332 3300005548 Ga0070665_100745284 Ga0070665_1007452842 114
333 3300005548 Ga0070665_100869750 Ga0070665_1008697502 114
334 3300005548 Ga0070665_101574190 Ga0070665_1015741902 114
335 3300005563 Ga0068855_100277549 Ga0068855_1002775493 114
336 3300005564 Ga0070664_100122115 Ga0070664_1001221153 114
337 3300005564 Ga0070664_100297348 Ga0070664_1002973483 114
338 3300005564 Ga0070664_100532597 Ga0070664_1005325972 114
339 3300005564 Ga0070664_100597702 Ga0070664_1005977023 114
340 3300005564 Ga0070664_100799569 Ga0070664_1007995693 114
341 3300005577 Ga0068857_100002254 Ga0068857_1000022549 114
342 3300005577 Ga0068857_100010923 Ga0068857_1000109237 114
343 3300005577 Ga0068857_100398677 Ga0068857_1003986771 114
344 3300005578 Ga0068854_100001334 Ga0068854_1000013346 114
345 3300005578 Ga0068854_100047373 Ga0068854_1000473732 114
346 3300005578 Ga0068854_100089731 Ga0068854_1000897311 114
347 3300005578 Ga0068854_100554164 Ga0068854_1005541642 114
348 3300005578 Ga0068854_100837674 Ga0068854_1008376742 114
349 3300005615 Ga0070702_100063607 Ga0070702_1000636072 114
350 3300005616 Ga0068852_100000562 Ga0068852_1000005623 114
351 3300005616 Ga0068852_100013117 Ga0068852_1000131174 114
352 3300005616 Ga0068852_100633251 Ga0068852_1006332513 114
353 3300005616 Ga0068852_101601572 Ga0068852_1016015721 114
354 3300005617 Ga0068859_100000934 Ga0068859_10000093430 114
355 3300005617 Ga0068859_100006555 Ga0068859_1000065555 114
356 3300005617 Ga0068859_100090424 Ga0068859_1000904243 114
357 3300005617 Ga0068859_100272495 Ga0068859_1002724952 114
358 3300005617 Ga0068859_100843356 Ga0068859_1008433562 114
359 3300005618 Ga0068864_100000557 Ga0068864_10000055710 114
360 3300005618 Ga0068864_100004852 Ga0068864_1000048529 114
361 3300005618 Ga0068864_100326890 Ga0068864_1003268903 114
362 3300005618 Ga0068864_102409962 Ga0068864_1024099622 114
363 3300005718 Ga0068866_10010606 Ga0068866_100106066 114
364 3300005718 Ga0068866_10609981 Ga0068866_106099812 114
365 3300005719 Ga0068861_100503179 Ga0068861_1005031792 114
366 3300005834 Ga0068851_10052968 Ga0068851_100529683 114
367 3300005834 Ga0068851_10435989 Ga0068851_104359892 114
368 3300005840 Ga0068870_10163151 Ga0068870_101631512 114
369 3300005841 Ga0068863_100000569 Ga0068863_10000056911 114
370 3300005841 Ga0068863_100002262 Ga0068863_10000226212 114
371 3300005841 Ga0068863_100055894 Ga0068863_1000558946 114
372 3300005841 Ga0068863_100085182 Ga0068863_1000851824 114
373 3300005842 Ga0068858_100000604 Ga0068858_10000060412 114
374 3300005842 Ga0068858_100036747 Ga0068858_1000367475 114
375 3300005842 Ga0068858_100156506 Ga0068858_1001565063 114
376 3300005843 Ga0068860_100004166 Ga0068860_10000416611 114
377 3300005843 Ga0068860_100006108 Ga0068860_1000061089 114
378 3300005843 Ga0068860_100012161 Ga0068860_1000121617 114
379 3300005843 Ga0068860_100076494 Ga0068860_1000764941 114
380 3300005843 Ga0068860_100213214 Ga0068860_1002132142 114
381 3300005843 Ga0068860_101015806 Ga0068860_1010158062 114
382 3300005844 Ga0068862_100007390 Ga0068862_1000073909 114
383 3300005844 Ga0068862_100018824 Ga0068862_1000188247 114
384 3300005844 Ga0068862_100074895 Ga0068862_1000748953 114
385 3300005844 Ga0068862_100212495 Ga0068862_1002124953 114
386 3300005844 Ga0068862_100379093 Ga0068862_1003790932 114
387 3300005844 Ga0068862_101563514 Ga0068862_1015635141 114
388 3300006237 Ga0097621_100066788 Ga0097621_1000667885 114
389 3300006358 Ga0068871_100249552 Ga0068871_1002495523 114
390 3300006881 Ga0068865_100001568 Ga0068865_10000156812 114
391 3300006931 Ga0097620_100000934 Ga0097620_1000009344 114
392 3300006931 Ga0097620_100006555 Ga0097620_10000655513 114
