F462637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 551 | 257 | 1102 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0023097|Ga0395899_0023097_2814_3719 |
| Length | 301 |
| Sequence | MAETRTVKLTSPDRVLYPDDGITKGDVFEYYNQVGPTIVPHLKNRPFTMKRYPHGITGEVFFQKQAPKGMPDWIPTRQFRTLPRDGGPRLVDFPLVNTSEAVLYMVQMNCVDMNAWYSRVDKPDRPDFVLFDLDPPDDGFELAIEVAHLIHELLDEVDLPGYVKTSGADGIHVVAPITRRSTFEQTYHFAEQASRLLERRHPGKVTTEWLKKKREGVLVDHRQNGHGKTIASVYSVRPKPGAPVSTPLRWEELTLDVRPRDFGMSEALARIDRYGDLFGPVLDDARPLAPAARKLNRVGSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 121 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 130 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 149 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 150 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 151 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 152 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.98 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0023097 | 3300037312 | Bacteria | 4713 |
| 2 | Ga0070683_100029766 | 3300005329 | Bacteria | 4948 |
| 3 | Ga0068869_100419745 | 3300005334 | Bacteria | 1103 |
| 4 | Ga0070680_100028046 | 3300005336 | Bacteria | 4514 |
| 5 | Ga0068868_100290432 | 3300005338 | Bacteria | 1386 |
| 6 | Ga0070660_100021788 | 3300005339 | Unclassified | 4729 |
| 7 | Ga0070660_100092091 | 3300005339 | Bacteria | 2392 |
| 8 | Ga0070660_100173668 | 3300005339 | Unclassified | 1742 |
| 9 | Ga0070691_10109754 | 3300005341 | Bacteria | 1379 |
| 10 | Ga0070687_100031585 | 3300005343 | Bacteria | 2599 |
| 11 | Ga0070671_100057259 | 3300005355 | Bacteria | 3244 |
| 12 | Ga0070659_100222432 | 3300005366 | Bacteria | 1558 |
| 13 | Ga0070703_10014462 | 3300005406 | Unclassified | 2249 |
| 14 | Ga0070709_10009989 | 3300005434 | Bacteria | 5248 |
| 15 | Ga0070709_10243254 | 3300005434 | Unclassified | 1293 |
| 16 | Ga0070709_10247527 | 3300005434 | Bacteria | 1283 |
| 17 | Ga0070714_100012162 | 3300005435 | Bacteria | 6858 |
| 18 | Ga0070714_100012238 | 3300005435 | Bacteria | 6843 |
| 19 | Ga0070714_100013409 | 3300005435 | Bacteria | 6569 |
| 20 | Ga0070714_100014140 | 3300005435 | Bacteria | 6408 |
| 21 | Ga0070714_100034096 | 3300005435 | Bacteria | 4261 |
| 22 | Ga0070714_100055604 | 3300005435 | Bacteria | 3383 |
| 23 | Ga0070714_100075815 | 3300005435 | Bacteria | 2918 |
| 24 | Ga0070714_100082595 | 3300005435 | Bacteria | 2800 |
| 25 | Ga0070714_100097537 | 3300005435 | Bacteria | 2584 |
| 26 | Ga0070713_100097255 | 3300005436 | Bacteria | 2543 |
| 27 | Ga0070710_10016677 | 3300005437 | Bacteria | 3742 |
| 28 | Ga0070710_10031338 | 3300005437 | Bacteria | 2869 |
| 29 | Ga0070710_10033839 | 3300005437 | Bacteria | 2777 |
| 30 | Ga0070711_100011924 | 3300005439 | Bacteria | 5410 |
| 31 | Ga0070711_100053598 | 3300005439 | Bacteria | 2780 |
| 32 | Ga0070711_100093717 | 3300005439 | Bacteria | 2169 |
| 33 | Ga0070705_100168257 | 3300005440 | Bacteria | 1472 |
| 34 | Ga0070700_100021598 | 3300005441 | Bacteria | 3743 |
| 35 | Ga0070694_100024833 | 3300005444 | Bacteria | 3871 |
| 36 | Ga0070694_100244449 | 3300005444 | Bacteria | 1355 |
| 37 | Ga0070663_100050643 | 3300005455 | Bacteria | 2955 |
| 38 | Ga0070678_100200028 | 3300005456 | Bacteria | 1648 |
| 39 | Ga0070662_100059566 | 3300005457 | Bacteria | 2782 |
| 40 | Ga0070662_100065747 | 3300005457 | Bacteria | 2659 |
| 41 | Ga0070662_100173109 | 3300005457 | Bacteria | 1697 |
| 42 | Ga0070681_10141601 | 3300005458 | Bacteria | 2334 |
| 43 | Ga0068867_100147128 | 3300005459 | Bacteria | 1847 |
| 44 | Ga0068867_100168045 | 3300005459 | Bacteria | 1735 |
| 45 | Ga0070706_100035844 | 3300005467 | Bacteria | 4581 |
| 46 | Ga0070706_100126059 | 3300005467 | Bacteria | 2388 |
| 47 | Ga0070706_100213817 | 3300005467 | Unclassified | 1800 |
| 48 | Ga0070707_100002571 | 3300005468 | Bacteria | 17241 |
| 49 | Ga0070707_100647111 | 3300005468 | Bacteria | 1020 |
| 50 | Ga0070698_100005325 | 3300005471 | Bacteria | 14083 |
| 51 | Ga0070698_100022232 | 3300005471 | Bacteria | 6637 |
| 52 | Ga0070698_100256393 | 3300005471 | Bacteria | 1681 |
| 53 | Ga0070699_100109897 | 3300005518 | Bacteria | 2420 |
| 54 | Ga0070699_100138235 | 3300005518 | Unclassified | 2150 |
| 55 | Ga0070684_100051554 | 3300005535 | Bacteria | 3575 |
| 56 | Ga0070684_100512278 | 3300005535 | Bacteria | 1112 |
| 57 | Ga0070697_100177663 | 3300005536 | Unclassified | 1804 |
| 58 | Ga0070686_100081593 | 3300005544 | Bacteria | 2142 |
| 59 | Ga0070695_100000007 | 3300005545 | Bacteria | 89343 |
| 60 | Ga0070695_100035320 | 3300005545 | Bacteria | 3140 |
| 61 | Ga0070695_100380801 | 3300005545 | Bacteria | 1065 |
| 62 | Ga0070696_100068802 | 3300005546 | Bacteria | 2486 |
| 63 | Ga0070696_100087218 | 3300005546 | Unclassified | 2217 |
| 64 | Ga0070696_100223116 | 3300005546 | Bacteria | 1415 |
| 65 | Ga0070693_100008434 | 3300005547 | Bacteria | 5081 |
| 66 | Ga0070693_100022759 | 3300005547 | Bacteria | 3338 |
| 67 | Ga0070704_100041512 | 3300005549 | Bacteria | 3175 |
| 68 | Ga0070704_100140900 | 3300005549 | Bacteria | 1882 |
| 69 | Ga0068855_100043432 | 3300005563 | Bacteria | 5324 |
| 70 | Ga0068855_100353388 | 3300005563 | Bacteria | 1619 |
| 71 | Ga0070664_100124093 | 3300005564 | Bacteria | 2263 |
| 72 | Ga0068854_100084988 | 3300005578 | Bacteria | 2342 |
| 73 | Ga0068856_100051745 | 3300005614 | Bacteria | 4049 |
| 74 | Ga0068856_100088003 | 3300005614 | Bacteria | 3088 |
| 75 | Ga0068856_100129863 | 3300005614 | Bacteria | 2524 |
| 76 | Ga0070702_100020231 | 3300005615 | Bacteria | 3482 |
| 77 | Ga0070702_100062955 | 3300005615 | Bacteria | 2164 |
| 78 | Ga0068861_100004866 | 3300005719 | Bacteria | 9035 |
| 79 | Ga0068861_100014430 | 3300005719 | Bacteria | 5545 |
| 80 | Ga0081538_10000647 | 3300005981 | Bacteria | 38507 |
| 81 | Ga0081538_10050009 | 3300005981 | Bacteria | 2530 |
| 82 | Ga0081540_1003762 | 3300005983 | Bacteria | 11888 |
| 83 | Ga0070717_10020676 | 3300006028 | Bacteria | 5181 |
| 84 | Ga0070717_10035212 | 3300006028 | Bacteria | 4051 |
| 85 | Ga0070717_10071869 | 3300006028 | Bacteria | 2888 |
| 86 | Ga0070717_10152595 | 3300006028 | Unclassified | 1999 |
| 87 | Ga0070715_10000593 | 3300006163 | Bacteria | 9538 |
| 88 | Ga0070715_10024115 | 3300006163 | Bacteria | 2392 |
| 89 | Ga0070716_100002850 | 3300006173 | Bacteria | 8054 |
| 90 | Ga0070716_100035041 | 3300006173 | Unclassified | 2757 |
| 91 | Ga0070716_100156842 | 3300006173 | Bacteria | 1470 |
| 92 | Ga0070712_100009760 | 3300006175 | Bacteria | 6049 |
| 93 | Ga0070712_100009820 | 3300006175 | Bacteria | 6031 |
| 94 | Ga0070712_100056825 | 3300006175 | Bacteria | 2746 |
| 95 | Ga0070712_100128908 | 3300006175 | Unclassified | 1915 |
| 96 | Ga0097621_100038303 | 3300006237 | Bacteria | 3847 |
| 97 | Ga0068871_100013346 | 3300006358 | Bacteria | 6097 |
