F462628

General Info

Members Datasets Scaffolds Average Seq Length
551 357 439 255

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100000156|Ga0307408_10000015657
Length 287
Sequence MIHECKQIIEICIKNNPDTPVNTNGNDIMNEYQDIVVEPAASGVQVIRLNRPQSKNALRNATLREVVAALAAAQDDADVRAVVITGGDGIFAAGADIHEMAALDAITAARDVRPQYWRAIAGFSKPLVAAVNGYALGAGCELLMHADIVVAGASARIGQPEINLGAIPGAGGTQRLVRTVGKPLAMKMVLGGEMISAERALAAGLVSDVVPDGEVLASAMAQAQRIAQKSPLAVALAKEAVLRSFEMHLEAGLQFERKSFSLLAASEDRREGIAAFLEKRPASFTGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
8 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
9 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
10 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
11 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
12 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
15 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
16 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
17 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
18 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
19 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
20 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
21 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
22 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
23 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
24 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
25 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
26 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
27 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
28 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
29 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
30 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
31 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
32 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
33 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
34 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
35 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
36 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
37 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
38 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
39 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
40 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
41 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
42 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
43 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
44 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
45 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
46 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
47 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
48 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
49 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
50 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
51 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
52 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2636415599 Klebsiella variicola DX120E Isolate Unclassified
60 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
61 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
62 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
63 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
64 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
65 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
66 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
67 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
68 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
69 2751185917 Enterobacter sp. HK169 Isolate Unclassified
70 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
71 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
72 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
73 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
74 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
75 2775507074 Klebsiella sp. D5A Isolate Unclassified
76 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
77 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
78 2821118458 Enterobacter asburiae 609 Isolate Unclassified
79 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
80 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
81 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
82 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
83 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
84 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
85 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
86 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
87 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
88 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
89 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
90 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
91 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
92 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
93 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
94 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
95 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
96 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
97 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
98 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
99 2937539931 Pantoea sp. LS15 Isolate Unclassified
100 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
101 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
102 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
103 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
104 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
105 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
106 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
107 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
108 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
109 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
110 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
111 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
112 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
113 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
114 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
115 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
116 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
117 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
118 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
119 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
120 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
121 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
122 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
123 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
124 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
125 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
126 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
127 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
128 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
129 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
130 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
134 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
135 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
136 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
137 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
138 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
141 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
142 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
143 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
144 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
145 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
146 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
147 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
148 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
149 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
150 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
151 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
152 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