393 3300006931 Ga0097620_100090415 Ga0097620_1000904153 114
394 3300006931 Ga0097620_100272478 Ga0097620_1002724782 114
395 3300006931 Ga0097620_100843318 Ga0097620_1008433182 114
396 3300009011 Ga0105251_10131863 Ga0105251_101318632 114
397 3300009092 Ga0105250_10002090 Ga0105250_1000209010 114
398 3300009093 Ga0105240_11684078 Ga0105240_116840781 114
399 3300009098 Ga0105245_10000120 Ga0105245_1000012032 114
400 3300009148 Ga0105243_10042672 Ga0105243_100426724 114
401 3300009148 Ga0105243_10152717 Ga0105243_101527172 114
402 3300009174 Ga0105241_10526958 Ga0105241_105269582 114
403 3300009177 Ga0105248_10000070 Ga0105248_1000007040 114
404 3300009177 Ga0105248_10000256 Ga0105248_100002569 114
405 3300009177 Ga0105248_10020775 Ga0105248_100207754 114
406 3300009177 Ga0105248_10146181 Ga0105248_101461814 114
407 3300009551 Ga0105238_10060199 Ga0105238_100601993 114
408 3300009553 Ga0105249_10050539 Ga0105249_100505395 114
409 3300009553 Ga0105249_10199692 Ga0105249_101996921 114
410 3300010375 Ga0105239_10212011 Ga0105239_102120114 114
411 3300011119 Ga0105246_10005610 Ga0105246_100056108 114
412 3300013100 Ga0157373_10005063 Ga0157373_1000506310 114
413 3300013100 Ga0157373_10132767 Ga0157373_101327672 114
414 3300013102 Ga0157371_10002887 Ga0157371_100028876 114
415 3300013296 Ga0157374_10171806 Ga0157374_101718062 114
416 3300013297 Ga0157378_10002232 Ga0157378_1000223219 114
417 3300013306 Ga0163162_10104977 Ga0163162_101049772 114
418 3300013306 Ga0163162_10158104 Ga0163162_101581043 114
419 3300013306 Ga0163162_12157599 Ga0163162_121575991 114
420 3300013307 Ga0157372_10272427 Ga0157372_102724273 114
421 3300013308 Ga0157375_10047139 Ga0157375_100471396 114
422 3300014325 Ga0163163_10000135 Ga0163163_1000013558 114
423 3300014745 Ga0157377_10103439 Ga0157377_101034393 114
424 3300014968 Ga0157379_10010929 Ga0157379_1001092911 114
425 3300014968 Ga0157379_10429283 Ga0157379_104292832 114
426 3300014968 Ga0157379_10758336 Ga0157379_107583362 114
427 3300025315 Ga0207697_10000260 Ga0207697_1000026028 114
428 3300025711 Ga0207696_1068461 Ga0207696_10684612 114
429 3300025735 Ga0207713_1117251 Ga0207713_11172512 114
430 3300025899 Ga0207642_10008911 Ga0207642_100089116 114
431 3300025899 Ga0207642_11044865 Ga0207642_110448651 114
432 3300025901 Ga0207688_10002688 Ga0207688_100026889 114
433 3300025901 Ga0207688_10011260 Ga0207688_100112605 114
434 3300025901 Ga0207688_10221917 Ga0207688_102219172 114
435 3300025904 Ga0207647_10000052 Ga0207647_1000005257 114
436 3300025907 Ga0207645_10003687 Ga0207645_1000368712 114
437 3300025907 Ga0207645_10241221 Ga0207645_102412212 114
438 3300025908 Ga0207643_10812135 Ga0207643_108121352 114
439 3300025909 Ga0207705_10081987 Ga0207705_100819871 114
440 3300025909 Ga0207705_10153664 Ga0207705_101536643 114
441 3300025911 Ga0207654_10326771 Ga0207654_103267712 114
442 3300025912 Ga0207707_10392866 Ga0207707_103928662 114
443 3300025919 Ga0207657_10008714 Ga0207657_100087148 114
444 3300025919 Ga0207657_11367569 Ga0207657_113675692 114
445 3300025920 Ga0207649_10012068 Ga0207649_100120687 114
446 3300025920 Ga0207649_10100543 Ga0207649_101005432 114
447 3300025920 Ga0207649_10301332 Ga0207649_103013322 114
448 3300025920 Ga0207649_10974118 Ga0207649_109741181 114
449 3300025923 Ga0207681_10004465 Ga0207681_100044653 114
450 3300025923 Ga0207681_10065507 Ga0207681_100655074 114
451 3300025923 Ga0207681_10498734 Ga0207681_104987342 114
452 3300025924 Ga0207694_10024119 Ga0207694_100241196 114
453 3300025925 Ga0207650_10289016 Ga0207650_102890162 114
454 3300025926 Ga0207659_10024359 Ga0207659_100243594 114