| 98 | Ga0075428_100044792 | 3300006844 | Bacteria | 4862 |
| 99 | Ga0075433_10019735 | 3300006852 | Bacteria | 5624 |
| 100 | Ga0075433_10207500 | 3300006852 | Bacteria | 1742 |
| 101 | Ga0075433_10329391 | 3300006852 | Bacteria | 1350 |
| 102 | Ga0075434_100036223 | 3300006871 | Bacteria | 4881 |
| 103 | Ga0075434_100211597 | 3300006871 | Bacteria | 1959 |
| 104 | Ga0075436_100086629 | 3300006914 | Unclassified | 2175 |
| 105 | Ga0105240_10250623 | 3300009093 | Bacteria | 2048 |
| 106 | Ga0111539_10010446 | 3300009094 | Bacteria | 11685 |
| 107 | Ga0111539_10076548 | 3300009094 | Bacteria | 3939 |
| 108 | Ga0111539_10305665 | 3300009094 | Bacteria | 1851 |
| 109 | Ga0105245_10027933 | 3300009098 | Unclassified | 4973 |
| 110 | Ga0105245_10056511 | 3300009098 | Bacteria | 3527 |
| 111 | Ga0105245_10078122 | 3300009098 | Bacteria | 3020 |
| 112 | Ga0105245_10138923 | 3300009098 | Bacteria | 2286 |
| 113 | Ga0105245_10406891 | 3300009098 | Bacteria | 1361 |
| 114 | Ga0105247_10021905 | 3300009101 | Bacteria | 3845 |
| 115 | Ga0114129_10011007 | 3300009147 | Bacteria | 12887 |
| 116 | Ga0114129_10033707 | 3300009147 | Bacteria | 7235 |
| 117 | Ga0114129_10104905 | 3300009147 | Bacteria | 3906 |
| 118 | Ga0114129_10178453 | 3300009147 | Bacteria | 2891 |
| 119 | Ga0114129_10802494 | 3300009147 | Unclassified | 1200 |
| 120 | Ga0105243_10097379 | 3300009148 | Unclassified | 2435 |
| 121 | Ga0105243_10134510 | 3300009148 | Unclassified | 2102 |
| 122 | Ga0105243_10148524 | 3300009148 | Bacteria | 2008 |
| 123 | Ga0105241_10048564 | 3300009174 | Bacteria | 3230 |
| 124 | Ga0105241_10054301 | 3300009174 | Bacteria | 3066 |
| 125 | Ga0105242_10039604 | 3300009176 | Bacteria | 3794 |
| 126 | Ga0105237_10007962 | 3300009545 | Bacteria | 11546 |
| 127 | Ga0105249_10027653 | 3300009553 | Bacteria | 5118 |
| 128 | Ga0105249_10261758 | 3300009553 | Bacteria | 1719 |
| 129 | Ga0105239_10325983 | 3300010375 | Bacteria | 1732 |
| 130 | Ga0157335_1000599 | 3300012492 | Bacteria | 1705 |
| 131 | Ga0157369_10205771 | 3300013105 | Bacteria | 2064 |
| 132 | Ga0157369_10211075 | 3300013105 | Bacteria | 2035 |
| 133 | Ga0157374_10639574 | 3300013296 | Bacteria | 1075 |
| 134 | Ga0157378_10229103 | 3300013297 | Bacteria | 1770 |
| 135 | Ga0157378_10484432 | 3300013297 | Bacteria | 1233 |
| 136 | Ga0163162_10025042 | 3300013306 | Bacteria | 5896 |
| 137 | Ga0163162_10633306 | 3300013306 | Bacteria | 1194 |
| 138 | Ga0157372_10060464 | 3300013307 | Bacteria | 4239 |
| 139 | Ga0157375_10015485 | 3300013308 | Bacteria | 6826 |
| 140 | Ga0157375_10058187 | 3300013308 | Bacteria | 3823 |
| 141 | Ga0157375_10411696 | 3300013308 | Unclassified | 1518 |
| 142 | Ga0157375_10852548 | 3300013308 | Bacteria | 1058 |
| 143 | Ga0182008_10048776 | 3300014497 | Bacteria | 2103 |
| 144 | Ga0157377_10040472 | 3300014745 | Bacteria | 2581 |
| 145 | Ga0157376_10083911 | 3300014969 | Bacteria | 2742 |
| 146 | Ga0157376_10242316 | 3300014969 | Unclassified | 1680 |
| 147 | Ga0206353_10031231 | 3300020082 | Bacteria | 1112 |
| 148 | Ga0207653_10002304 | 3300025885 | Bacteria | 6092 |
| 149 | Ga0207692_10014190 | 3300025898 | Bacteria | 3476 |
| 150 | Ga0207692_10040302 | 3300025898 | Bacteria | 2304 |
| 151 | Ga0207692_10104114 | 3300025898 | Unclassified | 1563 |
| 152 | Ga0207642_10144292 | 3300025899 | Bacteria | 1259 |
| 153 | Ga0207710_10080209 | 3300025900 | Bacteria | 1513 |
| 154 | Ga0207688_10040997 | 3300025901 | Bacteria | 2574 |
| 155 | Ga0207685_10025217 | 3300025905 | Bacteria | 2050 |
| 156 | Ga0207699_10005368 | 3300025906 | Bacteria | 6144 |
| 157 | Ga0207684_10068349 | 3300025910 | Bacteria | 3019 |
| 158 | Ga0207684_10094388 | 3300025910 | Bacteria | 2552 |
| 159 | Ga0207684_10205444 | 3300025910 | Bacteria | 1699 |
| 160 | Ga0207684_10278168 | 3300025910 | Bacteria | 1444 |
| 161 | Ga0207707_10055748 | 3300025912 | Bacteria | 3438 |
| 162 | Ga0207707_10086597 | 3300025912 | Bacteria | 2738 |
| 163 | Ga0207695_10329613 | 3300025913 | Bacteria | 1415 |
| 164 | Ga0207693_10000575 | 3300025915 | Bacteria | 33031 |
| 165 | Ga0207693_10001122 | 3300025915 | Bacteria | 24030 |
| 166 | Ga0207693_10001752 | 3300025915 | Bacteria | 19060 |
| 167 | Ga0207693_10007649 | 3300025915 | Bacteria | 8872 |
| 168 | Ga0207693_10020495 | 3300025915 | Bacteria | 5258 |
| 169 | Ga0207693_10024625 | 3300025915 | Bacteria | 4774 |
| 170 | Ga0207693_10038911 | 3300025915 | Bacteria | 3743 |
| 171 | Ga0207663_10004057 | 3300025916 | Bacteria | 7261 |
| 172 | Ga0207663_10004806 | 3300025916 | Bacteria | 6750 |
| 173 | Ga0207663_10010563 | 3300025916 | Bacteria | 4921 |
| 174 | Ga0207663_10011573 | 3300025916 | Bacteria | 4742 |
| 175 | Ga0207662_10037922 | 3300025918 | Bacteria | 2823 |
| 176 | Ga0207662_10149041 | 3300025918 | Bacteria | 1487 |
| 177 | Ga0207657_10008130 | 3300025919 | Bacteria | 10696 |
| 178 | Ga0207657_10012287 | 3300025919 | Bacteria | 8460 |
| 179 | Ga0207657_10026534 | 3300025919 | Bacteria | 5321 |
| 180 | Ga0207657_10126055 | 3300025919 | Bacteria | 2103 |
| 181 | Ga0207649_10170368 | 3300025920 | Bacteria | 1516 |
| 182 | Ga0207652_10156244 | 3300025921 | Bacteria | 2043 |
| 183 | Ga0207652_10236494 | 3300025921 | Unclassified | 1646 |
| 184 | Ga0207646_10000129 | 3300025922 | Bacteria | 102411 |
| 185 | Ga0207646_10004411 | 3300025922 | Bacteria | 15301 |
| 186 | Ga0207646_10193946 | 3300025922 | Bacteria | 1834 |
| 187 | Ga0207681_10261132 | 3300025923 | Bacteria | 1356 |
| 188 | Ga0207687_10086622 | 3300025927 | Bacteria | 2275 |
| 189 | Ga0207687_10231505 | 3300025927 | Bacteria | 1460 |
| 190 | Ga0207700_10011903 | 3300025928 | Bacteria | 5577 |
| 191 | Ga0207700_10225101 | 3300025928 | Bacteria | 1592 |
| 192 | Ga0207700_10309400 | 3300025928 | Bacteria | 1366 |
| 193 | Ga0207664_10004780 | 3300025929 | Bacteria | 9206 |
| 194 | Ga0207664_10020415 | 3300025929 | Bacteria | 4910 |
| 195 | Ga0207664_10027926 | 3300025929 | Bacteria | 4283 |
| 196 | Ga0207664_10040537 | 3300025929 | Bacteria | 3622 |
| 197 | Ga0207664_10046417 | 3300025929 | Bacteria | 3409 |
| 198 | Ga0207664_10050651 | 3300025929 | Bacteria | 3275 |
| 199 | Ga0207664_10071213 | 3300025929 | Bacteria | 2800 |
| 200 | Ga0207644_10071641 | 3300025931 | Bacteria | 2536 |
| 201 | Ga0207690_10212064 | 3300025932 | Bacteria | 1477 |
| 202 | Ga0207690_10268989 | 3300025932 | Bacteria | 1323 |
| 203 | Ga0207706_10004611 | 3300025933 | Bacteria | 12930 |
| 204 | Ga0207706_10076136 | 3300025933 | Bacteria | 2951 |
| 205 | Ga0207706_10098697 | 3300025933 | Bacteria | 2569 |
| 206 | Ga0207709_10043843 | 3300025935 | Bacteria | 2699 |
| 207 | Ga0207709_10350840 | 3300025935 | Unclassified | 1114 |
| 208 | Ga0207669_10030062 | 3300025937 | Bacteria | 3014 |
| 209 | Ga0207704_10212775 | 3300025938 | Bacteria | 1424 |