153 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
160 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
161 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
162 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
163 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
164 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
165 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
166 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
174 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
184 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
185 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
186 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
187 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
188 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
193 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
199 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
201 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
202 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
204 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
241 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
310 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
334 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
348 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
356 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
357 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.77
Metatranscriptomes 0.73
Isolates 20.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 6.35
Nodule 1.63
Rhizoplane 9.07
Rhizosphere 54.08
Stem 0
Stem Tuber 0
Unclassified 28.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1954747 2162886007 Bacteria 6272
2 SwRhRL2b_contig_2924619 2162886007 Bacteria 10051
3 SwRhRL2b_contig_972577 2162886007 Bacteria 1601
4 JGI24741J21665_1000934 3300001915 Bacteria 8817
5 JGI25155J39150_1000048 3300002704 Bacteria 78968
6 JGI25155J39150_1000162 3300002704 Bacteria 29967
7 JGI25156J39149_1000068 3300002705 Bacteria 81397
8 JGI25154J39366_1000066 3300002738 Bacteria 103361
9 JGI25154J39366_1000084 3300002738 Bacteria 88167
10 JGI25157J39369_1000097 3300002741 Bacteria 74420
11 rootH2_10194248 3300003320 Bacteria 3790
12 rootL2_10081672 3300003322 Bacteria 3181
13 rootL2_10270437 3300003322 Bacteria 4034
14 rootH1_10038329 3300003316 Bacteria 3981
15 rootH1_10038329 3300003323 Bacteria 7171
16 Ga0006562J51391_1001541 3300003578 Bacteria 4500
17 Ga0055539_1000049 3300003752 Bacteria 186588
18 Ga0055533_1000060 3300003756 Bacteria 186588
19 Ga0055532_1000015 3300003758 Bacteria 340197
20 Ga0055525_1000068 3300003759 Bacteria 186588
21 Ga0055534_1013049 3300003784 Bacteria 1612
22 Ga0055541_1000036 3300003841 Bacteria 186588
23 Ga0058692_1003479 3300003856 Bacteria 4856
24 JGI25405J52794_10012741 3300003911 Bacteria 1623
25 Ga0058860_10162850 3300004801 Bacteria 2035
26 Ga0065714_10064514 3300005288 Bacteria 44837
27 Ga0065704_10000921 3300005289 Bacteria 21299
28 Ga0065704_10072572 3300005289 Bacteria 8315
29 Ga0070658_10201073 3300005327 Bacteria 1681
30 Ga0070683_100006203 3300005329 Bacteria 10023
31 Ga0070687_100471981 3300005343 Bacteria 839
32 Ga0070661_100141382 3300005344 Bacteria 1814
33 Ga0070668_100055520 3300005347 Bacteria 3057
34 Ga0070668_100271804 3300005347 Bacteria 1413
35 Ga0070668_100498895 3300005347 Bacteria 1053
36 Ga0070675_100016782 3300005354 Bacteria 5814
37 Ga0070659_100028712 3300005366 Bacteria 4298
38 Ga0070708_100211261 3300005445 Bacteria 1818
39 Ga0070662_100000980 3300005457 Bacteria 17479
40 Ga0070681_10494104 3300005458 Bacteria 1137
41 Ga0070685_10000914 3300005466 Bacteria 15870
42 Ga0070706_100000575 3300005467 Bacteria 42747
43 Ga0070698_100301557 3300005471 Bacteria 1533
44 Ga0070684_100000777 3300005535 Bacteria 22140
45 Ga0070697_100000615 3300005536 Bacteria 27079
46 Ga0070672_100677071 3300005543 Bacteria 902
47 Ga0070686_100000004 3300005544 Bacteria 262514
48 Ga0070665_100001044 3300005548 Bacteria 34690
49 Ga0070665_100085809 3300005548 Bacteria 3154
50 Ga0070665_100458894 3300005548 Bacteria 1284
51 Ga0068855_100081586 3300005563 Bacteria 3748
52 Ga0070664_100344563 3300005564 Unclassified 1354
53 Ga0068857_100009683 3300005577 Bacteria 8371
54 Ga0068852_100026807 3300005616 Bacteria 4690
55 Ga0068863_100009600 3300005841 Bacteria 9438
56 Ga0068860_100000720 3300005843 Bacteria 37733
57 Ga0068860_100852382 3300005843 Bacteria 926
58 Ga0068862_100096007 3300005844 Bacteria 2587
59 Ga0068862_100117392 3300005844 Bacteria 2342
60 Ga0068862_100447382 3300005844 Bacteria 1217
61 Ga0081455_10001955 3300005937 Bacteria 24750
62 Ga0081455_10035995 3300005937 Bacteria 4414
63 Ga0081538_10004229 3300005981 Bacteria 13316
64 Ga0075368_10004843 3300006042 Bacteria 4589
65 Ga0075363_100026226 3300006048 Bacteria 2979
66 Ga0075364_10009211 3300006051 Bacteria 5917
67 Ga0075364_10037587 3300006051 Bacteria 3135
68 Ga0075367_10009346 3300006178 Bacteria 5121
69 Ga0075433_10000621 3300006852 Bacteria 23646
70 Ga0075433_10016412 3300006852 Bacteria 6103
71 Ga0075434_100003713 3300006871 Bacteria 13635
72 Ga0079104_1000486 3300006946 Bacteria 43595
73 Ga0079104_1003986 3300006946 Bacteria 6562
74 Ga0079104_1013664 3300006946 Bacteria 2491
75 Ga0105251_10008811 3300009011 Bacteria 6046
76 Ga0105251_10108447 3300009011 Bacteria 1266
77 Ga0105244_10000013 3300009036 Bacteria 258350
78 Ga0105244_10000199 3300009036 Bacteria 61103
79 Ga0105244_10012216 3300009036 Bacteria 5090
80 Ga0105250_10015855 3300009092 Bacteria 3080
81 Ga0105250_10096443 3300009092 Bacteria 1206
82 Ga0105240_10000161 3300009093 Bacteria 137359
83 Ga0105240_10000721 3300009093 Bacteria 60541
84 Ga0105240_10034437 3300009093 Bacteria 6532
85 Ga0105240_10133441 3300009093 Bacteria 2975
86 Ga0105243_10000228 3300009148 Bacteria 64893
87 Ga0105243_10078738 3300009148 Bacteria 2685
88 Ga0105243_10222945 3300009148 Bacteria 1668
89 Ga0105237_10027708 3300009545 Bacteria 5777
90 Ga0105238_10036400 3300009551 Bacteria 5002
91 Ga0105238_10125603 3300009551 Bacteria 2544
92 Ga0105238_10282818 3300009551 Bacteria 1640
93 Ga0105249_10004858 3300009553 Bacteria 11596
94 Ga0105249_10025968 3300009553 Bacteria 5275
95 Ga0105239_10219907 3300010375 Bacteria 2130
96 Ga0105239_10446230 3300010375 Bacteria 1467
97 Ga0157373_10000017 3300013100 Bacteria 173186
98 Ga0157373_10087320 3300013100 Bacteria 2198
99 Ga0157371_10404245 3300013102 Bacteria 999
100 Ga0157370_10002686 3300013104 Bacteria 21320
101 Ga0157370_10004481 3300013104 Bacteria 16002
102 Ga0157369_10029447 3300013105 Bacteria 6066
103 Ga0157375_10002614 3300013308 Bacteria 15612
104 Ga0157375_10034460 3300013308 Bacteria 4824
105 Ga0157375_10372231 3300013308 Bacteria 1595
106 Ga0163163_10554584 3300014325 Bacteria 1212
107 Ga0182008_10000036 3300014497 Bacteria 130349
108 Ga0182006_1000001 3300015261 Bacteria 1091090
109 Ga0182007_10063540 3300015262 Bacteria 1210
110 Ga0183366_1001 3300015679 Bacteria 2743932
111 Ga0183370_1001 3300015680 Bacteria 2743932
112 Ga0183369_1001 3300015685 Bacteria 2743932
113 Ga0183368_1001 3300015687 Bacteria 2743932
114 Ga0163161_10006250 3300017792 Bacteria 8248
115 Ga0163161_10220599 3300017792 Bacteria 1468
116 Ga0163161_10301275 3300017792 Bacteria 1262
117 Ga0213872_10001939 3300021361 Bacteria 12637
118 Ga0213875_10002050 3300021388 Bacteria 12374
119 Ga0213875_10126297 3300021388 Bacteria 1195
120 Ga0209435_100021 3300025206 Bacteria 223961
121 Ga0209435_100074 3300025206 Bacteria 55837
122 Ga0209784_100021 3300025224 Bacteria 408534
123 Ga0209566_100039 3300025225 Bacteria 303368
124 Ga0209674_100036 3300025226 Bacteria 408534
125 Ga0209147_100004 3300025229 Bacteria 1371850
126 Ga0209563_100040 3300025230 Bacteria 408534
127 Ga0209437_100045 3300025233 Bacteria 429809
128 Ga0209258_100083 3300025242 Bacteria 246008
129 Ga0209646_1000057 3300025246 Bacteria 266384
130 Ga0209646_1000074 3300025246 Bacteria 223961
131 Ga0209026_1000058 3300025250 Bacteria 228656
132 Ga0209026_1002150 3300025250 Bacteria 7682
133 Ga0209677_100023 3300025253 Bacteria 408534