455 3300025931 Ga0207644_10025528 Ga0207644_100255285 114
456 3300025932 Ga0207690_10032858 Ga0207690_100328582 114
457 3300025932 Ga0207690_11177136 Ga0207690_111771362 114
458 3300025933 Ga0207706_10001178 Ga0207706_1000117826 114
459 3300025933 Ga0207706_10140935 Ga0207706_101409353 114
460 3300025933 Ga0207706_10149546 Ga0207706_101495462 114
461 3300025933 Ga0207706_10332364 Ga0207706_103323643 114
462 3300025935 Ga0207709_10152680 Ga0207709_101526802 114
463 3300025935 Ga0207709_11152835 Ga0207709_111528351 114
464 3300025937 Ga0207669_10030861 Ga0207669_100308614 114
465 3300025937 Ga0207669_11131367 Ga0207669_111313672 114
466 3300025938 Ga0207704_10003302 Ga0207704_100033029 114
467 3300025938 Ga0207704_11309909 Ga0207704_113099092 114
468 3300025940 Ga0207691_10000114 Ga0207691_1000011417 114
469 3300025940 Ga0207691_11488766 Ga0207691_114887662 114
470 3300025941 Ga0207711_10000051 Ga0207711_10000051115 114
471 3300025941 Ga0207711_10005174 Ga0207711_1000517412 114
472 3300025941 Ga0207711_10013598 Ga0207711_100135985 114
473 3300025942 Ga0207689_10000014 Ga0207689_1000001461 114
474 3300025942 Ga0207689_10184188 Ga0207689_101841881 114
475 3300025945 Ga0207679_10136454 Ga0207679_101364542 114
476 3300025945 Ga0207679_10145787 Ga0207679_101457872 114
477 3300025945 Ga0207679_10562112 Ga0207679_105621123 114
478 3300025945 Ga0207679_10737308 Ga0207679_107373082 114
479 3300025949 Ga0207667_10472778 Ga0207667_104727782 114
480 3300025960 Ga0207651_10000066 Ga0207651_1000006616 114
481 3300025960 Ga0207651_10012422 Ga0207651_100124224 114
482 3300025960 Ga0207651_10627182 Ga0207651_106271822 114
483 3300025961 Ga0207712_10346220 Ga0207712_103462204 114
484 3300025972 Ga0207668_10134481 Ga0207668_101344813 114
485 3300025972 Ga0207668_10167236 Ga0207668_101672361 114
486 3300025972 Ga0207668_10379531 Ga0207668_103795313 114
487 3300025981 Ga0207640_10005977 Ga0207640_100059779 114
488 3300025981 Ga0207640_10013873 Ga0207640_100138732 114
489 3300025981 Ga0207640_10745527 Ga0207640_107455272 114
490 3300025986 Ga0207658_10003422 Ga0207658_1000342210 114
491 3300025986 Ga0207658_10052096 Ga0207658_100520964 114
492 3300025986 Ga0207658_11333033 Ga0207658_113330332 114
493 3300025986 Ga0207658_11416926 Ga0207658_114169262 114
494 3300026023 Ga0207677_10033710 Ga0207677_100337102 114
495 3300026023 Ga0207677_10391617 Ga0207677_103916172 114
496 3300026035 Ga0207703_10003761 Ga0207703_100037616 114
497 3300026035 Ga0207703_10032547 Ga0207703_100325476 114
498 3300026035 Ga0207703_10109588 Ga0207703_101095884 114
499 3300026041 Ga0207639_10327992 Ga0207639_103279922 114
500 3300026041 Ga0207639_10657046 Ga0207639_106570462 114
501 3300026067 Ga0207678_10009335 Ga0207678_100093354 114
502 3300026067 Ga0207678_10140323 Ga0207678_101403232 114
503 3300026067 Ga0207678_10384462 Ga0207678_103844622 114
504 3300026067 Ga0207678_10695294 Ga0207678_106952942 114
505 3300026088 Ga0207641_10000190 Ga0207641_1000019013 114
506 3300026088 Ga0207641_10019664 Ga0207641_100196646 114
507 3300026088 Ga0207641_10070975 Ga0207641_100709752 114
508 3300026088 Ga0207641_10629555 Ga0207641_106295553 114
509 3300026089 Ga0207648_10001420 Ga0207648_1000142026 114
510 3300026089 Ga0207648_10013151 Ga0207648_100131516 114
511 3300026095 Ga0207676_10000139 Ga0207676_1000013945 114
512 3300026095 Ga0207676_10000259 Ga0207676_100002593 114
513 3300026095 Ga0207676_11364243 Ga0207676_113642431 114
514 3300026116 Ga0207674_10000244 Ga0207674_100002449 114
515 3300026116 Ga0207674_10014008 Ga0207674_100140087 114
516 3300026118 Ga0207675_100038995 Ga0207675_1000389954 114