| 210 | Ga0207665_10000460 | 3300025939 | Bacteria | 28132 |
| 211 | Ga0207665_10060510 | 3300025939 | Bacteria | 2565 |
| 212 | Ga0207665_10127053 | 3300025939 | Bacteria | 1806 |
| 213 | Ga0207689_10394285 | 3300025942 | Bacteria | 1154 |
| 214 | Ga0207661_10048226 | 3300025944 | Bacteria | 3383 |
| 215 | Ga0207661_10326850 | 3300025944 | Unclassified | 1380 |
| 216 | Ga0207679_10370637 | 3300025945 | Bacteria | 1253 |
| 217 | Ga0207667_10191647 | 3300025949 | Bacteria | 2098 |
| 218 | Ga0207712_10016095 | 3300025961 | Bacteria | 4836 |
| 219 | Ga0207712_10026600 | 3300025961 | Bacteria | 3856 |
| 220 | Ga0207712_10286650 | 3300025961 | Unclassified | 1346 |
| 221 | Ga0207668_10070346 | 3300025972 | Bacteria | 2495 |
| 222 | Ga0207668_10312115 | 3300025972 | Bacteria | 1302 |
| 223 | Ga0207678_10009007 | 3300026067 | Bacteria | 8785 |
| 224 | Ga0207708_10014299 | 3300026075 | Bacteria | 5937 |
| 225 | Ga0207708_10262321 | 3300026075 | Unclassified | 1395 |
| 226 | Ga0207702_10041507 | 3300026078 | Bacteria | 3858 |
| 227 | Ga0207702_10239528 | 3300026078 | Bacteria | 1699 |
| 228 | Ga0207648_10010988 | 3300026089 | Bacteria | 8551 |
| 229 | Ga0207648_10062475 | 3300026089 | Bacteria | 3247 |
| 230 | Ga0207676_10564663 | 3300026095 | Bacteria | 1089 |
| 231 | Ga0207675_100001731 | 3300026118 | Bacteria | 21861 |
| 232 | Ga0207675_100012040 | 3300026118 | Bacteria | 8081 |
| 233 | Ga0207675_100089876 | 3300026118 | Bacteria | 2887 |
| 234 | Ga0207683_10001815 | 3300026121 | Bacteria | 18886 |
| 235 | Ga0207683_10009367 | 3300026121 | Bacteria | 8341 |
| 236 | Ga0207428_10035092 | 3300027907 | Bacteria | 4103 |
| 237 | Ga0207428_10071952 | 3300027907 | Bacteria | 2715 |
| 238 | Ga0207428_10131562 | 3300027907 | Unclassified | 1914 |
| 239 | Ga0265338_10007426 | 3300028800 | Bacteria | 13604 |
| 240 | Ga0265330_10026167 | 3300031235 | Bacteria | 2641 |
| 241 | Ga0265325_10010105 | 3300031241 | Bacteria | 5481 |
| 242 | Ga0265339_10001655 | 3300031249 | Bacteria | 16435 |
| 243 | Ga0265316_10019177 | 3300031344 | Bacteria | 5858 |
| 244 | Ga0265316_10138961 | 3300031344 | Unclassified | 1826 |
| 245 | Ga0265313_10031722 | 3300031595 | Bacteria | 2705 |
| 246 | Ga0265314_10004687 | 3300031711 | Bacteria | 12554 |
| 247 | Ga0265342_10005947 | 3300031712 | Bacteria | 9181 |
| 248 | Ga0307407_10253844 | 3300031903 | Bacteria | 1206 |
| 249 | Ga0307409_100017329 | 3300031995 | Bacteria | 4797 |
| 250 | Ga0307409_100048436 | 3300031995 | Bacteria | 3234 |
| 251 | Ga0373948_0004833 | 3300034817 | Bacteria | 2153 |
| 252 | Ga0373929_0019667 | 3300035085 | Bacteria | 1354 |
| 253 | Ga0373940_0014493 | 3300035088 | Bacteria | 1924 |
| 254 | Ga0373940_0047470 | 3300035088 | Bacteria | 1197 |
| 255 | Ga0373944_0004742 | 3300035089 | Bacteria | 3555 |
| 256 | Ga0373951_0015865 | 3300035091 | Unclassified | 1698 |
| 257 | Ga0373932_0007294 | 3300035112 | Unclassified | 2632 |
| 258 | Ga0373932_0023368 | 3300035112 | Bacteria | 1653 |
| 259 | Ga0373939_0031751 | 3300035114 | Bacteria | 1529 |
| 260 | Ga0373945_0001396 | 3300035116 | Bacteria | 7342 |
| 261 | Ga0373960_0009805 | 3300035121 | Bacteria | 2328 |
| 262 | Ga0373943_0003005 | 3300035170 | Bacteria | 7656 |
| 263 | Ga0373931_0042612 | 3300035691 | Bacteria | 2387 |
| 264 | Ga0373947_0003935 | 3300035725 | Bacteria | 8728 |
| 265 | Ga0373937_0000989 | 3300036401 | Bacteria | 24140 |
| 266 | Ga0373925_0081437 | 3300037068 | Bacteria | 2461 |
| 267 | Ga0395899_0001412 | 3300037312 | Bacteria | 20603 |
| 268 | Ga0395899_0003244 | 3300037312 | Bacteria | 12896 |
| 269 | Ga0395899_0003866 | 3300037312 | Bacteria | 11813 |
| 270 | Ga0395899_0005395 | 3300037312 | Bacteria | 9932 |
| 271 | Ga0395899_0094961 | 3300037312 | Bacteria | 2157 |
| 272 | Ga0395899_0201137 | 3300037312 | Bacteria | 1389 |
| 273 | Ga0395900_0001164 | 3300037418 | Bacteria | 32917 |
| 274 | Ga0395900_0009309 | 3300037418 | Bacteria | 10070 |
| 275 | Ga0395900_0012328 | 3300037418 | Bacteria | 8745 |
| 276 | Ga0395900_0013759 | 3300037418 | Bacteria | 8258 |
| 277 | Ga0395900_0014733 | 3300037418 | Bacteria | 7971 |
| 278 | Ga0395900_0034516 | 3300037418 | Bacteria | 5209 |
| 279 | Ga0395900_0046163 | 3300037418 | Bacteria | 4486 |
| 280 | Ga0395900_0075212 | 3300037418 | Bacteria | 3472 |
| 281 | Ga0395898_0001782 | 3300037466 | Bacteria | 28015 |
| 282 | Ga0395898_0002074 | 3300037466 | Bacteria | 24942 |
| 283 | Ga0395898_0003259 | 3300037466 | Bacteria | 18237 |
| 284 | Ga0395898_0010614 | 3300037466 | Bacteria | 9619 |
| 285 | Ga0395898_0011124 | 3300037466 | Bacteria | 9368 |
| 286 | Ga0395898_0012351 | 3300037466 | Bacteria | 8833 |
| 287 | Ga0395898_0015429 | 3300037466 | Bacteria | 7834 |
| 288 | Ga0395898_0022501 | 3300037466 | Bacteria | 6383 |
| 289 | Ga0395898_0146251 | 3300037466 | Bacteria | 2262 |
| 290 | Ga0395898_0154728 | 3300037466 | Bacteria | 2193 |
| 291 | Ga0395898_0196063 | 3300037466 | Bacteria | 1929 |
| 292 | Ga0395898_0223444 | 3300037466 | Unclassified | 1796 |
| 293 | Ga0395905_0001389 | 3300037471 | Bacteria | 29362 |
| 294 | Ga0395905_0011923 | 3300037471 | Bacteria | 8382 |
| 295 | Ga0395905_0015733 | 3300037471 | Bacteria | 7186 |
| 296 | Ga0395905_0019695 | 3300037471 | Bacteria | 6395 |
| 297 | Ga0395905_0034142 | 3300037471 | Bacteria | 4775 |
| 298 | Ga0395905_0038769 | 3300037471 | Bacteria | 4469 |
| 299 | Ga0395905_0079004 | 3300037471 | Bacteria | 3083 |
| 300 | Ga0395905_0566890 | 3300037471 | Bacteria | 1037 |
| 301 | Ga0395901_0001175 | 3300038443 | Bacteria | 27810 |
| 302 | Ga0395901_0005893 | 3300038443 | Bacteria | 12398 |
| 303 | Ga0395901_0009631 | 3300038443 | Bacteria | 9801 |
| 304 | Ga0395901_0010692 | 3300038443 | Bacteria | 9304 |
| 305 | Ga0395901_0017371 | 3300038443 | Bacteria | 7344 |
| 306 | Ga0395901_0023069 | 3300038443 | Bacteria | 6378 |
| 307 | Ga0395901_0025172 | 3300038443 | Bacteria | 6109 |
| 308 | Ga0395901_0030573 | 3300038443 | Bacteria | 5549 |
| 309 | Ga0395901_0057375 | 3300038443 | Bacteria | 4049 |
| 310 | Ga0395901_0102081 | 3300038443 | Bacteria | 3009 |
| 311 | Ga0451789_1162015 | 3300041443 | Unclassified | 1903 |
| 312 | Ga0451800_1232464 | 3300041459 | Bacteria | 1475 |
| 313 | Ga0451835_1079801 | 3300041492 | Bacteria | 1540 |
| 314 | Ga0451839_0541400 | 3300041496 | Bacteria | 2836 |
| 315 | Ga0451855_0278084 | 3300041511 | Unclassified | 1648 |
| 316 | Ga0439448_0020564 | 3300042005 | Bacteria | 2043 |
| 317 | Ga0466965_0037368 | 3300044683 | Bacteria | 2384 |
| 318 | Ga0466961_0002713 | 3300044693 | Bacteria | 11005 |
| 319 | Ga0466961_0003462 | 3300044693 | Bacteria | 9838 |
| 320 | Ga0466963_0001309 | 3300044694 | Bacteria | 13235 |
| 321 | Ga0466963_0001554 | 3300044694 | Bacteria | 12440 |
| 322 | Ga0466963_0001999 | 3300044694 | Bacteria | 11199 |