134 Ga0209759_1000046 3300025256 Bacteria 230149
135 Ga0209759_1000112 3300025256 Bacteria 143361
136 Ga0209455_1008156 3300025272 Bacteria 2875
137 Ga0209675_1000034 3300025291 Bacteria 267827
138 Ga0209564_1052543 3300025295 Bacteria 979
139 Ga0207696_1020680 3300025711 Bacteria 2117
140 Ga0207655_1000001 3300025728 Bacteria 1866413
141 Ga0207655_1000031 3300025728 Bacteria 392265
142 Ga0207655_1000247 3300025728 Bacteria 87805
143 Ga0207713_1000002 3300025735 Bacteria 1061749
144 Ga0207713_1000427 3300025735 Bacteria 44600
145 Ga0207713_1007043 3300025735 Bacteria 6736
146 Ga0207713_1025509 3300025735 Bacteria 2728
147 Ga0207713_1051863 3300025735 Bacteria 1628
148 Ga0207684_10000443 3300025910 Bacteria 54670
149 Ga0207695_10000776 3300025913 Bacteria 60540
150 Ga0207695_10001397 3300025913 Bacteria 40785
151 Ga0207695_10123700 3300025913 Bacteria 2552
152 Ga0207695_10683459 3300025913 Bacteria 907
153 Ga0207671_10090769 3300025914 Bacteria 2301
154 Ga0207662_10234000 3300025918 Bacteria 1201
155 Ga0207694_10000041 3300025924 Bacteria 183415
156 Ga0207664_10493169 3300025929 Bacteria 1096
157 Ga0207706_10022240 3300025933 Bacteria 5690
158 Ga0207709_10000169 3300025935 Bacteria 87123
159 Ga0207709_10385580 3300025935 Bacteria 1067
160 Ga0207669_10690571 3300025937 Bacteria 838
161 Ga0207704_10259767 3300025938 Bacteria 1309
162 Ga0207691_10396990 3300025940 Bacteria 1176
163 Ga0207689_10634290 3300025942 Unclassified 900
164 Ga0207661_10004240 3300025944 Bacteria 10036
165 Ga0207667_10000043 3300025949 Bacteria 261426
166 Ga0207712_10090152 3300025961 Bacteria 2255
167 Ga0207668_10041839 3300025972 Bacteria 3099
168 Ga0207668_10481854 3300025972 Bacteria 1064
169 Ga0207708_10153178 3300026075 Bacteria 1817
170 Ga0207641_10013538 3300026088 Bacteria 6691
171 Ga0207674_10031454 3300026116 Bacteria 5576
172 Ga0207674_10083449 3300026116 Bacteria 3195
173 Ga0207698_10093063 3300026142 Bacteria 2474
174 Ga0209281_1000004 3300027111 Bacteria 1253949
175 Ga0209281_1001709 3300027111 Bacteria 11361
176 Ga0209281_1002630 3300027111 Bacteria 6888
177 Ga0209371_1000001 3300027312 Bacteria 2771503
178 Ga0209371_1000278 3300027312 Bacteria 59137
179 Ga0209371_1011043 3300027312 Bacteria 2713
180 Ga0209813_10000317 3300027866 Bacteria 12790
181 Ga0268266_10003024 3300028379 Bacteria 17278
182 Ga0268264_10173312 3300028381 Bacteria 1953
183 Ga0268264_10175810 3300028381 Bacteria 1940
184 Ga0268256_1000001 3300030500 Bacteria 2771065
185 Ga0268256_1000231 3300030500 Bacteria 59137
186 Ga0268256_1011944 3300030500 Bacteria 2713
187 Ga0265327_10015107 3300031251 Bacteria 5006
188 Ga0307408_100000156 3300031548 Bacteria 76233
189 Ga0307408_100018396 3300031548 Bacteria 4691
190 Ga0307408_100052420 3300031548 Bacteria 2942
191 Ga0316576_10023725 3300031727 Bacteria 4277
192 Ga0316576_10124888 3300031727 Bacteria 1933
193 Ga0316576_10238954 3300031727 Bacteria 1365
194 Ga0316578_10000926 3300031728 Bacteria 11117
195 Ga0307405_10015026 3300031731 Bacteria 4179
196 Ga0307405_10021280 3300031731 Bacteria 3642
197 Ga0307405_10105407 3300031731 Unclassified 1899
198 Ga0307413_10005855 3300031824 Bacteria 5543
199 Ga0307410_10003925 3300031852 Bacteria 7569
200 Ga0307410_10469653 3300031852 Bacteria 1030
201 Ga0307412_10000006 3300031911 Bacteria 506878
202 Ga0307412_10001251 3300031911 Bacteria 14374
203 Ga0307412_10005118 3300031911 Bacteria 7339
204 Ga0307409_100217066 3300031995 Unclassified 1724
205 Ga0307409_100264445 3300031995 Bacteria 1580
206 Ga0307409_100857787 3300031995 Bacteria 919
207 Ga0307416_100000016 3300032002 Bacteria 205465
208 Ga0307416_100022109 3300032002 Bacteria 4582
209 Ga0307416_100049454 3300032002 Bacteria 3343
210 Ga0307416_100395191 3300032002 Unclassified 1418
211 Ga0307414_10000031 3300032004 Bacteria 186808
212 Ga0307414_10026949 3300032004 Bacteria 3706
213 Ga0307414_10091350 3300032004 Bacteria 2262
214 Ga0307411_10054419 3300032005 Bacteria 2627
215 Ga0307415_100015485 3300032126 Bacteria 4517
216 Ga0307415_100451667 3300032126 Bacteria 1111
217 Ga0316596_1040920 3300033541 Bacteria 1217
218 Ga0373959_0000113 3300034820 Bacteria 18158
219 Ga0373961_0032026 3300035241 Bacteria 1472
220 Ga0316574_0012656 3300035398 Bacteria 4831
221 Ga0316584_0001367 3300036712 Bacteria 14515
222 Ga0316584_0020970 3300036712 Bacteria 4746
223 Ga0316584_0217747 3300036712 Bacteria 1404
224 Ga0395899_0100098 3300037312 Bacteria 2093
225 Ga0395900_0137216 3300037418 Bacteria 2506
226 Ga0395905_0033946 3300037471 Bacteria 4791
227 Ga0436364_0181350 3300037853 Bacteria 1186
228 Ga0436364_0898868 3300037853 Bacteria 46055
229 Ga0400483_030976 3300039062 Bacteria 10375
230 Ga0400483_120856 3300039062 Bacteria 19505
231 Ga0400483_128277 3300039062 Bacteria 37786
232 Ga0400483_147462 3300039062 Bacteria 8185
233 Ga0436361_1172308 3300039447 Bacteria 8529
234 Ga0436361_1219561 3300039447 Bacteria 1703
235 Ga0439465_0000018 3300041413 Bacteria 33089
236 Ga0439445_0006324 3300042004 Bacteria 2719
237 Ga0439432_018275 3300042006 Bacteria 2343
238 Ga0439452_000014 3300042010 Bacteria 344969
239 Ga0466981_0000027 3300044669 Bacteria 71694
240 Ga0451576_0771744 3300045051 Bacteria 1010
241 Ga0495627_000030 3300046453 Bacteria 228883
242 Ga0495591_000003 3300046458 Bacteria 449825
243 Ga0495638_0040399 3300046460 Bacteria 2956
244 Ga0495651_0026866 3300046462 Bacteria 4482
245 Ga0495650_0000005 3300046471 Bacteria 766553
246 Ga0495650_0021197 3300046471 Bacteria 3149
247 Ga0495580_0002211 3300046472 Bacteria 17022
248 Ga0495596_0013932 3300046500 Bacteria 3396
249 Ga0495607_0000138 3300046501 Bacteria 77180
250 Ga0495606_0005420 3300046507 Bacteria 12224
251 Ga0495606_0016414 3300046507 Bacteria 5646
252 Ga0495606_0030351 3300046507 Bacteria 3778
253 Ga0495610_0000036 3300046512 Bacteria 186904
254 Ga0495618_0131140 3300046514 Bacteria 1604
255 Ga0495628_0000037 3300046516 Bacteria 109854
256 Ga0495632_0007379 3300046519 Bacteria 6918
257 Ga0495643_0000286 3300046522 Bacteria 72166
258 Ga0495643_0030915 3300046522 Bacteria 2985
259 Ga0495643_0038227 3300046522 Bacteria 2629
260 Ga0495648_0011496 3300046524 Bacteria 6661
261 Ga0495663_0000014 3300046525 Bacteria 149657
262 Ga0495663_0005143 3300046525 Bacteria 3647
263 Ga0495652_0212407 3300046529 Bacteria 1459
264 Ga0495654_0000003 3300046530 Bacteria 863485
265 Ga0495609_0000003 3300046538 Bacteria 711547
266 Ga0495633_0000001 3300046558 Bacteria 801972
267 Ga0495633_0007840 3300046558 Bacteria 6095
268 Ga0495668_0075216 3300046616 Bacteria 1855
269 Ga0495625_0000135 3300046660 Bacteria 114867
270 Ga0495625_0001718 3300046660 Bacteria 25444
271 Ga0495625_0013150 3300046660 Bacteria 6668
272 Ga0495661_0000601 3300046665 Bacteria 36844
273 Ga0495588_0000261 3300046674 Bacteria 42963
274 Ga0495623_0006352 3300046679 Bacteria 7681
275 Ga0495646_0067168 3300046680 Bacteria 2120
276 Ga0495687_000277 3300047443 Bacteria 67841
277 Ga0495679_070736 3300047446 Bacteria 1005
278 Ga0495673_0001549 3300047469 Bacteria 18046
279 Ga0495686_0000136 3300047472 Bacteria 148759
280 Ga0495686_0000955 3300047472 Bacteria 35740
281 Ga0495602_0058674 3300048088 Bacteria 3367
282 Ga0496102_0289538 3300048905 Bacteria 1544
283 Ga0496104_0000043 3300048907 Bacteria 154773
284 Ga0496104_0067080 3300048907 Bacteria 3408
285 Ga0496104_0251993 3300048907 Bacteria 1678
286 Ga0496104_0387253 3300048907 Bacteria 1310
287 Ga0496105_0044457 3300048908 Bacteria 3663
288 Ga0496105_0400589 3300048908 Bacteria 1089
289 Ga0496110_0010739 3300048913 Bacteria 7461
290 Ga0496112_0436879 3300048915 Bacteria 1247
291 Ga0496114_0057246 3300048917 Bacteria 3254
292 Ga0496116_0000068 3300048919 Bacteria 259724
293 Ga0496116_0000877 3300048919 Bacteria 37519
294 Ga0496116_0025771 3300048919 Bacteria 4314
295 Ga0496116_0027914 3300048919 Bacteria 4099
296 Ga0496116_0038804 3300048919 Bacteria 3301
297 Ga0496116_0040404 3300048919 Bacteria 3212
298 Ga0496116_0062952 3300048919 Bacteria 2392
299 Ga0496117_0000020 3300048920 Bacteria 458405
300 Ga0496117_0000062 3300048920 Bacteria 257535
301 Ga0496117_0004453 3300048920 Bacteria 15443