517 3300026118 Ga0207675_100047074 Ga0207675_1000470745 114
518 3300026118 Ga0207675_100376256 Ga0207675_1003762562 114
519 3300026118 Ga0207675_100478420 Ga0207675_1004784203 114
520 3300026142 Ga0207698_10008286 Ga0207698_100082869 114
521 3300026142 Ga0207698_10092373 Ga0207698_100923732 114
522 3300028379 Ga0268266_10075981 Ga0268266_100759811 114
523 3300028379 Ga0268266_10211577 Ga0268266_102115773 114
524 3300028379 Ga0268266_11027703 Ga0268266_110277032 114
525 3300028380 Ga0268265_10004697 Ga0268265_100046974 114
526 3300028380 Ga0268265_10014260 Ga0268265_100142608 114
527 3300028380 Ga0268265_10052394 Ga0268265_100523946 114
528 3300028380 Ga0268265_10069307 Ga0268265_100693072 114
529 3300028380 Ga0268265_10154011 Ga0268265_101540113 114
530 3300028380 Ga0268265_10366955 Ga0268265_103669552 114
531 3300028381 Ga0268264_10001693 Ga0268264_1000169313 114
532 3300028381 Ga0268264_10307555 Ga0268264_103075553 114
533 3300028381 Ga0268264_11498602 Ga0268264_114986022 114
534 3300031456 Ga0307513_10082836 Ga0307513_100828364 114
535 3300031456 Ga0307513_10691603 Ga0307513_106916032 114
536 3300031548 Ga0307408_100526436 Ga0307408_1005264362 114
537 3300031852 Ga0307410_10665097 Ga0307410_106650972 114
538 3300031901 Ga0307406_10235821 Ga0307406_102358212 114
539 3300032126 Ga0307415_100203815 Ga0307415_1002038152 114
540 3300037418 Ga0395900_0034421 Ga0395900_0034421_2757_3101 114
541 3300037418 Ga0395900_0099886 Ga0395900_0099886_1301_1675 114
542 3300037471 Ga0395905_0789967 Ga0395905_0789967_191_535 114
543 3300038443 Ga0395901_0118329 Ga0395901_0118329_126_470 114
544 3300038443 Ga0395901_0154411 Ga0395901_0154411_38_412 114
545 3300046616 Ga0495668_0004232 Ga0495668_0004232_2569_2913 114
546 3300046684 Ga0495669_0023704 Ga0495669_0023704_1270_1614 114
547 3300046684 Ga0495669_0101472 Ga0495669_0101472_971_1315 114
548 3300048916 Ga0496113_0642632 Ga0496113_0642632_195_539 114
549 3300049459 Ga0495678_204492 Ga0495678_204492_164_508 114
550 3300049583 Ga0501067_0296463 Ga0501067_0296463_501_860 114
551 3300053134 Ga0500658_0000056 Ga0500658_0000056_46820_47164 114

Structural Annotation

Top 5 Hits

ID Description Score Start End
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.8358 62 108
4iag-assembly1.cif.gz_A-2 crystal structure of zbma, the zorbamycin binding protein from streptomyces flavoviridis 0.8235 60 110
5cj3-assembly1.cif.gz_B crystal structure of the zorbamycin binding protein (zbma) from streptomyces flavoviridis with zorbamycin 0.823 60 112
3r6a-assembly1.cif.gz_B crystal structure of an uncharacterized protein (hypothetical protein mm_3218) from methanosarcina mazei. 0.8199 62 114
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8173 62 110
ID Description Score Start End Superfamily
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8503 62 108 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8355 60 108 3.10.180.10
af_Q2FYM3_64_210_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8206 60 108 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8185 62 111 3.10.180.10
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8173 62 110 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2T5J7Z7-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9451 61 108 GO:0016829
GO:0051213
AF-A0A7W0U3G2-F1-model_v4 VOC family protein 0.9202 60 109
AF-A0A2T5NVJ7-F1-model_v4 deleted 0.9144 61 110
AF-A0A2A4LEQ0-F1-model_v4 VOC domain-containing protein 0.9045 57 110
AF-A0A2T5TX50-F1-model_v4 Enzyme related to lactoylglutathione lyase 0.9029 61 114

Feature Viewer

pLDDT pTM Quality
83.28 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map