| 323 | Ga0466963_0005483 | 3300044694 | Bacteria | 7428 |
| 324 | Ga0466963_0017879 | 3300044694 | Bacteria | 4423 |
| 325 | Ga0466963_0050109 | 3300044694 | Bacteria | 2764 |
| 326 | Ga0466963_0053089 | 3300044694 | Bacteria | 2690 |
| 327 | Ga0466963_0071175 | 3300044694 | Bacteria | 2340 |
| 328 | Ga0466963_0131276 | 3300044694 | Bacteria | 1730 |
| 329 | Ga0466964_0002323 | 3300044706 | Bacteria | 6751 |
| 330 | Ga0466964_0008233 | 3300044706 | Bacteria | 3912 |
| 331 | Ga0466964_0012567 | 3300044706 | Bacteria | 3205 |
| 332 | Ga0466964_0030287 | 3300044706 | Unclassified | 2140 |
| 333 | Ga0466964_0034537 | 3300044706 | Bacteria | 2018 |
| 334 | Ga0466964_0076761 | 3300044706 | Unclassified | 1425 |
| 335 | Ga0466971_0011160 | 3300044719 | Bacteria | 3934 |
| 336 | Ga0466971_0038104 | 3300044719 | Bacteria | 2156 |
| 337 | Ga0466968_0001477 | 3300044735 | Bacteria | 8417 |
| 338 | Ga0466968_0005367 | 3300044735 | Bacteria | 4798 |
| 339 | Ga0466968_0019874 | 3300044735 | Bacteria | 2708 |
| 340 | Ga0466968_0025174 | 3300044735 | Bacteria | 2436 |
| 341 | Ga0466968_0042562 | 3300044735 | Bacteria | 1921 |
| 342 | Ga0466968_0047907 | 3300044735 | Bacteria | 1818 |
| 343 | Ga0466968_0062365 | 3300044735 | Bacteria | 1610 |
| 344 | Ga0466957_0002913 | 3300044842 | Bacteria | 9275 |
| 345 | Ga0466957_0005581 | 3300044842 | Bacteria | 7066 |
| 346 | Ga0466957_0008119 | 3300044842 | Bacteria | 5957 |
| 347 | Ga0466957_0030147 | 3300044842 | Bacteria | 3238 |
| 348 | Ga0466957_0183875 | 3300044842 | Bacteria | 1366 |
| 349 | Ga0466960_0006627 | 3300044901 | Bacteria | 4655 |
| 350 | Ga0466960_0009904 | 3300044901 | Unclassified | 3943 |
| 351 | Ga0466959_0071041 | 3300045049 | Bacteria | 2521 |
| 352 | Ga0466958_0013966 | 3300045836 | Bacteria | 4579 |
| 353 | Ga0466958_0050928 | 3300045836 | Bacteria | 2506 |
| 354 | Ga0466967_0004412 | 3300045976 | Bacteria | 9480 |
| 355 | Ga0466967_0006626 | 3300045976 | Bacteria | 8232 |
| 356 | Ga0466967_0011618 | 3300045976 | Bacteria | 6685 |
| 357 | Ga0466967_0028120 | 3300045976 | Bacteria | 4689 |
| 358 | Ga0466967_0042611 | 3300045976 | Bacteria | 3923 |
| 359 | Ga0466967_0061665 | 3300045976 | Bacteria | 3327 |
| 360 | Ga0466967_0070061 | 3300045976 | Bacteria | 3136 |
| 361 | Ga0466967_0082134 | 3300045976 | Bacteria | 2911 |
| 362 | Ga0466967_0113066 | 3300045976 | Bacteria | 2497 |
| 363 | Ga0466967_0128079 | 3300045976 | Bacteria | 2353 |
| 364 | Ga0466967_0141202 | 3300045976 | Bacteria | 2243 |
| 365 | Ga0466967_0160672 | 3300045976 | Bacteria | 2108 |
| 366 | Ga0466967_0165648 | 3300045976 | Bacteria | 2077 |
| 367 | Ga0466967_0172883 | 3300045976 | Bacteria | 2033 |
| 368 | Ga0466967_0241450 | 3300045976 | Bacteria | 1723 |
| 369 | Ga0495592_0000368 | 3300046454 | Bacteria | 35552 |
| 370 | Ga0495592_0075008 | 3300046454 | Bacteria | 2456 |
| 371 | Ga0495603_0000121 | 3300046455 | Bacteria | 38318 |
| 372 | Ga0495603_0072458 | 3300046455 | Bacteria | 2024 |
| 373 | Ga0495603_0125079 | 3300046455 | Bacteria | 1498 |
| 374 | Ga0495590_0059953 | 3300046457 | Unclassified | 1332 |
| 375 | Ga0495629_0059428 | 3300046459 | Bacteria | 2672 |
| 376 | Ga0495641_0005218 | 3300046461 | Bacteria | 8861 |
| 377 | Ga0495651_0003669 | 3300046462 | Bacteria | 11756 |
| 378 | Ga0495651_0010403 | 3300046462 | Bacteria | 7149 |
| 379 | Ga0495653_0008167 | 3300046463 | Bacteria | 8572 |
| 380 | Ga0495653_0030595 | 3300046463 | Bacteria | 4286 |
| 381 | Ga0495653_0068898 | 3300046463 | Bacteria | 2652 |
| 382 | Ga0495653_0078236 | 3300046463 | Bacteria | 2453 |
| 383 | Ga0495653_0224170 | 3300046463 | Unclassified | 1262 |
| 384 | Ga0495580_0125236 | 3300046472 | Bacteria | 1783 |
| 385 | Ga0495582_0019824 | 3300046473 | Bacteria | 3677 |
| 386 | Ga0495582_0046552 | 3300046473 | Bacteria | 2389 |
| 387 | Ga0495582_0168677 | 3300046473 | Bacteria | 1246 |
| 388 | Ga0495584_0099279 | 3300046491 | Unclassified | 1471 |
| 389 | Ga0495584_0153961 | 3300046491 | Bacteria | 1168 |
| 390 | Ga0495594_0006550 | 3300046499 | Bacteria | 5990 |
| 391 | Ga0495596_0065533 | 3300046500 | Unclassified | 1413 |
| 392 | Ga0495608_0010708 | 3300046511 | Bacteria | 6397 |
| 393 | Ga0495608_0115934 | 3300046511 | Bacteria | 1719 |
| 394 | Ga0495618_0003932 | 3300046514 | Bacteria | 9171 |
| 395 | Ga0495618_0037509 | 3300046514 | Plasmid | 3044 |
| 396 | Ga0495618_0049839 | 3300046514 | Bacteria | 2644 |
| 397 | Ga0495628_0000650 | 3300046516 | Bacteria | 31811 |
| 398 | Ga0495628_0126961 | 3300046516 | Unclassified | 1953 |
| 399 | Ga0495630_0050355 | 3300046517 | Bacteria | 3117 |
| 400 | Ga0495652_0009623 | 3300046529 | Bacteria | 8776 |
| 401 | Ga0495652_0031120 | 3300046529 | Bacteria | 4675 |
| 402 | Ga0495652_0044756 | 3300046529 | Bacteria | 3810 |
| 403 | Ga0495640_0272981 | 3300046533 | Bacteria | 1054 |
| 404 | Ga0495587_0000469 | 3300046536 | Bacteria | 27940 |
| 405 | Ga0495587_0036849 | 3300046536 | Bacteria | 2940 |
| 406 | Ga0495645_0000456 | 3300046543 | Bacteria | 28144 |
| 407 | Ga0495645_0047808 | 3300046543 | Bacteria | 3116 |
| 408 | Ga0495645_0155116 | 3300046543 | Bacteria | 1587 |
| 409 | Ga0495634_0057063 | 3300046642 | Unclassified | 2607 |
| 410 | Ga0495588_0003928 | 3300046674 | Bacteria | 6520 |
| 411 | Ga0495657_0010935 | 3300046675 | Bacteria | 6806 |
| 412 | Ga0495657_0017999 | 3300046675 | Bacteria | 5121 |
| 413 | Ga0495657_0066515 | 3300046675 | Unclassified | 2368 |
| 414 | Ga0495657_0076170 | 3300046675 | Bacteria | 2179 |
| 415 | Ga0495623_0000123 | 3300046679 | Bacteria | 47116 |
| 416 | Ga0495623_0128024 | 3300046679 | Bacteria | 1523 |
| 417 | Ga0495658_0202928 | 3300046683 | Bacteria | 1236 |
| 418 | Ga0495613_0020046 | 3300046689 | Bacteria | 4982 |
| 419 | Ga0495624_0044963 | 3300046690 | Unclassified | 2813 |
| 420 | Ga0495600_0087349 | 3300046809 | Bacteria | 2034 |
| 421 | Ga0495604_0000085 | 3300047317 | Bacteria | 81234 |
| 422 | Ga0495604_0045114 | 3300047317 | Unclassified | 3441 |
| 423 | Ga0495674_0038534 | 3300047319 | Bacteria | 4289 |
| 424 | Ga0495674_0039871 | 3300047319 | Bacteria | 4205 |
| 425 | Ga0495674_0172263 | 3300047319 | Unclassified | 1805 |
| 426 | Ga0495676_0000372 | 3300047321 | Bacteria | 36840 |
| 427 | Ga0495676_0074966 | 3300047321 | Bacteria | 2589 |
| 428 | Ga0495680_0022908 | 3300047322 | Bacteria | 5201 |
| 429 | Ga0495680_0024954 | 3300047322 | Bacteria | 4951 |
| 430 | Ga0495680_0030262 | 3300047322 | Bacteria | 4422 |
| 431 | Ga0495680_0065819 | 3300047322 | Unclassified | 2775 |
| 432 | Ga0495680_0100521 | 3300047322 | Bacteria | 2155 |
| 433 | Ga0495675_0000627 | 3300047444 | Bacteria | 22487 |
| 434 | Ga0495684_0040904 | 3300047471 | Bacteria | 3552 |
| 435 | Ga0495684_0041594 | 3300047471 | Unclassified | 3522 |
| 436 | Ga0496100_0026105 | 3300048903 | Bacteria | 3578 |