302 Ga0496117_0012908 3300048920 Bacteria 7322
303 Ga0496117_0021503 3300048920 Bacteria 5215
304 Ga0496117_0021990 3300048920 Bacteria 5131
305 Ga0496117_0033790 3300048920 Bacteria 3862
306 Ga0496117_0086189 3300048920 Bacteria 2041
307 Ga0496117_0102415 3300048920 Bacteria 1807
308 Ga0496118_0000015 3300048921 Bacteria 551359
309 Ga0496118_0000113 3300048921 Bacteria 150726
310 Ga0496118_0005707 3300048921 Bacteria 14014
311 Ga0496118_0023833 3300048921 Bacteria 5303
312 Ga0496118_0024690 3300048921 Bacteria 5178
313 Ga0496118_0045225 3300048921 Bacteria 3439
314 Ga0496118_0094672 3300048921 Bacteria 2041
315 Ga0496119_0000024 3300048922 Bacteria 257750
316 Ga0496119_0002826 3300048922 Bacteria 18578
317 Ga0496119_0003849 3300048922 Bacteria 15330
318 Ga0496119_0005039 3300048922 Bacteria 12839
319 Ga0496119_0057863 3300048922 Bacteria 2339
320 Ga0496119_0119410 3300048922 Bacteria 1451
321 Ga0496119_0146540 3300048922 Bacteria 1269
322 Ga0496120_0000497 3300048923 Bacteria 61419
323 Ga0496120_0001405 3300048923 Bacteria 29145
324 Ga0496120_0002649 3300048923 Bacteria 17666
325 Ga0496120_0003690 3300048923 Bacteria 13665
326 Ga0496120_0016822 3300048923 Bacteria 4763
327 Ga0496120_0032497 3300048923 Bacteria 3146
328 Ga0496121_0000760 3300048924 Bacteria 59241
329 Ga0496121_0001539 3300048924 Bacteria 38620
330 Ga0496121_0003938 3300048924 Bacteria 20555
331 Ga0496121_0013513 3300048924 Bacteria 8763
332 Ga0496121_0015948 3300048924 Bacteria 7798
333 Ga0496121_0018603 3300048924 Bacteria 6995
334 Ga0496121_0023348 3300048924 Bacteria 5960
335 Ga0496121_0040845 3300048924 Bacteria 4063
336 Ga0496121_0077819 3300048924 Bacteria 2639
337 Ga0496121_0117777 3300048924 Bacteria 2012
338 Ga0496121_0149445 3300048924 Bacteria 1721
339 Ga0496122_0000005 3300048925 Bacteria 630659
340 Ga0496122_0000245 3300048925 Bacteria 121737
341 Ga0496122_0000491 3300048925 Bacteria 82131
342 Ga0496122_0000666 3300048925 Bacteria 69147
343 Ga0496122_0001318 3300048925 Bacteria 40697
344 Ga0496122_0004047 3300048925 Bacteria 18621
345 Ga0496122_0005153 3300048925 Bacteria 15758
346 Ga0496122_0006470 3300048925 Bacteria 13435
347 Ga0496122_0010862 3300048925 Bacteria 9323
348 Ga0496122_0017000 3300048925 Bacteria 6832
349 Ga0496122_0022684 3300048925 Bacteria 5571
350 Ga0496122_0023737 3300048925 Bacteria 5391
351 Ga0496122_0029718 3300048925 Bacteria 4599
352 Ga0496122_0040104 3300048925 Bacteria 3726
353 Ga0496122_0053747 3300048925 Bacteria 3032
354 Ga0496122_0177846 3300048925 Bacteria 1273
355 Ga0496122_0244031 3300048925 Bacteria 1010
356 Ga0496123_0000008 3300048926 Bacteria 630628
357 Ga0496123_0000488 3300048926 Bacteria 69002
358 Ga0496123_0001674 3300048926 Bacteria 29668
359 Ga0496123_0004559 3300048926 Bacteria 14451
360 Ga0496123_0006397 3300048926 Bacteria 11424
361 Ga0496123_0011450 3300048926 Bacteria 7685
362 Ga0496123_0014211 3300048926 Bacteria 6616
363 Ga0496123_0032809 3300048926 Bacteria 3749
364 Ga0496123_0069385 3300048926 Bacteria 2213
365 Ga0496124_0002391 3300048927 Bacteria 24687
366 Ga0496124_0004679 3300048927 Bacteria 15817
367 Ga0496124_0008418 3300048927 Bacteria 10789
368 Ga0496124_0021594 3300048927 Bacteria 5929
369 Ga0496124_0039284 3300048927 Bacteria 4103
370 Ga0496124_0227345 3300048927 Bacteria 1398
371 Ga0496124_0430813 3300048927 Bacteria 905
372 Ga0496125_0000757 3300048928 Bacteria 52952
373 Ga0496125_0002896 3300048928 Bacteria 21614
374 Ga0496125_0003692 3300048928 Bacteria 18271
375 Ga0496125_0013645 3300048928 Bacteria 7975
376 Ga0496125_0019324 3300048928 Bacteria 6432
377 Ga0496125_0030372 3300048928 Bacteria 4835
378 Ga0496125_0051682 3300048928 Bacteria 3386
379 Ga0496125_0064977 3300048928 Bacteria 2894
380 Ga0496125_0071008 3300048928 Bacteria 2723
381 Ga0496125_0091566 3300048928 Bacteria 2277
382 Ga0496125_0127447 3300048928 Bacteria 1800
383 Ga0496125_0156587 3300048928 Bacteria 1555
384 Ga0496126_0000142 3300048929 Bacteria 164438
385 Ga0496126_0003795 3300048929 Bacteria 18759
386 Ga0496126_0011526 3300048929 Bacteria 9138
387 Ga0496126_0020397 3300048929 Bacteria 6499
388 Ga0496126_0072827 3300048929 Bacteria 3055
389 Ga0496126_0252116 3300048929 Bacteria 1470
390 Ga0496126_0265037 3300048929 Bacteria 1427
391 Ga0501335_000232 3300049551 Bacteria 3157
392 Ga0501032_0195206 3300049569 Bacteria 1322
393 Ga0501036_0014674 3300049572 Bacteria 6530
394 Ga0501038_0032333 3300049574 Bacteria 4617
395 Ga0501039_0060915 3300049575 Bacteria 2922
396 Ga0501040_0040457 3300049576 Bacteria 3172
397 Ga0501041_0241270 3300049577 Bacteria 1136
398 Ga0501042_0046528 3300049578 Bacteria 3093
399 Ga0501048_0033655 3300049582 Bacteria 3701
400 Ga0501048_0415069 3300049582 Bacteria 963
401 Ga0501068_0241228 3300049584 Bacteria 1150
402 Ga0501069_0277019 3300049585 Bacteria 981
403 Ga0501071_0010741 3300049587 Bacteria 6141
404 Ga0501071_0590304 3300049587 Bacteria 854
405 Ga0501072_0025426 3300049588 Bacteria 4612
406 Ga0501075_0016758 3300049591 Bacteria 5284
407 Ga0501075_0048812 3300049591 Bacteria 3181
408 Ga0501076_0015876 3300049592 Bacteria 5698
409 Ga0501077_0017381 3300049593 Bacteria 4539
410 Ga0501077_0157022 3300049593 Bacteria 1444
411 Ga0501079_0055899 3300049741 Bacteria 3045
412 Ga0501080_0038923 3300049742 Bacteria 4438
413 Ga0501081_0042779 3300049743 Bacteria 3105
414 Ga0501241_000004 3300049758 Bacteria 177326
415 Ga0501269_000046 3300049766 Bacteria 38459
416 Ga0501035_0418050 3300049822 Bacteria 1113
417 Ga0501045_0004002 3300049824 Bacteria 10148
418 nmdc:mga00v17_559_c3 3300050491 Bacteria 5613
419 nmdc:mga06z11_11389_c1 3300050494 Bacteria 3834
420 nmdc:mga04h51_2600_c1 3300050495 Bacteria 4295
421 nmdc:mga05p37_133895_c1 3300050507 Bacteria 3040
422 nmdc:mga0rr50_431901_c1 3300050513 Bacteria 1115
423 nmdc:mga08x19_46611_c1 3300050514 Bacteria 2773
424 nmdc:mga0a205_15541_c1 3300050515 Bacteria 7113
425 nmdc:mga0a205_3215_c1 3300050515 Bacteria 14524
426 Ga0495601_0146643 3300053077 Bacteria 1540
427 Ga0500643_000172 3300053087 Bacteria 63436
428 Ga0500643_038257 3300053087 Bacteria 1423
429 Ga0500556_0000136 3300053104 Bacteria 62226
430 Ga0500618_000753 3300053125 Bacteria 18333
431 Ga0500628_001253 3300053129 Bacteria 4387
432 Ga0500642_0000003 3300053130 Bacteria 544899
433 Ga0500559_0003399 3300053136 Bacteria 7838
434 Ga0500645_000261 3300053730 Bacteria 37957
435 Ga0501084_0013768 3300054114 Bacteria 6694
436 Ga0500661_000324 3300055283 Bacteria 8754
437 Ga0501082_0028434 3300060353 Bacteria 4816
438 Ga0530510_0005135 3300061734 Bacteria 9032
439 Ga0530510_0237338 3300061734 Bacteria 1357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_10000914 Ga0070685_1000091414 225
2 3300003856 Ga0058692_1003479 Ga0058692_10034792 226
3 3300025937 Ga0207669_10690571 Ga0207669_106905712 226
4 3300027312 Ga0209371_1000001 Ga0209371_10000011231 226
5 3300030500 Ga0268256_1000001 Ga0268256_10000011410 226
6 3300046507 Ga0495606_0030351 Ga0495606_0030351_1717_2496 229
7 3300047443 Ga0495687_000277 Ga0495687_000277_41983_42762 229
8 3300039062 Ga0400483_030976 Ga0400483_030976_5085_5855 230
9 3300039062 Ga0400483_128277 Ga0400483_128277_5560_6330 231
10 3300025735 Ga0207713_1051863 Ga0207713_10518632 232
11 3300048905 Ga0496102_0289538 Ga0496102_0289538_127_894 232
12 3300048921 Ga0496118_0024690 Ga0496118_0024690_2114_2881 232
13 3300048922 Ga0496119_0002826 Ga0496119_0002826_17732_18499 232
14 3300048923 Ga0496120_0001405 Ga0496120_0001405_25163_25930 232
15 3300048924 Ga0496121_0001539 Ga0496121_0001539_7594_8361 232
16 3300021361 Ga0213872_10001939 Ga0213872_1000193912 234
17 3300039447 Ga0436361_1172308 Ga0436361_1172308_783_1574 234
18 3300005577 Ga0068857_100009683 Ga0068857_1000096837 235
19 3300026116 Ga0207674_10031454 Ga0207674_100314543 235
20 3300027111 Ga0209281_1002630 Ga0209281_10026305 235
21 3300048928 Ga0496125_0064977 Ga0496125_0064977_1325_2092 235
22 3300048928 Ga0496125_0091566 Ga0496125_0091566_844_1611 239
23 3300005366 Ga0070659_100028712 Ga0070659_1000287122 240
24 3300048922 Ga0496119_0119410 Ga0496119_0119410_502_1269 240