| 437 | Ga0496100_0032627 | 3300048903 | Bacteria | 3250 |
| 438 | Ga0496100_0061114 | 3300048903 | Bacteria | 2482 |
| 439 | Ga0496101_0010225 | 3300048904 | Bacteria | 6193 |
| 440 | Ga0496101_0097529 | 3300048904 | Bacteria | 2195 |
| 441 | Ga0496102_0018319 | 3300048905 | Bacteria | 6152 |
| 442 | Ga0496102_0028038 | 3300048905 | Bacteria | 5031 |
| 443 | Ga0496102_0037220 | 3300048905 | Bacteria | 4388 |
| 444 | Ga0496103_0017820 | 3300048906 | Bacteria | 4254 |
| 445 | Ga0496103_0044554 | 3300048906 | Bacteria | 2734 |
| 446 | Ga0496103_0132528 | 3300048906 | Unclassified | 1592 |
| 447 | Ga0496103_0235304 | 3300048906 | Unclassified | 1178 |
| 448 | Ga0496104_0002049 | 3300048907 | Bacteria | 17506 |
| 449 | Ga0496104_0071581 | 3300048907 | Bacteria | 3296 |
| 450 | Ga0496104_0098593 | 3300048907 | Bacteria | 2797 |
| 451 | Ga0496105_0004500 | 3300048908 | Bacteria | 10494 |
| 452 | Ga0496105_0005816 | 3300048908 | Bacteria | 9408 |
| 453 | Ga0496105_0021421 | 3300048908 | Bacteria | 5230 |
| 454 | Ga0496105_0053916 | 3300048908 | Bacteria | 3321 |
| 455 | Ga0496105_0188456 | 3300048908 | Bacteria | 1687 |
| 456 | Ga0496106_0013348 | 3300048909 | Bacteria | 6064 |
| 457 | Ga0496106_0017531 | 3300048909 | Bacteria | 5300 |
| 458 | Ga0496106_0146925 | 3300048909 | Bacteria | 1858 |
| 459 | Ga0496106_0216208 | 3300048909 | Bacteria | 1527 |
| 460 | Ga0496107_0031756 | 3300048910 | Bacteria | 3770 |
| 461 | Ga0496107_0081901 | 3300048910 | Unclassified | 2353 |
| 462 | Ga0496107_0241342 | 3300048910 | Bacteria | 1344 |
| 463 | Ga0496108_0002865 | 3300048911 | Bacteria | 13842 |
| 464 | Ga0496108_0006900 | 3300048911 | Bacteria | 9190 |
| 465 | Ga0496108_0040950 | 3300048911 | Bacteria | 3865 |
| 466 | Ga0496108_0451034 | 3300048911 | Unclassified | 1124 |
| 467 | Ga0496108_0455647 | 3300048911 | Bacteria | 1117 |
| 468 | Ga0496109_0003397 | 3300048912 | Bacteria | 13322 |
| 469 | Ga0496109_0013794 | 3300048912 | Bacteria | 7023 |
| 470 | Ga0496109_0032873 | 3300048912 | Bacteria | 4666 |
| 471 | Ga0496109_0084068 | 3300048912 | Bacteria | 2935 |
| 472 | Ga0496109_0208028 | 3300048912 | Bacteria | 1840 |
| 473 | Ga0496109_0241473 | 3300048912 | Bacteria | 1700 |
| 474 | Ga0496110_0001392 | 3300048913 | Bacteria | 17458 |
| 475 | Ga0496111_0001619 | 3300048914 | Bacteria | 13030 |
| 476 | Ga0496111_0104601 | 3300048914 | Bacteria | 2082 |
| 477 | Ga0496112_0077598 | 3300048915 | Bacteria | 3285 |
| 478 | Ga0496112_0216019 | 3300048915 | Bacteria | 1874 |
| 479 | Ga0496112_0414401 | 3300048915 | Bacteria | 1286 |
| 480 | Ga0496112_0463611 | 3300048915 | Bacteria | 1204 |
| 481 | Ga0496113_0003282 | 3300048916 | Bacteria | 9659 |
| 482 | Ga0496113_0003768 | 3300048916 | Bacteria | 9150 |
| 483 | Ga0496113_0270527 | 3300048916 | Bacteria | 1358 |
| 484 | Ga0496114_0077125 | 3300048917 | Bacteria | 2809 |
| 485 | Ga0496114_0083959 | 3300048917 | Unclassified | 2696 |
| 486 | Ga0496114_0130088 | 3300048917 | Unclassified | 2173 |
| 487 | Ga0496115_0006938 | 3300048918 | Bacteria | 8324 |
| 488 | Ga0496115_0053108 | 3300048918 | Bacteria | 3252 |
| 489 | Ga0501032_0010449 | 3300049569 | Bacteria | 6696 |
| 490 | Ga0501033_0012842 | 3300049570 | Bacteria | 6387 |
| 491 | Ga0501036_0007928 | 3300049572 | Bacteria | 8690 |
| 492 | Ga0501037_0002457 | 3300049573 | Bacteria | 13397 |
| 493 | Ga0501038_0008146 | 3300049574 | Bacteria | 9645 |
| 494 | Ga0501039_0008068 | 3300049575 | Bacteria | 8022 |
| 495 | Ga0501040_0002978 | 3300049576 | Bacteria | 10957 |
| 496 | Ga0501041_0010363 | 3300049577 | Bacteria | 5492 |
| 497 | Ga0501042_0001698 | 3300049578 | Bacteria | 13142 |
| 498 | Ga0501043_0009614 | 3300049579 | Bacteria | 7575 |
| 499 | Ga0501046_0000511 | 3300049580 | Bacteria | 38395 |
| 500 | Ga0501047_0283422 | 3300049581 | Bacteria | 1501 |
| 501 | Ga0501048_0004982 | 3300049582 | Bacteria | 10136 |
| 502 | Ga0501067_0161921 | 3300049583 | Bacteria | 1246 |
| 503 | Ga0501068_0002005 | 3300049584 | Bacteria | 10824 |
| 504 | Ga0501069_0000588 | 3300049585 | Bacteria | 16841 |
| 505 | Ga0501069_0003040 | 3300049585 | Bacteria | 8614 |
| 506 | Ga0501069_0077446 | 3300049585 | Bacteria | 1870 |
| 507 | Ga0501070_0008776 | 3300049586 | Bacteria | 8547 |
| 508 | Ga0501071_0007639 | 3300049587 | Bacteria | 7124 |
| 509 | Ga0501072_0014815 | 3300049588 | Bacteria | 5978 |
| 510 | Ga0501074_0001178 | 3300049590 | Bacteria | 17155 |
| 511 | Ga0501075_0007888 | 3300049591 | Bacteria | 7391 |
| 512 | Ga0501076_0008600 | 3300049592 | Bacteria | 7487 |
| 513 | Ga0501077_0058324 | 3300049593 | Bacteria | 2450 |
| 514 | Ga0501079_0020334 | 3300049741 | Bacteria | 5072 |
| 515 | Ga0501080_0015265 | 3300049742 | Bacteria | 7080 |
| 516 | Ga0501081_0018304 | 3300049743 | Bacteria | 4649 |
| 517 | Ga0501083_0011151 | 3300049744 | Bacteria | 6308 |
| 518 | Ga0501035_0008074 | 3300049822 | Bacteria | 9809 |
| 519 | Ga0501044_0018079 | 3300049823 | Bacteria | 7561 |
| 520 | Ga0501045_0007698 | 3300049824 | Bacteria | 7493 |
| 521 | nmdc:mga05p37_126140_c1 | 3300050507 | Bacteria | 3143 |
| 522 | nmdc:mga05p37_13543_c1 | 3300050507 | Bacteria | 9779 |
| 523 | nmdc:mga09592_72342_c1 | 3300050508 | Bacteria | 2927 |
| 524 | nmdc:mga06r32_12036_c1 | 3300050510 | Bacteria | 7796 |
| 525 | nmdc:mga08y16_181386_c1 | 3300050511 | Bacteria | 2186 |
| 526 | nmdc:mga08y16_51852_c1 | 3300050511 | Bacteria | 4293 |
| 527 | nmdc:mga08y16_58637_c1 | 3300050511 | Bacteria | 4022 |
| 528 | nmdc:mga0n895_14674_c1 | 3300050512 | Bacteria | 7124 |
| 529 | nmdc:mga0n895_16218_c1 | 3300050512 | Bacteria | 6830 |
| 530 | nmdc:mga0n895_210749_c1 | 3300050512 | Bacteria | 1973 |
| 531 | nmdc:mga0rr50_332481_c1 | 3300050513 | Bacteria | 1276 |
| 532 | nmdc:mga0rr50_43077_c1 | 3300050513 | Bacteria | 3300 |
| 533 | nmdc:mga08x19_349015_c1 | 3300050514 | Bacteria | 1033 |
| 534 | nmdc:mga08x19_3700_c1 | 3300050514 | Bacteria | 9103 |
| 535 | nmdc:mga0a205_15383_c1 | 3300050515 | Bacteria | 7152 |
| 536 | Ga0495601_0000269 | 3300053077 | Bacteria | 28152 |
| 537 | Ga0495601_0013901 | 3300053077 | Bacteria | 4846 |
| 538 | Ga0495601_0017895 | 3300053077 | Bacteria | 4308 |
| 539 | Ga0495595_0007187 | 3300053084 | Bacteria | 4550 |
| 540 | Ga0495595_0083471 | 3300053084 | Bacteria | 1525 |
| 541 | Ga0495619_0001964 | 3300053085 | Bacteria | 13716 |
| 542 | Ga0495619_0019352 | 3300053085 | Bacteria | 4327 |
| 543 | Ga0495619_0192186 | 3300053085 | Bacteria | 1413 |
| 544 | Ga0501084_0039093 | 3300054114 | Bacteria | 3968 |
| 545 | Ga0501082_0010391 | 3300060353 | Bacteria | 8015 |
| 546 | Ga0501082_0236154 | 3300060353 | Bacteria | 1591 |
| 547 | Ga0466962_0002408 | 3300061719 | Bacteria | 8875 |
| 548 | Ga0466962_0028761 | 3300061719 | Bacteria | 2662 |
| 549 | Ga0466962_0095791 | 3300061719 | Bacteria | 1423 |
| 550 | Ga0530510_0006468 | 3300061734 | Bacteria | 8157 |
| 551 | Ga0530510_0356927 | 3300061734 | Unclassified | 1098 |
| 552 | Ga0395899_0023097 | |||
| 553 | Ga0070683_100029766 | |||
| 554 | Ga0068869_100419745 | |||
| 555 | Ga0070680_100028046 | |||
| 556 | Ga0068868_100290432 | |||
| 557 | Ga0070660_100021788 | |||
| 558 | Ga0070660_100092091 | |||
| 559 | Ga0070660_100173668 | |||
| 560 | Ga0070691_10109754 | |||
| 561 | Ga0070687_100031585 | |||
| 562 | Ga0070671_100057259 | |||
| 563 | Ga0070659_100222432 | |||
| 564 | Ga0070703_10014462 | |||
| 565 | Ga0070709_10009989 | |||
| 566 | Ga0070709_10243254 | |||
| 567 | Ga0070709_10247527 | |||
| 568 | Ga0070714_100012162 | |||
| 569 | Ga0070714_100012238 | |||
| 570 | Ga0070714_100013409 | |||
| 571 | Ga0070714_100014140 | |||
| 572 | Ga0070714_100034096 | |||
| 573 | Ga0070714_100055604 | |||
| 574 | Ga0070714_100075815 | |||
| 575 | Ga0070714_100082595 | |||
| 576 | Ga0070714_100097537 | |||
| 577 | Ga0070713_100097255 | |||
| 578 | Ga0070710_10016677 | |||
| 579 | Ga0070710_10031338 | |||
| 580 | Ga0070710_10033839 | |||
| 581 | Ga0070711_100011924 | |||
| 582 | Ga0070711_100053598 | |||
| 583 | Ga0070711_100093717 | |||
| 584 | Ga0070705_100168257 | |||
| 585 | Ga0070700_100021598 | |||
| 586 | Ga0070694_100024833 | |||
| 587 | Ga0070694_100244449 | |||
| 588 | Ga0070663_100050643 | |||
| 589 | Ga0070678_100200028 | |||
| 590 | Ga0070662_100059566 | |||
| 591 | Ga0070662_100065747 | |||
| 592 | Ga0070662_100173109 | |||
| 593 | Ga0070681_10141601 | |||
| 594 | Ga0068867_100147128 | |||
| 595 | Ga0068867_100168045 | |||
| 596 | Ga0070706_100035844 | |||
| 597 | Ga0070706_100126059 | |||
| 598 | Ga0070706_100213817 | |||
| 599 | Ga0070707_100002571 | |||
| 600 | Ga0070707_100647111 | |||
| 601 | Ga0070698_100005325 | |||
| 602 | Ga0070698_100022232 | |||
| 603 | Ga0070698_100256393 | |||
| 604 | Ga0070699_100109897 | |||
| 605 | Ga0070699_100138235 | |||
| 606 | Ga0070684_100051554 | |||
| 607 | Ga0070684_100512278 | |||
| 608 | Ga0070697_100177663 | |||
| 609 | Ga0070686_100081593 | |||
| 610 | Ga0070695_100000007 | |||
| 611 | Ga0070695_100035320 | |||
| 612 | Ga0070695_100380801 | |||
| 613 | Ga0070696_100068802 | |||
| 614 | Ga0070696_100087218 | |||
| 615 | Ga0070696_100223116 | |||
| 616 | Ga0070693_100008434 | |||
| 617 | Ga0070693_100022759 | |||
| 618 | Ga0070704_100041512 | |||
| 619 | Ga0070704_100140900 | |||
| 620 | Ga0068855_100043432 | |||
| 621 | Ga0068855_100353388 | |||
| 622 | Ga0070664_100124093 | |||
| 623 | Ga0068854_100084988 | |||
| 624 | Ga0068856_100051745 | |||
| 625 | Ga0068856_100088003 | |||
| 626 | Ga0068856_100129863 | |||
| 627 | Ga0070702_100020231 | |||
| 628 | Ga0070702_100062955 | |||
| 629 | Ga0068861_100004866 | |||
| 630 | Ga0068861_100014430 | |||
| 631 | Ga0081538_10000647 | |||
| 632 | Ga0081538_10050009 | |||
| 633 | Ga0081540_1003762 | |||
| 634 | Ga0070717_10020676 | |||
| 635 | Ga0070717_10035212 | |||
| 636 | Ga0070717_10071869 | |||
| 637 | Ga0070717_10152595 | |||
| 638 | Ga0070715_10000593 | |||
| 639 | Ga0070715_10024115 | |||
| 640 | Ga0070716_100002850 | |||
| 641 | Ga0070716_100035041 | |||
| 642 | Ga0070716_100156842 | |||
| 643 | Ga0070712_100009760 | |||
| 644 | Ga0070712_100009820 | |||
| 645 | Ga0070712_100056825 | |||
| 646 | Ga0070712_100128908 | |||
| 647 | Ga0097621_100038303 | |||
| 648 | Ga0068871_100013346 | |||
| 649 | Ga0075428_100044792 | |||
| 650 | Ga0075433_10019735 | |||
| 651 | Ga0075433_10207500 | |||
| 652 | Ga0075433_10329391 | |||
| 653 | Ga0075434_100036223 | |||
| 654 | Ga0075434_100211597 | |||
| 655 | Ga0075436_100086629 | |||
| 656 | Ga0105240_10250623 | |||
| 657 | Ga0111539_10010446 | |||
| 658 | Ga0111539_10076548 | |||
| 659 | Ga0111539_10305665 | |||
| 660 | Ga0105245_10027933 | |||
| 661 | Ga0105245_10056511 | |||
| 662 | Ga0105245_10078122 | |||
| 663 | Ga0105245_10138923 | |||
| 664 | Ga0105245_10406891 | |||
| 665 | Ga0105247_10021905 | |||
| 666 | Ga0114129_10011007 | |||
| 667 | Ga0114129_10033707 | |||
| 668 | Ga0114129_10104905 | |||
| 669 | Ga0114129_10178453 | |||
| 670 | Ga0114129_10802494 | |||
| 671 | Ga0105243_10097379 | |||
| 672 | Ga0105243_10134510 | |||
| 673 | Ga0105243_10148524 | |||
| 674 | Ga0105241_10048564 | |||
| 675 | Ga0105241_10054301 | |||
| 676 | Ga0105242_10039604 | |||
| 677 | Ga0105237_10007962 | |||
| 678 | Ga0105249_10027653 | |||
| 679 | Ga0105249_10261758 | |||
| 680 | Ga0105239_10325983 | |||
| 681 | Ga0157335_1000599 | |||
| 682 | Ga0157369_10205771 | |||
| 683 | Ga0157369_10211075 | |||
| 684 | Ga0157374_10639574 | |||
| 685 | Ga0157378_10229103 | |||
| 686 | Ga0157378_10484432 | |||
| 687 | Ga0163162_10025042 | |||
| 688 | Ga0163162_10633306 | |||
| 689 | Ga0157372_10060464 | |||
| 690 | Ga0157375_10015485 | |||
| 691 | Ga0157375_10058187 | |||
| 692 | Ga0157375_10411696 | |||
| 693 | Ga0157375_10852548 | |||
| 694 | Ga0182008_10048776 | |||
| 695 | Ga0157377_10040472 | |||
| 696 | Ga0157376_10083911 | |||
| 697 | Ga0157376_10242316 | |||
| 698 | Ga0206353_10031231 | |||
| 699 | Ga0207653_10002304 | |||
| 700 | Ga0207692_10014190 | |||
| 701 | Ga0207692_10040302 | |||
| 702 | Ga0207692_10104114 | |||
| 703 | Ga0207642_10144292 | |||
| 704 | Ga0207710_10080209 | |||
| 705 | Ga0207688_10040997 | |||
| 706 | Ga0207685_10025217 | |||
| 707 | Ga0207699_10005368 | |||
| 708 | Ga0207684_10068349 | |||
| 709 | Ga0207684_10094388 | |||
| 710 | Ga0207684_10205444 | |||
| 711 | Ga0207684_10278168 | |||
| 712 | Ga0207707_10055748 | |||
| 713 | Ga0207707_10086597 | |||
| 714 | Ga0207695_10329613 | |||
| 715 | Ga0207693_10000575 | |||
| 716 | Ga0207693_10001122 | |||
| 717 | Ga0207693_10001752 | |||
| 718 | Ga0207693_10007649 | |||
| 719 | Ga0207693_10020495 | |||
| 720 | Ga0207693_10024625 | |||
| 721 | Ga0207693_10038911 | |||
| 722 | Ga0207663_10004057 | |||
| 723 | Ga0207663_10004806 | |||
| 724 | Ga0207663_10010563 | |||
| 725 | Ga0207663_10011573 | |||
| 726 | Ga0207662_10037922 | |||
| 727 | Ga0207662_10149041 | |||
| 728 | Ga0207657_10008130 | |||
| 729 | Ga0207657_10012287 | |||
| 730 | Ga0207657_10026534 | |||
| 731 | Ga0207657_10126055 | |||
| 732 | Ga0207649_10170368 | |||
| 733 | Ga0207652_10156244 | |||
| 734 | Ga0207652_10236494 | |||
| 735 | Ga0207646_10000129 | |||
| 736 | Ga0207646_10004411 | |||
| 737 | Ga0207646_10193946 | |||
| 738 | Ga0207681_10261132 | |||
| 739 | Ga0207687_10086622 | |||
| 740 | Ga0207687_10231505 | |||
| 741 | Ga0207700_10011903 | |||
| 742 | Ga0207700_10225101 | |||
| 743 | Ga0207700_10309400 | |||
| 744 | Ga0207664_10004780 | |||
| 745 | Ga0207664_10020415 | |||
| 746 | Ga0207664_10027926 | |||
| 747 | Ga0207664_10040537 | |||
| 748 | Ga0207664_10046417 | |||
| 749 | Ga0207664_10050651 | |||