25 3300048926 Ga0496123_0069385 Ga0496123_0069385_1330_2097 240
26 3300048929 Ga0496126_0000142 Ga0496126_0000142_114105_114872 240
27 3300021388 Ga0213875_10002050 Ga0213875_100020502 241
28 3300037853 Ga0436364_0898868 Ga0436364_0898868_18116_18898 241
29 3300048915 Ga0496112_0436879 Ga0496112_0436879_204_977 241
30 3300049582 Ga0501048_0415069 Ga0501048_0415069_16_744 241
31 3300005843 Ga0068860_100000720 Ga0068860_1000007204 242
32 3300028381 Ga0268264_10175810 Ga0268264_101758103 242
33 3300048926 Ga0496123_0032809 Ga0496123_0032809_834_1601 242
34 3300045051 Ga0451576_0771744 Ga0451576_0771744_38_826 243
35 iso_pu_bacteria 2548876994 2550697082 243
36 3300046522 Ga0495643_0030915 Ga0495643_0030915_13_747 244
37 3300048920 Ga0496117_0033790 Ga0496117_0033790_3109_3843 244
38 iso_pu_bacteria 2738541273 2738698497 244
39 iso_pu_bacteria 2738543014 2739252823 244
40 3300005457 Ga0070662_100000980 Ga0070662_10000098015 245
41 3300009092 Ga0105250_10096443 Ga0105250_100964432 245
42 3300015679 Ga0183366_1001 Ga0183366_10011298 245
43 3300015680 Ga0183370_1001 Ga0183370_10011298 245
44 3300015685 Ga0183369_1001 Ga0183369_10011298 245
45 3300015687 Ga0183368_1001 Ga0183368_10011298 245
46 3300025735 Ga0207713_1007043 Ga0207713_10070434 245
47 3300025933 Ga0207706_10022240 Ga0207706_100222403 245
48 3300027312 Ga0209371_1011043 Ga0209371_10110432 245
49 3300030500 Ga0268256_1011944 Ga0268256_10119442 245
50 3300048920 Ga0496117_0012908 Ga0496117_0012908_2123_2890 245
51 3300048920 Ga0496117_0021503 Ga0496117_0021503_3658_4425 245
52 3300048921 Ga0496118_0005707 Ga0496118_0005707_5846_6613 245
53 3300048921 Ga0496118_0094672 Ga0496118_0094672_572_1339 245
54 3300048923 Ga0496120_0016822 Ga0496120_0016822_1486_2253 245
55 3300048925 Ga0496122_0010862 Ga0496122_0010862_2578_3345 245
56 3300048925 Ga0496122_0017000 Ga0496122_0017000_2219_2986 245
57 3300048925 Ga0496122_0023737 Ga0496122_0023737_2219_2986 245
58 3300048926 Ga0496123_0001674 Ga0496123_0001674_9018_9785 245
59 3300048926 Ga0496123_0014211 Ga0496123_0014211_5751_6518 245
60 3300048928 Ga0496125_0030372 Ga0496125_0030372_803_1570 245
61 3300005844 Ga0068862_100096007 Ga0068862_1000960072 246
62 3300026116 Ga0207674_10083449 Ga0207674_100834493 246
63 3300009553 Ga0105249_10025968 Ga0105249_100259682 247
64 3300048924 Ga0496121_0040845 Ga0496121_0040845_507_1274 247
65 iso_pu_bacteria 2511231000 2511233506 247
66 iso_pu_bacteria 2523533629 2524005182 247
67 iso_pu_bacteria 2582581278 2585141963 247
68 iso_pu_bacteria 2582581281 2585157791 247
69 iso_pu_bacteria 2582581282 2585162076 247
70 iso_pu_bacteria 2582581873 2585426346 247
71 iso_pu_bacteria 2585428060 2587747446 247
72 iso_pu_bacteria 2585428061 2587752769 247
73 iso_pu_bacteria 2585428115 2587944769 247
74 iso_pu_bacteria 2585428182 2588212004 247
75 iso_pu_bacteria 2585428183 2588216333 247
76 iso_pu_bacteria 2585428184 2588221098 247
77 iso_pu_bacteria 2585428185 2588225548 247
78 iso_pu_bacteria 2585428187 2588231979 247
79 iso_pu_bacteria 2588253712 2588448116 247
80 iso_pu_bacteria 2588254257 2590609394 247
81 iso_pu_bacteria 2599185169 2599409655 247
82 iso_pu_bacteria 2600255307 2601739669 247
83 iso_pu_bacteria 2600255309 2601750158 247
84 iso_pu_bacteria 2600255392 2602017411 247
85 iso_pu_bacteria 2675903046 2676406803 247
86 iso_pu_bacteria 2728369107 2729203118 247
87 iso_pu_bacteria 2739367874 2740059672 247
88 iso_pu_bacteria 2765235839 2765574853 247
89 iso_pu_bacteria 2772190705 2772606201 247
90 iso_pu_bacteria 2775506739 2775675008 247
91 iso_pu_bacteria 2816332188 2816876138 247
92 iso_pu_bacteria 2842083920 2842087061 247
93 iso_pu_bacteria 2871720351 2871721541 247
94 iso_pu_bacteria 2889290771 2889294594 247
95 iso_pu_bacteria 2905999023 2906002365 247
96 iso_pu_bacteria 2919097161 2919100317 247
97 iso_pu_bacteria 2919399522 2919402046 247
98 iso_pu_bacteria 2945924605 2945925481 247
99 iso_pu_bacteria 2977243572 2977244318 247
100 iso_pu_bacteria 2984572630 2984573793 247
101 iso_pu_bacteria 2984606641 2984607234 247
102 iso_pu_bacteria 2993372514 2993375786 247
103 iso_pu_bacteria 2993480792 2993482650 247
104 3300039062 Ga0400483_120856 Ga0400483_120856_491_1261 248
105 3300039062 Ga0400483_147462 Ga0400483_147462_6503_7273 248
106 2162886007 SwRhRL2b_contig_972577 SwRhRL2b_0900.00007670 249
107 3300001915 JGI24741J21665_1000934 JGI24741J21665_10009347 249
108 3300003320 rootH2_10194248 rootH2_101942483 249
109 3300003322 rootL2_10270437 rootL2_102704375 249
110 3300003323 rootH1_10038329 rootH1_100383295 249
111 3300003578 Ga0006562J51391_1001541 Ga0006562J51391_10015412 249
112 3300003784 Ga0055534_1013049 Ga0055534_10130492 249
113 3300004801 Ga0058860_10162850 Ga0058860_101628503 249
114 3300005288 Ga0065714_10064514 Ga0065714_1006451433 249
115 3300005289 Ga0065704_10072572 Ga0065704_100725723 249
116 3300005327 Ga0070658_10201073 Ga0070658_102010732 249
117 3300005329 Ga0070683_100006203 Ga0070683_1000062036 249
118 3300005344 Ga0070661_100141382 Ga0070661_1001413822 249
119 3300005347 Ga0070668_100055520 Ga0070668_1000555202 249
120 3300005347 Ga0070668_100498895 Ga0070668_1004988952 249
121 3300005535 Ga0070684_100000777 Ga0070684_1000007776 249
122 3300005844 Ga0068862_100447382 Ga0068862_1004473822 249
123 3300009036 Ga0105244_10000013 Ga0105244_1000001374 249
124 3300009092 Ga0105250_10015855 Ga0105250_100158554 249
125 3300009148 Ga0105243_10000228 Ga0105243_1000022830 249
126 3300009148 Ga0105243_10078738 Ga0105243_100787383 249
127 3300013100 Ga0157373_10000017 Ga0157373_1000001788 249
128 3300013102 Ga0157371_10404245 Ga0157371_104042451 249
129 3300013104 Ga0157370_10004481 Ga0157370_100044813 249
130 3300013105 Ga0157369_10029447 Ga0157369_100294476 249
131 3300013308 Ga0157375_10002614 Ga0157375_100026149 249
132 3300013308 Ga0157375_10372231 Ga0157375_103722312 249
133 3300014497 Ga0182008_10000036 Ga0182008_1000003680 249
134 3300015261 Ga0182006_1000001 Ga0182006_100000173 249
135 3300015262 Ga0182007_10063540 Ga0182007_100635402 249
136 3300017792 Ga0163161_10006250 Ga0163161_100062507 249
137 3300017792 Ga0163161_10220599 Ga0163161_102205992 249
138 3300017792 Ga0163161_10301275 Ga0163161_103012752 249
139 3300025291 Ga0209675_1000034 Ga0209675_1000034170 249
140 3300025295 Ga0209564_1052543 Ga0209564_10525431 249
141 3300025728 Ga0207655_1000031 Ga0207655_100003174 249
142 3300025935 Ga0207709_10000169 Ga0207709_1000016979 249
143 3300025935 Ga0207709_10385580 Ga0207709_103855802 249
144 3300025944 Ga0207661_10004240 Ga0207661_100042406 249
145 3300025972 Ga0207668_10041839 Ga0207668_100418393 249
146 3300031911 Ga0307412_10000006 Ga0307412_1000000674 249
147 3300031911 Ga0307412_10001251 Ga0307412_1000125111 249
148 3300031911 Ga0307412_10005118 Ga0307412_100051181 249
149 3300032002 Ga0307416_100000016 Ga0307416_100000016113 249
150 3300032004 Ga0307414_10000031 Ga0307414_10000031158 249
151 3300032004 Ga0307414_10091350 Ga0307414_100913501 249
152 3300041413 Ga0439465_0000018 Ga0439465_0000018_27092_27868 249
153 3300042004 Ga0439445_0006324 Ga0439445_0006324_981_1748 249
154 3300046453 Ga0495627_000030 Ga0495627_000030_78686_79453 249
155 3300046460 Ga0495638_0040399 Ga0495638_0040399_256_1023 249
156 3300046500 Ga0495596_0013932 Ga0495596_0013932_2419_3186 249
157 3300046507 Ga0495606_0005420 Ga0495606_0005420_3299_4066 249
158 3300046512 Ga0495610_0000036 Ga0495610_0000036_108962_109759 249
159 3300046519 Ga0495632_0007379 Ga0495632_0007379_3526_4293 249
160 3300046522 Ga0495643_0038227 Ga0495643_0038227_22_789 249
161 3300046525 Ga0495663_0000014 Ga0495663_0000014_94609_95376 249
162 3300046525 Ga0495663_0005143 Ga0495663_0005143_1470_2237 249
163 3300046530 Ga0495654_0000003 Ga0495654_0000003_6510_7277 249
164 3300046538 Ga0495609_0000003 Ga0495609_0000003_6463_7230 249
165 3300046558 Ga0495633_0000001 Ga0495633_0000001_81605_82372 249
166 3300046558 Ga0495633_0007840 Ga0495633_0007840_1964_2731 249
167 3300046660 Ga0495625_0000135 Ga0495625_0000135_107600_108367 249
168 3300047472 Ga0495686_0000136 Ga0495686_0000136_141506_142273 249
169 3300047472 Ga0495686_0000955 Ga0495686_0000955_26970_27737 249