| 750 | Ga0207664_10071213 | |||
| 751 | Ga0207644_10071641 | |||
| 752 | Ga0207690_10212064 | |||
| 753 | Ga0207690_10268989 | |||
| 754 | Ga0207706_10004611 | |||
| 755 | Ga0207706_10076136 | |||
| 756 | Ga0207706_10098697 | |||
| 757 | Ga0207709_10043843 | |||
| 758 | Ga0207709_10350840 | |||
| 759 | Ga0207669_10030062 | |||
| 760 | Ga0207704_10212775 | |||
| 761 | Ga0207665_10000460 | |||
| 762 | Ga0207665_10060510 | |||
| 763 | Ga0207665_10127053 | |||
| 764 | Ga0207689_10394285 | |||
| 765 | Ga0207661_10048226 | |||
| 766 | Ga0207661_10326850 | |||
| 767 | Ga0207679_10370637 | |||
| 768 | Ga0207667_10191647 | |||
| 769 | Ga0207712_10016095 | |||
| 770 | Ga0207712_10026600 | |||
| 771 | Ga0207712_10286650 | |||
| 772 | Ga0207668_10070346 | |||
| 773 | Ga0207668_10312115 | |||
| 774 | Ga0207678_10009007 | |||
| 775 | Ga0207708_10014299 | |||
| 776 | Ga0207708_10262321 | |||
| 777 | Ga0207702_10041507 | |||
| 778 | Ga0207702_10239528 | |||
| 779 | Ga0207648_10010988 | |||
| 780 | Ga0207648_10062475 | |||
| 781 | Ga0207676_10564663 | |||
| 782 | Ga0207675_100001731 | |||
| 783 | Ga0207675_100012040 | |||
| 784 | Ga0207675_100089876 | |||
| 785 | Ga0207683_10001815 | |||
| 786 | Ga0207683_10009367 | |||
| 787 | Ga0207428_10035092 | |||
| 788 | Ga0207428_10071952 | |||
| 789 | Ga0207428_10131562 | |||
| 790 | Ga0265338_10007426 | |||
| 791 | Ga0265330_10026167 | |||
| 792 | Ga0265325_10010105 | |||
| 793 | Ga0265339_10001655 | |||
| 794 | Ga0265316_10019177 | |||
| 795 | Ga0265316_10138961 | |||
| 796 | Ga0265313_10031722 | |||
| 797 | Ga0265314_10004687 | |||
| 798 | Ga0265342_10005947 | |||
| 799 | Ga0307407_10253844 | |||
| 800 | Ga0307409_100017329 | |||
| 801 | Ga0307409_100048436 | |||
| 802 | Ga0373948_0004833 | |||
| 803 | Ga0373929_0019667 | |||
| 804 | Ga0373940_0014493 | |||
| 805 | Ga0373940_0047470 | |||
| 806 | Ga0373944_0004742 | |||
| 807 | Ga0373951_0015865 | |||
| 808 | Ga0373932_0007294 | |||
| 809 | Ga0373932_0023368 | |||
| 810 | Ga0373939_0031751 | |||
| 811 | Ga0373945_0001396 | |||
| 812 | Ga0373960_0009805 | |||
| 813 | Ga0373943_0003005 | |||
| 814 | Ga0373931_0042612 | |||
| 815 | Ga0373947_0003935 | |||
| 816 | Ga0373937_0000989 | |||
| 817 | Ga0373925_0081437 | |||
| 818 | Ga0395899_0001412 | |||
| 819 | Ga0395899_0003244 | |||
| 820 | Ga0395899_0003866 | |||
| 821 | Ga0395899_0005395 | |||
| 822 | Ga0395899_0094961 | |||
| 823 | Ga0395899_0201137 | |||
| 824 | Ga0395900_0001164 | |||
| 825 | Ga0395900_0009309 | |||
| 826 | Ga0395900_0012328 | |||
| 827 | Ga0395900_0013759 | |||
| 828 | Ga0395900_0014733 | |||
| 829 | Ga0395900_0034516 | |||
| 830 | Ga0395900_0046163 | |||
| 831 | Ga0395900_0075212 | |||
| 832 | Ga0395898_0001782 | |||
| 833 | Ga0395898_0002074 | |||
| 834 | Ga0395898_0003259 | |||
| 835 | Ga0395898_0010614 | |||
| 836 | Ga0395898_0011124 | |||
| 837 | Ga0395898_0012351 | |||
| 838 | Ga0395898_0015429 | |||
| 839 | Ga0395898_0022501 | |||
| 840 | Ga0395898_0146251 | |||
| 841 | Ga0395898_0154728 | |||
| 842 | Ga0395898_0196063 | |||
| 843 | Ga0395898_0223444 | |||
| 844 | Ga0395905_0001389 | |||
| 845 | Ga0395905_0011923 | |||
| 846 | Ga0395905_0015733 | |||
| 847 | Ga0395905_0019695 | |||
| 848 | Ga0395905_0034142 | |||
| 849 | Ga0395905_0038769 | |||
| 850 | Ga0395905_0079004 | |||
| 851 | Ga0395905_0566890 | |||
| 852 | Ga0395901_0001175 | |||
| 853 | Ga0395901_0005893 | |||
| 854 | Ga0395901_0009631 | |||
| 855 | Ga0395901_0010692 | |||
| 856 | Ga0395901_0017371 | |||
| 857 | Ga0395901_0023069 | |||
| 858 | Ga0395901_0025172 | |||
| 859 | Ga0395901_0030573 | |||
| 860 | Ga0395901_0057375 | |||
| 861 | Ga0395901_0102081 | |||
| 862 | Ga0451789_1162015 | |||
| 863 | Ga0451800_1232464 | |||
| 864 | Ga0451835_1079801 | |||
| 865 | Ga0451839_0541400 | |||
| 866 | Ga0451855_0278084 | |||
| 867 | Ga0439448_0020564 | |||
| 868 | Ga0466965_0037368 | |||
| 869 | Ga0466961_0002713 | |||
| 870 | Ga0466961_0003462 | |||
| 871 | Ga0466963_0001309 | |||
| 872 | Ga0466963_0001554 | |||
| 873 | Ga0466963_0001999 | |||
| 874 | Ga0466963_0005483 | |||
| 875 | Ga0466963_0017879 | |||
| 876 | Ga0466963_0050109 | |||
| 877 | Ga0466963_0053089 | |||
| 878 | Ga0466963_0071175 | |||
| 879 | Ga0466963_0131276 | |||
| 880 | Ga0466964_0002323 | |||
| 881 | Ga0466964_0008233 | |||
| 882 | Ga0466964_0012567 | |||
| 883 | Ga0466964_0030287 | |||
| 884 | Ga0466964_0034537 | |||
| 885 | Ga0466964_0076761 | |||
| 886 | Ga0466971_0011160 | |||
| 887 | Ga0466971_0038104 | |||
| 888 | Ga0466968_0001477 | |||
| 889 | Ga0466968_0005367 | |||
| 890 | Ga0466968_0019874 | |||
| 891 | Ga0466968_0025174 | |||
| 892 | Ga0466968_0042562 | |||
| 893 | Ga0466968_0047907 | |||
| 894 | Ga0466968_0062365 | |||
| 895 | Ga0466957_0002913 | |||
| 896 | Ga0466957_0005581 | |||
| 897 | Ga0466957_0008119 | |||
| 898 | Ga0466957_0030147 | |||
| 899 | Ga0466957_0183875 | |||
| 900 | Ga0466960_0006627 | |||
| 901 | Ga0466960_0009904 | |||
| 902 | Ga0466959_0071041 | |||
| 903 | Ga0466958_0013966 | |||
| 904 | Ga0466958_0050928 | |||
| 905 | Ga0466967_0004412 | |||
| 906 | Ga0466967_0006626 | |||
| 907 | Ga0466967_0011618 | |||
| 908 | Ga0466967_0028120 | |||
| 909 | Ga0466967_0042611 | |||
| 910 | Ga0466967_0061665 | |||
| 911 | Ga0466967_0070061 | |||
| 912 | Ga0466967_0082134 | |||
| 913 | Ga0466967_0113066 | |||
| 914 | Ga0466967_0128079 | |||
| 915 | Ga0466967_0141202 | |||
| 916 | Ga0466967_0160672 | |||
| 917 | Ga0466967_0165648 | |||
| 918 | Ga0466967_0172883 | |||
| 919 | Ga0466967_0241450 | |||
| 920 | Ga0495592_0000368 | |||
| 921 | Ga0495592_0075008 | |||
| 922 | Ga0495603_0000121 | |||
| 923 | Ga0495603_0072458 | |||
| 924 | Ga0495603_0125079 | |||
| 925 | Ga0495590_0059953 | |||
| 926 | Ga0495629_0059428 | |||
| 927 | Ga0495641_0005218 | |||
| 928 | Ga0495651_0003669 | |||
| 929 | Ga0495651_0010403 | |||
| 930 | Ga0495653_0008167 | |||
| 931 | Ga0495653_0030595 | |||
| 932 | Ga0495653_0068898 | |||
| 933 | Ga0495653_0078236 | |||
| 934 | Ga0495653_0224170 | |||
| 935 | Ga0495580_0125236 | |||
| 936 | Ga0495582_0019824 | |||
| 937 | Ga0495582_0046552 | |||
| 938 | Ga0495582_0168677 | |||
| 939 | Ga0495584_0099279 | |||
| 940 | Ga0495584_0153961 | |||
| 941 | Ga0495594_0006550 | |||
| 942 | Ga0495596_0065533 | |||
| 943 | Ga0495608_0010708 | |||
| 944 | Ga0495608_0115934 | |||
| 945 | Ga0495618_0003932 | |||
| 946 | Ga0495618_0037509 | |||
| 947 | Ga0495618_0049839 | |||
| 948 | Ga0495628_0000650 | |||
| 949 | Ga0495628_0126961 | |||
| 950 | Ga0495630_0050355 | |||
| 951 | Ga0495652_0009623 | |||
| 952 | Ga0495652_0031120 | |||
| 953 | Ga0495652_0044756 | |||
| 954 | Ga0495640_0272981 | |||
| 955 | Ga0495587_0000469 | |||
| 956 | Ga0495587_0036849 | |||
| 957 | Ga0495645_0000456 | |||
| 958 | Ga0495645_0047808 | |||
| 959 | Ga0495645_0155116 | |||