170 3300048907 Ga0496104_0251993 Ga0496104_0251993_584_1351 249
171 3300048919 Ga0496116_0000068 Ga0496116_0000068_182381_183148 249
172 3300048920 Ga0496117_0000062 Ga0496117_0000062_180360_181127 249
173 3300048920 Ga0496117_0102415 Ga0496117_0102415_312_1079 249
174 3300048921 Ga0496118_0000113 Ga0496118_0000113_91486_92253 249
175 3300048922 Ga0496119_0000024 Ga0496119_0000024_180371_181138 249
176 3300048924 Ga0496121_0149445 Ga0496121_0149445_41_808 249
177 3300048925 Ga0496122_0000245 Ga0496122_0000245_39612_40400 249
178 3300048925 Ga0496122_0000666 Ga0496122_0000666_33086_33853 249
179 3300048925 Ga0496122_0001318 Ga0496122_0001318_38150_38917 249
180 3300048925 Ga0496122_0022684 Ga0496122_0022684_4274_5041 249
181 3300048925 Ga0496122_0053747 Ga0496122_0053747_1782_2549 249
182 3300048926 Ga0496123_0004559 Ga0496123_0004559_13156_13923 249
183 3300048926 Ga0496123_0011450 Ga0496123_0011450_6432_7199 249
184 3300048927 Ga0496124_0002391 Ga0496124_0002391_6920_7687 249
185 3300048928 Ga0496125_0002896 Ga0496125_0002896_13069_13836 249
186 3300048928 Ga0496125_0071008 Ga0496125_0071008_678_1451 249
187 3300048929 Ga0496126_0011526 Ga0496126_0011526_7985_8752 249
188 3300049551 Ga0501335_000232 Ga0501335_000232_863_1639 249
189 3300049758 Ga0501241_000004 Ga0501241_000004_94634_95410 249
190 3300049766 Ga0501269_000046 Ga0501269_000046_20436_21212 249
191 iso_pu_bacteria 2585428045 2587680303 249
192 iso_pu_bacteria 2588254255 2590603985 249
193 iso_pu_bacteria 2751185877 2753674739 249
194 iso_pu_bacteria 2946019816 2946023319 249
195 3300036712 Ga0316584_0001367 Ga0316584_0001367_5550_6311 250
196 3300044669 Ga0466981_0000027 Ga0466981_0000027_54166_54933 250
197 iso_pu_bacteria 2600255254 2601521851 251
198 iso_pu_bacteria 2600255255 2601526876 251
199 iso_pu_bacteria 2600255280 2601613706 251
200 iso_pu_bacteria 2600255281 2601618429 251
201 iso_pu_bacteria 2600255287 2601642944 251
202 iso_pu_bacteria 2600255288 2601647814 251
203 iso_pu_bacteria 2600255289 2601651854 251
204 iso_pu_bacteria 2600255290 2601657181 251
205 iso_pu_bacteria 2600255291 2601662765 251
206 iso_pu_bacteria 2600255298 2601695722 251
207 iso_pu_bacteria 2600255299 2601700398 251
208 iso_pu_bacteria 2600255300 2601704978 251
209 iso_pu_bacteria 2600255301 2601710007 251
210 iso_pu_bacteria 2600255302 2601715019 251
211 iso_pu_bacteria 2600255303 2601720749 251
212 iso_pu_bacteria 2600255304 2601725425 251
213 iso_pu_bacteria 2600255305 2601729967 251
214 iso_pu_bacteria 2600255306 2601734984 251
215 iso_pu_bacteria 2602042047 2603642477 251
216 iso_pu_bacteria 2602042052 2603660139 251
217 iso_pu_bacteria 2602042053 2603665415 251
218 iso_pu_bacteria 2602042067 2603703076 251
219 iso_pu_bacteria 2602042103 2603837350 251
220 iso_pu_bacteria 2602042104 2603842426 251
221 iso_pu_bacteria 2602042105 2603847499 251
222 iso_pu_bacteria 2602042106 2603852570 251
223 iso_pu_bacteria 2602042110 2603870623 251
224 iso_pu_bacteria 2602042111 2603875558 251
225 iso_pu_bacteria 2603880178 2606047814 251
226 iso_pu_bacteria 2603880184 2606069846 251
227 iso_pu_bacteria 2603880202 2606145681 251
228 iso_pu_bacteria 2603880211 2606175216 251
229 iso_pu_bacteria 2636415599 2637225580 251
230 iso_pu_bacteria 2667528172 2671103035 251
231 iso_pu_bacteria 2681812866 2681997397 251
232 iso_pu_bacteria 2681812869 2682005322 251
233 iso_pu_bacteria 2751185917 2753855899 251
234 iso_pu_bacteria 2765235842 2765588893 251
235 iso_pu_bacteria 2775506706 2775538917 251
236 iso_pu_bacteria 2775507074 2777022936 251
237 iso_pu_bacteria 2821118458 2821119729 251
238 iso_pu_bacteria 2823373977 2823374685 251
239 iso_pu_bacteria 2844425489 2844427452 251
240 iso_pu_bacteria 2884086401 2884088853 251
241 iso_pu_bacteria 2904513164 2904513559 251
242 iso_pu_bacteria 2923634449 2923634769 251
243 iso_pu_bacteria 2927833300 2927834176 251
244 iso_pu_bacteria 2937539931 2937541738 251
245 iso_pu_bacteria 2939568625 2939569108 251
246 iso_pu_bacteria 2939642701 2939643846 251
247 iso_pu_bacteria 2969079654 2969082577 251
248 iso_pu_bacteria 2974310843 2974312183 251
249 iso_pu_bacteria 2984559226 2984559639 251
250 iso_pu_bacteria 2984595703 2984597721 251
251 iso_pu_bacteria 8018405270 8018407848 251
252 iso_pu_bacteria 8055087960 8055090739 251
253 3300031727 Ga0316576_10023725 Ga0316576_100237253 252
254 3300035398 Ga0316574_0012656 Ga0316574_0012656_1554_2321 252
255 3300036712 Ga0316584_0020970 Ga0316584_0020970_942_1709 252
256 3300005467 Ga0070706_100000575 Ga0070706_10000057550 253
257 3300005536 Ga0070697_100000615 Ga0070697_10000061511 253
258 3300025910 Ga0207684_10000443 Ga0207684_1000044354 253
259 3300025929 Ga0207664_10493169 Ga0207664_104931691 253
260 iso_pu_bacteria 2923510766 2923513839 253
261 3300005564 Ga0070664_100344563 Ga0070664_1003445632 254
262 3300005937 Ga0081455_10035995 Ga0081455_100359952 254
263 3300005981 Ga0081538_10004229 Ga0081538_100042297 254
264 3300031548 Ga0307408_100018396 Ga0307408_1000183962 254
265 3300033541 Ga0316596_1040920 Ga0316596_10409201 254
266 3300049569 Ga0501032_0195206 Ga0501032_0195206_152_925 254
267 3300049572 Ga0501036_0014674 Ga0501036_0014674_4323_5096 254
268 3300049574 Ga0501038_0032333 Ga0501038_0032333_41_814 254
269 3300049575 Ga0501039_0060915 Ga0501039_0060915_515_1288 254
270 3300049576 Ga0501040_0040457 Ga0501040_0040457_640_1413 254
271 3300049577 Ga0501041_0241270 Ga0501041_0241270_293_1066 254
272 3300049578 Ga0501042_0046528 Ga0501042_0046528_1902_2675 254
273 3300049582 Ga0501048_0033655 Ga0501048_0033655_1675_2448 254
274 3300049584 Ga0501068_0241228 Ga0501068_0241228_98_871 254
275 3300049585 Ga0501069_0277019 Ga0501069_0277019_122_895 254
276 3300049587 Ga0501071_0010741 Ga0501071_0010741_2397_3170 254
277 3300049587 Ga0501071_0590304 Ga0501071_0590304_12_785 254
278 3300049588 Ga0501072_0025426 Ga0501072_0025426_2397_3170 254
279 3300049591 Ga0501075_0016758 Ga0501075_0016758_1243_2016 254
280 3300049591 Ga0501075_0048812 Ga0501075_0048812_1834_2607 254
281 3300049592 Ga0501076_0015876 Ga0501076_0015876_2739_3512 254
282 3300049593 Ga0501077_0017381 Ga0501077_0017381_2396_3169 254
283 3300049593 Ga0501077_0157022 Ga0501077_0157022_270_1043 254
284 3300049741 Ga0501079_0055899 Ga0501079_0055899_428_1201 254
285 3300049742 Ga0501080_0038923 Ga0501080_0038923_2109_2882 254
286 3300049743 Ga0501081_0042779 Ga0501081_0042779_1554_2327 254
287 3300049822 Ga0501035_0418050 Ga0501035_0418050_304_1077 254
288 3300049824 Ga0501045_0004002 Ga0501045_0004002_2437_3210 254
289 3300054114 Ga0501084_0013768 Ga0501084_0013768_3756_4529 254
290 3300060353 Ga0501082_0028434 Ga0501082_0028434_364_1137 254
291 3300061734 Ga0530510_0005135 Ga0530510_0005135_4017_4790 254
292 3300061734 Ga0530510_0237338 Ga0530510_0237338_142_915 254
293 iso_pu_bacteria 2828305725 2828307077 254
294 2162886007 SwRhRL2b_contig_1954747 SwRhRL2b_0274.00006710 255
295 2162886007 SwRhRL2b_contig_2924619 SwRhRL2b_0093.00007310 255
296 3300002704 JGI25155J39150_1000048 JGI25155J39150_100004833 255
297 3300002704 JGI25155J39150_1000162 JGI25155J39150_100016216 255
298 3300002705 JGI25156J39149_1000068 JGI25156J39149_100006837 255
299 3300002738 JGI25154J39366_1000066 JGI25154J39366_100006654 255
300 3300002738 JGI25154J39366_1000084 JGI25154J39366_100008437 255
301 3300002741 JGI25157J39369_1000097 JGI25157J39369_100009737 255
302 3300003322 rootL2_10081672 rootL2_100816722 255
303 3300003752 Ga0055539_1000049 Ga0055539_100004979 255
304 3300003756 Ga0055533_1000060 Ga0055533_100006079 255
305 3300003758 Ga0055532_1000015 Ga0055532_1000015174 255
306 3300003759 Ga0055525_1000068 Ga0055525_1000068115 255
307 3300003841 Ga0055541_1000036 Ga0055541_1000036115 255
308 3300003911 JGI25405J52794_10012741 JGI25405J52794_100127412 255
309 3300005289 Ga0065704_10000921 Ga0065704_1000092112 255
310 3300005343 Ga0070687_100471981 Ga0070687_1004719811 255
311 3300005347 Ga0070668_100271804 Ga0070668_1002718041 255
312 3300005354 Ga0070675_100016782 Ga0070675_1000167826 255
313 3300005445 Ga0070708_100211261 Ga0070708_1002112612 255