| 960 | Ga0495634_0057063 | |||
| 961 | Ga0495588_0003928 | |||
| 962 | Ga0495657_0010935 | |||
| 963 | Ga0495657_0017999 | |||
| 964 | Ga0495657_0066515 | |||
| 965 | Ga0495657_0076170 | |||
| 966 | Ga0495623_0000123 | |||
| 967 | Ga0495623_0128024 | |||
| 968 | Ga0495658_0202928 | |||
| 969 | Ga0495613_0020046 | |||
| 970 | Ga0495624_0044963 | |||
| 971 | Ga0495600_0087349 | |||
| 972 | Ga0495604_0000085 | |||
| 973 | Ga0495604_0045114 | |||
| 974 | Ga0495674_0038534 | |||
| 975 | Ga0495674_0039871 | |||
| 976 | Ga0495674_0172263 | |||
| 977 | Ga0495676_0000372 | |||
| 978 | Ga0495676_0074966 | |||
| 979 | Ga0495680_0022908 | |||
| 980 | Ga0495680_0024954 | |||
| 981 | Ga0495680_0030262 | |||
| 982 | Ga0495680_0065819 | |||
| 983 | Ga0495680_0100521 | |||
| 984 | Ga0495675_0000627 | |||
| 985 | Ga0495684_0040904 | |||
| 986 | Ga0495684_0041594 | |||
| 987 | Ga0496100_0026105 | |||
| 988 | Ga0496100_0032627 | |||
| 989 | Ga0496100_0061114 | |||
| 990 | Ga0496101_0010225 | |||
| 991 | Ga0496101_0097529 | |||
| 992 | Ga0496102_0018319 | |||
| 993 | Ga0496102_0028038 | |||
| 994 | Ga0496102_0037220 | |||
| 995 | Ga0496103_0017820 | |||
| 996 | Ga0496103_0044554 | |||
| 997 | Ga0496103_0132528 | |||
| 998 | Ga0496103_0235304 | |||
| 999 | Ga0496104_0002049 | |||
| 1000 | Ga0496104_0071581 | |||
| 1001 | Ga0496104_0098593 | |||
| 1002 | Ga0496105_0004500 | |||
| 1003 | Ga0496105_0005816 | |||
| 1004 | Ga0496105_0021421 | |||
| 1005 | Ga0496105_0053916 | |||
| 1006 | Ga0496105_0188456 | |||
| 1007 | Ga0496106_0013348 | |||
| 1008 | Ga0496106_0017531 | |||
| 1009 | Ga0496106_0146925 | |||
| 1010 | Ga0496106_0216208 | |||
| 1011 | Ga0496107_0031756 | |||
| 1012 | Ga0496107_0081901 | |||
| 1013 | Ga0496107_0241342 | |||
| 1014 | Ga0496108_0002865 | |||
| 1015 | Ga0496108_0006900 | |||
| 1016 | Ga0496108_0040950 | |||
| 1017 | Ga0496108_0451034 | |||
| 1018 | Ga0496108_0455647 | |||
| 1019 | Ga0496109_0003397 | |||
| 1020 | Ga0496109_0013794 | |||
| 1021 | Ga0496109_0032873 | |||
| 1022 | Ga0496109_0084068 | |||
| 1023 | Ga0496109_0208028 | |||
| 1024 | Ga0496109_0241473 | |||
| 1025 | Ga0496110_0001392 | |||
| 1026 | Ga0496111_0001619 | |||
| 1027 | Ga0496111_0104601 | |||
| 1028 | Ga0496112_0077598 | |||
| 1029 | Ga0496112_0216019 | |||
| 1030 | Ga0496112_0414401 | |||
| 1031 | Ga0496112_0463611 | |||
| 1032 | Ga0496113_0003282 | |||
| 1033 | Ga0496113_0003768 | |||
| 1034 | Ga0496113_0270527 | |||
| 1035 | Ga0496114_0077125 | |||
| 1036 | Ga0496114_0083959 | |||
| 1037 | Ga0496114_0130088 | |||
| 1038 | Ga0496115_0006938 | |||
| 1039 | Ga0496115_0053108 | |||
| 1040 | Ga0501032_0010449 | |||
| 1041 | Ga0501033_0012842 | |||
| 1042 | Ga0501036_0007928 | |||
| 1043 | Ga0501037_0002457 | |||
| 1044 | Ga0501038_0008146 | |||
| 1045 | Ga0501039_0008068 | |||
| 1046 | Ga0501040_0002978 | |||
| 1047 | Ga0501041_0010363 | |||
| 1048 | Ga0501042_0001698 | |||
| 1049 | Ga0501043_0009614 | |||
| 1050 | Ga0501046_0000511 | |||
| 1051 | Ga0501047_0283422 | |||
| 1052 | Ga0501048_0004982 | |||
| 1053 | Ga0501067_0161921 | |||
| 1054 | Ga0501068_0002005 | |||
| 1055 | Ga0501069_0000588 | |||
| 1056 | Ga0501069_0003040 | |||
| 1057 | Ga0501069_0077446 | |||
| 1058 | Ga0501070_0008776 | |||
| 1059 | Ga0501071_0007639 | |||
| 1060 | Ga0501072_0014815 | |||
| 1061 | Ga0501074_0001178 | |||
| 1062 | Ga0501075_0007888 | |||
| 1063 | Ga0501076_0008600 | |||
| 1064 | Ga0501077_0058324 | |||
| 1065 | Ga0501079_0020334 | |||
| 1066 | Ga0501080_0015265 | |||
| 1067 | Ga0501081_0018304 | |||
| 1068 | Ga0501083_0011151 | |||
| 1069 | Ga0501035_0008074 | |||
| 1070 | Ga0501044_0018079 | |||
| 1071 | Ga0501045_0007698 | |||
| 1072 | nmdc:mga05p37_126140_c1 | |||
| 1073 | nmdc:mga05p37_13543_c1 | |||
| 1074 | nmdc:mga09592_72342_c1 | |||
| 1075 | nmdc:mga06r32_12036_c1 | |||
| 1076 | nmdc:mga08y16_181386_c1 | |||
| 1077 | nmdc:mga08y16_51852_c1 | |||
| 1078 | nmdc:mga08y16_58637_c1 | |||
| 1079 | nmdc:mga0n895_14674_c1 | |||
| 1080 | nmdc:mga0n895_16218_c1 | |||
| 1081 | nmdc:mga0n895_210749_c1 | |||
| 1082 | nmdc:mga0rr50_332481_c1 | |||
| 1083 | nmdc:mga0rr50_43077_c1 | |||
| 1084 | nmdc:mga08x19_349015_c1 | |||
| 1085 | nmdc:mga08x19_3700_c1 | |||
| 1086 | nmdc:mga0a205_15383_c1 | |||
| 1087 | Ga0495601_0000269 | |||
| 1088 | Ga0495601_0013901 | |||
| 1089 | Ga0495601_0017895 | |||
| 1090 | Ga0495595_0007187 | |||
| 1091 | Ga0495595_0083471 | |||
| 1092 | Ga0495619_0001964 | |||
| 1093 | Ga0495619_0019352 | |||
| 1094 | Ga0495619_0192186 | |||
| 1095 | Ga0501084_0039093 | |||
| 1096 | Ga0501082_0010391 | |||
| 1097 | Ga0501082_0236154 | |||
| 1098 | Ga0466962_0002408 | |||
| 1099 | Ga0466962_0028761 | |||
| 1100 | Ga0466962_0095791 | |||
| 1101 | Ga0530510_0006468 | |||
| 1102 | Ga0530510_0356927 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dmu-assembly1.cif.gz_A | structure of the nhej polymerase from methanocella paludicola | 0.9417 | 2 | 294 |
| 6sa1-assembly1.cif.gz_A | post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp | 0.9113 | 1 | 308 |
| 2iry-assembly1.cif.gz_A | crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. | 0.9102 | 12 | 288 |
| 2far-assembly2.cif.gz_B | crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese | 0.9012 | 12 | 301 |
| 6sa1-assembly1.cif.gz_A | post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp | 0.9002 | 1 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2iruB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9308 | 132 | 265 | 3.30.70.3300 |
| af_O69697_22_304_3.90.920.10 | Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain | 0.9181 | 19 | 302 | 3.90.920.10 |
| af_P95226_24_305_3.90.920.10 | Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain | 0.9146 | 19 | 300 | 3.90.920.10 |
| af_O69697_22_304_3.90.920.10 | Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain | 0.9119 | 19 | 302 | 3.90.920.10 |
| af_P9WNV3_16_301_3.90.920.10 | Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain | 0.9068 | 20 | 290 | 3.90.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538GGL7-F1-model_v4 | ATP-dependent DNA ligase | 0.991 | 1 | 109 |
GO:0005524
GO:0016874 GO:0046872 |
| AF-A0A7V8XNT0-F1-model_v4 | DNA ligase D polymerase domain-containing protein | 0.9795 | 21 | 293 |
GO:0005524
GO:0046872 |
| AF-A0A538L3M1-F1-model_v4 | DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) | 0.9766 | 12 | 293 |
GO:0003677
GO:0003887 GO:0003910 GO:0004527 GO:0005524 GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A538DLM7-F1-model_v4 | DNA ligase D polymerase domain-containing protein | 0.9761 | 102 | 302 |
GO:0005524
GO:0046872 |
| AF-A0A7W0SYV6-F1-model_v4 | DNA ligase (ATP) (EC 6.5.1.1) (NHEJ DNA polymerase) | 0.9751 | 4 | 302 |
GO:0003677
GO:0003887 GO:0003910 GO:0004527 GO:0005524 GO:0006281 GO:0006310 GO:0046872 |