314 3300005458 Ga0070681_10494104 Ga0070681_104941041 255
315 3300005471 Ga0070698_100301557 Ga0070698_1003015572 255
316 3300005543 Ga0070672_100677071 Ga0070672_1006770711 255
317 3300005544 Ga0070686_100000004 Ga0070686_100000004164 255
318 3300005548 Ga0070665_100001044 Ga0070665_10000104414 255
319 3300005548 Ga0070665_100085809 Ga0070665_1000858093 255
320 3300005548 Ga0070665_100458894 Ga0070665_1004588942 255
321 3300005563 Ga0068855_100081586 Ga0068855_1000815862 255
322 3300005616 Ga0068852_100026807 Ga0068852_1000268073 255
323 3300005841 Ga0068863_100009600 Ga0068863_1000096007 255
324 3300005843 Ga0068860_100852382 Ga0068860_1008523822 255
325 3300005844 Ga0068862_100117392 Ga0068862_1001173923 255
326 3300005937 Ga0081455_10001955 Ga0081455_100019557 255
327 3300006042 Ga0075368_10004843 Ga0075368_100048435 255
328 3300006048 Ga0075363_100026226 Ga0075363_1000262262 255
329 3300006051 Ga0075364_10009211 Ga0075364_100092116 255
330 3300006051 Ga0075364_10037587 Ga0075364_100375874 255
331 3300006178 Ga0075367_10009346 Ga0075367_100093463 255
332 3300006852 Ga0075433_10000621 Ga0075433_1000062113 255
333 3300006852 Ga0075433_10016412 Ga0075433_100164123 255
334 3300006871 Ga0075434_100003713 Ga0075434_1000037132 255
335 3300006946 Ga0079104_1000486 Ga0079104_100048612 255
336 3300006946 Ga0079104_1003986 Ga0079104_10039866 255
337 3300006946 Ga0079104_1013664 Ga0079104_10136643 255
338 3300009011 Ga0105251_10008811 Ga0105251_100088116 255
339 3300009011 Ga0105251_10108447 Ga0105251_101084472 255
340 3300009036 Ga0105244_10000199 Ga0105244_100001994 255
341 3300009036 Ga0105244_10012216 Ga0105244_100122164 255
342 3300009093 Ga0105240_10000161 Ga0105240_10000161117 255
343 3300009093 Ga0105240_10000721 Ga0105240_1000072131 255
344 3300009093 Ga0105240_10034437 Ga0105240_100344377 255
345 3300009093 Ga0105240_10133441 Ga0105240_101334411 255
346 3300009148 Ga0105243_10222945 Ga0105243_102229452 255
347 3300009545 Ga0105237_10027708 Ga0105237_100277086 255
348 3300009551 Ga0105238_10036400 Ga0105238_100364002 255
349 3300009551 Ga0105238_10125603 Ga0105238_101256033 255
350 3300009551 Ga0105238_10282818 Ga0105238_102828182 255
351 3300009553 Ga0105249_10004858 Ga0105249_1000485815 255
352 3300010375 Ga0105239_10219907 Ga0105239_102199072 255
353 3300010375 Ga0105239_10446230 Ga0105239_104462302 255
354 3300013100 Ga0157373_10087320 Ga0157373_100873203 255
355 3300013104 Ga0157370_10002686 Ga0157370_1000268615 255
356 3300013308 Ga0157375_10034460 Ga0157375_100344604 255
357 3300014325 Ga0163163_10554584 Ga0163163_105545841 255
358 3300021388 Ga0213875_10126297 Ga0213875_101262973 255
359 3300025206 Ga0209435_100021 Ga0209435_10002127 255
360 3300025206 Ga0209435_100074 Ga0209435_10007423 255
361 3300025224 Ga0209784_100021 Ga0209784_100021179 255
362 3300025225 Ga0209566_100039 Ga0209566_100039180 255
363 3300025226 Ga0209674_100036 Ga0209674_100036179 255
364 3300025229 Ga0209147_100004 Ga0209147_100004739 255
365 3300025230 Ga0209563_100040 Ga0209563_100040179 255
366 3300025233 Ga0209437_100045 Ga0209437_10004595 255
367 3300025242 Ga0209258_100083 Ga0209258_100083170 255
368 3300025246 Ga0209646_1000057 Ga0209646_1000057142 255
369 3300025246 Ga0209646_1000074 Ga0209646_100007427 255
370 3300025250 Ga0209026_1000058 Ga0209026_1000058176 255
371 3300025250 Ga0209026_1002150 Ga0209026_10021502 255
372 3300025253 Ga0209677_100023 Ga0209677_100023179 255
373 3300025256 Ga0209759_1000046 Ga0209759_1000046175 255
374 3300025256 Ga0209759_1000112 Ga0209759_100011253 255
375 3300025272 Ga0209455_1008156 Ga0209455_10081562 255
376 3300025711 Ga0207696_1020680 Ga0207696_10206803 255
377 3300025728 Ga0207655_1000001 Ga0207655_10000011345 255
378 3300025728 Ga0207655_1000247 Ga0207655_10002478 255
379 3300025735 Ga0207713_1000002 Ga0207713_1000002312 255
380 3300025735 Ga0207713_1000427 Ga0207713_100042714 255
381 3300025735 Ga0207713_1025509 Ga0207713_10255092 255
382 3300025913 Ga0207695_10000776 Ga0207695_1000077617 255
383 3300025913 Ga0207695_10001397 Ga0207695_1000139720 255
384 3300025913 Ga0207695_10123700 Ga0207695_101237003 255
385 3300025913 Ga0207695_10683459 Ga0207695_106834591 255
386 3300025914 Ga0207671_10090769 Ga0207671_100907692 255
387 3300025918 Ga0207662_10234000 Ga0207662_102340002 255
388 3300025924 Ga0207694_10000041 Ga0207694_10000041154 255
389 3300025938 Ga0207704_10259767 Ga0207704_102597672 255
390 3300025940 Ga0207691_10396990 Ga0207691_103969901 255
391 3300025942 Ga0207689_10634290 Ga0207689_106342901 255
392 3300025949 Ga0207667_10000043 Ga0207667_1000004371 255
393 3300025961 Ga0207712_10090152 Ga0207712_100901522 255
394 3300025972 Ga0207668_10481854 Ga0207668_104818542 255
395 3300026075 Ga0207708_10153178 Ga0207708_101531781 255
396 3300026088 Ga0207641_10013538 Ga0207641_100135386 255
397 3300026142 Ga0207698_10093063 Ga0207698_100930632 255
398 3300027111 Ga0209281_1000004 Ga0209281_10000041104 255
399 3300027111 Ga0209281_1001709 Ga0209281_10017095 255
400 3300027312 Ga0209371_1000278 Ga0209371_100027812 255
401 3300027866 Ga0209813_10000317 Ga0209813_100003176 255
402 3300028379 Ga0268266_10003024 Ga0268266_100030247 255
403 3300028381 Ga0268264_10173312 Ga0268264_101733123 255
404 3300030500 Ga0268256_1000231 Ga0268256_100023112 255
405 3300031251 Ga0265327_10015107 Ga0265327_100151075 255
406 3300031548 Ga0307408_100000156 Ga0307408_10000015657 255
407 3300031548 Ga0307408_100052420 Ga0307408_1000524204 255
408 3300031727 Ga0316576_10124888 Ga0316576_101248881 255
409 3300031727 Ga0316576_10238954 Ga0316576_102389541 255
410 3300031728 Ga0316578_10000926 Ga0316578_100009268 255
411 3300031731 Ga0307405_10015026 Ga0307405_100150264 255
412 3300031731 Ga0307405_10021280 Ga0307405_100212803 255
413 3300031731 Ga0307405_10105407 Ga0307405_101054072 255
414 3300031824 Ga0307413_10005855 Ga0307413_100058557 255
415 3300031852 Ga0307410_10003925 Ga0307410_100039253 255
416 3300031852 Ga0307410_10469653 Ga0307410_104696531 255
417 3300031995 Ga0307409_100217066 Ga0307409_1002170662 255
418 3300031995 Ga0307409_100264445 Ga0307409_1002644452 255
419 3300031995 Ga0307409_100857787 Ga0307409_1008577871 255
420 3300032002 Ga0307416_100022109 Ga0307416_1000221094 255
421 3300032002 Ga0307416_100049454 Ga0307416_1000494544 255
422 3300032002 Ga0307416_100395191 Ga0307416_1003951911 255
423 3300032004 Ga0307414_10026949 Ga0307414_100269493 255
424 3300032005 Ga0307411_10054419 Ga0307411_100544192 255
425 3300032126 Ga0307415_100015485 Ga0307415_1000154854 255
426 3300032126 Ga0307415_100451667 Ga0307415_1004516671 255
427 3300034820 Ga0373959_0000113 Ga0373959_0000113_11226_12008 255
428 3300035241 Ga0373961_0032026 Ga0373961_0032026_632_1423 255
429 3300036712 Ga0316584_0217747 Ga0316584_0217747_233_1012 255
430 3300037312 Ga0395899_0100098 Ga0395899_0100098_543_1325 255
431 3300037418 Ga0395900_0137216 Ga0395900_0137216_1156_1938 255
432 3300037471 Ga0395905_0033946 Ga0395905_0033946_1780_2562 255
433 3300037853 Ga0436364_0181350 Ga0436364_0181350_285_1064 255
434 3300039447 Ga0436361_1219561 Ga0436361_1219561_797_1588 255
435 3300042006 Ga0439432_018275 Ga0439432_018275_507_1274 255
436 3300042010 Ga0439452_000014 Ga0439452_000014_28891_29658 255
437 3300046458 Ga0495591_000003 Ga0495591_000003_355462_356229 255
438 3300046462 Ga0495651_0026866 Ga0495651_0026866_3444_4223 255
439 3300046471 Ga0495650_0000005 Ga0495650_0000005_526615_527382 255
440 3300046471 Ga0495650_0021197 Ga0495650_0021197_1530_2297 255
441 3300046472 Ga0495580_0002211 Ga0495580_0002211_5712_6485 255
442 3300046501 Ga0495607_0000138 Ga0495607_0000138_35033_35812 255
443 3300046507 Ga0495606_0016414 Ga0495606_0016414_3242_4012 255
444 3300046514 Ga0495618_0131140 Ga0495618_0131140_377_1156 255
445 3300046516 Ga0495628_0000037 Ga0495628_0000037_27675_28454 255
446 3300046522 Ga0495643_0000286 Ga0495643_0000286_32165_32947 255
447 3300046524 Ga0495648_0011496 Ga0495648_0011496_3511_4290 255
448 3300046529 Ga0495652_0212407 Ga0495652_0212407_357_1136 255
449 3300046616 Ga0495668_0075216 Ga0495668_0075216_1012_1788 255
450 3300046660 Ga0495625_0001718 Ga0495625_0001718_13965_14771 255
451 3300046660 Ga0495625_0013150 Ga0495625_0013150_1020_1796 255
452 3300046665 Ga0495661_0000601 Ga0495661_0000601_34281_35060 255
453 3300046674 Ga0495588_0000261 Ga0495588_0000261_24645_25424 255
454 3300046679 Ga0495623_0006352 Ga0495623_0006352_3092_3871 255
455 3300046680 Ga0495646_0067168 Ga0495646_0067168_734_1513 255
456 3300047446 Ga0495679_070736 Ga0495679_070736_59_826 255
457 3300047469 Ga0495673_0001549 Ga0495673_0001549_11937_12704 255
458 3300048088 Ga0495602_0058674 Ga0495602_0058674_2092_2871 255
459 3300048907 Ga0496104_0000043 Ga0496104_0000043_18870_19637 255
460 3300048907 Ga0496104_0067080 Ga0496104_0067080_1148_1915 255
461 3300048907 Ga0496104_0387253 Ga0496104_0387253_412_1191 255
462 3300048908 Ga0496105_0044457 Ga0496105_0044457_793_1560 255
463 3300048908 Ga0496105_0400589 Ga0496105_0400589_112_879 255
464 3300048913 Ga0496110_0010739 Ga0496110_0010739_3469_4245 255
465 3300048917 Ga0496114_0057246 Ga0496114_0057246_1364_2143 255
466 3300048919 Ga0496116_0000877 Ga0496116_0000877_33879_34646 255
467 3300048919 Ga0496116_0025771 Ga0496116_0025771_1314_2081 255
468 3300048919 Ga0496116_0027914 Ga0496116_0027914_2019_2786 255
469 3300048919 Ga0496116_0038804 Ga0496116_0038804_538_1305 255
470 3300048919 Ga0496116_0040404 Ga0496116_0040404_2287_3081 255
471 3300048919 Ga0496116_0062952 Ga0496116_0062952_791_1558 255
472 3300048920 Ga0496117_0000020 Ga0496117_0000020_300213_300980 255
473 3300048920 Ga0496117_0004453 Ga0496117_0004453_10910_11677 255
474 3300048920 Ga0496117_0021990 Ga0496117_0021990_707_1474 255
475 3300048920 Ga0496117_0086189 Ga0496117_0086189_572_1339 255
476 3300048921 Ga0496118_0000015 Ga0496118_0000015_315428_316195 255
477 3300048921 Ga0496118_0023833 Ga0496118_0023833_3268_4035 255
478 3300048921 Ga0496118_0045225 Ga0496118_0045225_2236_3003 255
479 3300048922 Ga0496119_0003849 Ga0496119_0003849_6712_7479 255
480 3300048922 Ga0496119_0005039 Ga0496119_0005039_3703_4470 255
481 3300048922 Ga0496119_0057863 Ga0496119_0057863_135_902 255
482 3300048922 Ga0496119_0146540 Ga0496119_0146540_453_1220 255
483 3300048923 Ga0496120_0000497 Ga0496120_0000497_10186_10953 255
484 3300048923 Ga0496120_0002649 Ga0496120_0002649_3233_4000 255
485 3300048923 Ga0496120_0003690 Ga0496120_0003690_4020_4787 255
486 3300048923 Ga0496120_0032497 Ga0496120_0032497_905_1672 255
487 3300048924 Ga0496121_0000760 Ga0496121_0000760_1148_1915 255
488 3300048924 Ga0496121_0003938 Ga0496121_0003938_3394_4161 255
489 3300048924 Ga0496121_0013513 Ga0496121_0013513_630_1397 255
490 3300048924 Ga0496121_0015948 Ga0496121_0015948_5044_5811 255
491 3300048924 Ga0496121_0018603 Ga0496121_0018603_6119_6886 255
492 3300048924 Ga0496121_0023348 Ga0496121_0023348_3104_3871 255
493 3300048924 Ga0496121_0077819 Ga0496121_0077819_1400_2167 255
494 3300048924 Ga0496121_0117777 Ga0496121_0117777_946_1722 255
495 3300048925 Ga0496122_0000005 Ga0496122_0000005_270585_271352 255
496 3300048925 Ga0496122_0000491 Ga0496122_0000491_65516_66310 255
497 3300048925 Ga0496122_0004047 Ga0496122_0004047_2078_2845 255
498 3300048925 Ga0496122_0005153 Ga0496122_0005153_8443_9219 255
499 3300048925 Ga0496122_0006470 Ga0496122_0006470_11674_12441 255
500 3300048925 Ga0496122_0029718 Ga0496122_0029718_2406_3173 255
501 3300048925 Ga0496122_0040104 Ga0496122_0040104_2240_3007 255
502 3300048925 Ga0496122_0177846 Ga0496122_0177846_380_1147 255
503 3300048925 Ga0496122_0244031 Ga0496122_0244031_59_826 255
504 3300048926 Ga0496123_0000008 Ga0496123_0000008_359277_360044 255
505 3300048926 Ga0496123_0000488 Ga0496123_0000488_57604_58398 255
506 3300048926 Ga0496123_0006397 Ga0496123_0006397_1227_1994 255
507 3300048927 Ga0496124_0004679 Ga0496124_0004679_14494_15261 255
508 3300048927 Ga0496124_0008418 Ga0496124_0008418_4719_5486 255
509 3300048927 Ga0496124_0021594 Ga0496124_0021594_3321_4088 255
510 3300048927 Ga0496124_0039284 Ga0496124_0039284_2679_3446 255
511 3300048927 Ga0496124_0227345 Ga0496124_0227345_255_1022 255
512 3300048927 Ga0496124_0430813 Ga0496124_0430813_50_817 255
513 3300048928 Ga0496125_0000757 Ga0496125_0000757_22542_23336 255
514 3300048928 Ga0496125_0003692 Ga0496125_0003692_2276_3043 255
515 3300048928 Ga0496125_0013645 Ga0496125_0013645_842_1609 255
516 3300048928 Ga0496125_0019324 Ga0496125_0019324_3354_4121 255
517 3300048928 Ga0496125_0051682 Ga0496125_0051682_2162_2929 255
518 3300048928 Ga0496125_0127447 Ga0496125_0127447_799_1575 255
519 3300048928 Ga0496125_0156587 Ga0496125_0156587_651_1418 255
520 3300048929 Ga0496126_0003795 Ga0496126_0003795_14833_15600 255
521 3300048929 Ga0496126_0020397 Ga0496126_0020397_1998_2765 255
522 3300048929 Ga0496126_0072827 Ga0496126_0072827_843_1610 255
523 3300048929 Ga0496126_0252116 Ga0496126_0252116_238_1017 255
524 3300048929 Ga0496126_0265037 Ga0496126_0265037_120_887 255
525 3300050491 nmdc:mga00v17_559_c3 nmdc:mga00v17_559_c3_10_777 255
526 3300050494 nmdc:mga06z11_11389_c1 nmdc:mga06z11_11389_c1_1609_2412 255
527 3300050495 nmdc:mga04h51_2600_c1 nmdc:mga04h51_2600_c1_872_1675 255
528 3300050507 nmdc:mga05p37_133895_c1 nmdc:mga05p37_133895_c1_94_879 255
529 3300050513 nmdc:mga0rr50_431901_c1 nmdc:mga0rr50_431901_c1_268_1041 255
530 3300050514 nmdc:mga08x19_46611_c1 nmdc:mga08x19_46611_c1_1736_2509 255
531 3300050515 nmdc:mga0a205_15541_c1 nmdc:mga0a205_15541_c1_2918_3691 255
532 3300050515 nmdc:mga0a205_3215_c1 nmdc:mga0a205_3215_c1_1231_2004 255
533 3300053077 Ga0495601_0146643 Ga0495601_0146643_638_1417 255
534 3300053087 Ga0500643_000172 Ga0500643_000172_19164_19940 255
535 3300053087 Ga0500643_038257 Ga0500643_038257_489_1265 255
536 3300053104 Ga0500556_0000136 Ga0500556_0000136_33305_34081 255
537 3300053125 Ga0500618_000753 Ga0500618_000753_8715_9503 255
538 3300053129 Ga0500628_001253 Ga0500628_001253_2572_3354 255
539 3300053130 Ga0500642_0000003 Ga0500642_0000003_299784_300560 255
540 3300053136 Ga0500559_0003399 Ga0500559_0003399_3125_3901 255
541 3300053730 Ga0500645_000261 Ga0500645_000261_10144_10920 255
542 3300055283 Ga0500661_000324 Ga0500661_000324_4521_5297 255
543 iso_pu_bacteria 2511231003 2511249083 255
544 iso_pu_bacteria 2511231026 2511387228 255
545 iso_pu_bacteria 2818991445 2819592315 255
546 iso_pu_bacteria 2884811622 2884816253 255
547 iso_pu_bacteria 2884836552 2884840268 255
548 iso_pu_bacteria 2884852848 2884856966 255
549 iso_pu_bacteria 2896154374 2896157551 255
550 iso_pu_bacteria 2919046199 2919049034 255
551 iso_pu_bacteria 2928130867 2928134317 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

39

287

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

44

217

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.99 1 255
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9862 1 255
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9828 3 253
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9816 3 255
3q0g-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa 0.9778 3 253
ID Description Score Start End Superfamily
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 1.007 198 255 1.10.12.10
2qq3D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9921 199 254 1.10.12.10
4fzwB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9918 1 197 3.90.226.10
3h81B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9903 198 253 1.10.12.10
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9899 198 255 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2W5U094-F1-model_v4 2,3-dehydroadipyl-CoA hydratase 0.9994 1 205 GO:0003824
GO:0006635
AF-A0A5E6SNG9-F1-model_v4 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) 0.9983 2 255 GO:0004300
GO:0006635
AF-A0A7W3GAB6-F1-model_v4 deleted 0.9979 1 255
AF-A0A7H4MJ55-F1-model_v4 Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17) 0.9978 1 255 GO:0004300
GO:0006635
GO:0051537
AF-A0A7W4I0L4-F1-model_v4 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) 0.9978 1 255 GO:0004300
GO:0006635

Feature Viewer

pLDDT pTM Quality
96.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map